F337941

General Info

Members Datasets Scaffolds Average Seq Length
225 148 450 195

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10269131|Ga0307516_102691312
Length 201
Sequence VRQKDDPRLRSDAQRNRERILEVALAELSRAADTPLSAIAKKAGVGQGTFYRNFPNRETLVLELYRHGVQQIADSASELLETREPDRALRAWMDHLAGFAMTKAGLAEAIRQATSSGTAAKPGHTPVTDAAGLLLRACEEAGTIRPGVTADDFMLAIAGLWQLTPHDDWQSRATRLLDIVMDGLRAGAPGPQGLPGGSDRL

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
9 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
10 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
11 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
12 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
14 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
15 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
16 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
17 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
18 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
19 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
20 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
21 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
22 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
23 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
24 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
25 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
26 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
27 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
28 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
29 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
30 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
31 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
32 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
33 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
34 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
35 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
36 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
37 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
38 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
39 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
40 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
41 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
42 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
43 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
44 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
45 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
46 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
47 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
48 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
49 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
50 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
51 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
52 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
53 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
54 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
55 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
56 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
57 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
58 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
59 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
60 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
61 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
62 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
63 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
64 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
65 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
68 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
73 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
74 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
75 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
76 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
77 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
82 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
85 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
89 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
90 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
114 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
116 2511231022 Pseudomonas sp. GM79 Isolate Nodule
117 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
118 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
119 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
120 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
121 2643221647 Streptomyces sp. Root369 Isolate Unclassified
122 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
123 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
124 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
125 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
126 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
127 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
128 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
129 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
130 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
131 2862574272 Streptomyces sp. AcE210 Isolate Nodule
132 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
133 2867428634 Streptomyces sp. RP5T Isolate Unclassified
134 2867475112 Streptomyces sp. TM32 Isolate Unclassified
135 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
136 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
137 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
138 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
139 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
140 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
141 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
142 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
143 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
144 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
145 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
146 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
147 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
148 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80
Metatranscriptomes 0
Isolates 20

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.78
Nodule 2.22
Rhizoplane 1.78
Rhizosphere 81.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10269131 3300031730 Bacteria 1391
2 rootH1_10019582 3300003316 Bacteria 4023
3 rootH2_10013574 3300003320 Bacteria 28972
4 rootL2_10015084 3300003322 Bacteria 2826
5 rootH1_10074074 3300003323 Bacteria 3571
6 JGI25160J50197_1002334 3300003354 Bacteria 8880
7 Ga0070714_100013525 3300005435 Bacteria 6541
8 Ga0105238_10978212 3300009551 Bacteria 867
9 Ga0105239_10729602 3300010375 Bacteria 1134
10 Ga0157370_10000853 3300013104 Bacteria 38670
11 Ga0207426_1000760 3300025302 Bacteria 35891
12 Ga0207426_1003430 3300025302 Bacteria 8631
13 Ga0207664_10050562 3300025929 Bacteria 3278
14 Ga0307512_10041953 3300030522 Bacteria 3796
15 Ga0307508_10010034 3300031616 Bacteria 8676
16 Ga0307514_10003170 3300031649 Bacteria 16089
17 Ga0307514_10035284 3300031649 Bacteria 3980
18 Ga0307514_10132169 3300031649 Bacteria 1716
19 Ga0307516_10006713 3300031730 Bacteria 13448
20 Ga0307516_10020835 3300031730 Bacteria 6766
21 Ga0307516_10030239 3300031730 Bacteria 5468
22 Ga0307510_10046965 3300033180 Bacteria 4634
23 Ga0395901_1248041 3300038443 Bacteria 707
24 Ga0439436_0000450 3300041404 Bacteria 10505
25 Ga0439436_0000664 3300041404 Bacteria 9190
26 Ga0439439_0005336 3300041406 Bacteria 2932
27 Ga0439465_0146165 3300041413 Bacteria 842
28 Ga0451802_1165734 3300041460 Bacteria 1146
29 Ga0451841_0008731 3300041498 Bacteria 1390
30 Ga0451853_2321433 3300041512 Bacteria 4744
31 Ga0439442_010440 3300042002 Bacteria 1883
32 Ga0439449_0016465 3300042007 Bacteria 2778
33 Ga0439449_0045847 3300042007 Bacteria 1620
34 Ga0439450_135728 3300042008 Bacteria 640
35 Ga0439457_000791 3300042014 Bacteria 9431
36 Ga0439457_004704 3300042014 Bacteria 3528
37 Ga0450903_000099 3300042138 Bacteria 18213
38 Ga0439458_0000593 3300042157 Bacteria 9326
39 Ga0466969_0139259 3300044656 Bacteria 1122
40 Ga0466972_0051257 3300044658 Bacteria 1991
41 Ga0466965_0001381 3300044683 Bacteria 9748
42 Ga0466966_0029058 3300044684 Bacteria 3598
43 Ga0466961_0003324 3300044693 Bacteria 10032
44 Ga0466964_0002881 3300044706 Bacteria 6208
45 Ga0466971_0012249 3300044719 Bacteria 3756
46 Ga0466970_0027498 3300044765 Bacteria 2984
47 Ga0466958_0000924 3300045836 Bacteria 13221
48 Ga0466967_0031007 3300045976 Bacteria 4495
49 Ga0466967_0086729 3300045976 Bacteria 2836
50 Ga0495592_0102786 3300046454 Bacteria 2034
51 Ga0495603_0076177 3300046455 Bacteria 1969
52 Ga0495603_0085508 3300046455 Bacteria 1846
53 Ga0495629_0033569 3300046459 Bacteria 3629
54 Ga0495629_0281649 3300046459 Bacteria 1141
55 Ga0495638_0296179 3300046460 Bacteria 873
56 Ga0495651_0066958 3300046462 Bacteria 2740
57 Ga0495580_0211839 3300046472 Bacteria 1333
58 Ga0495605_0020357 3300046474 Bacteria 3526
59 Ga0495662_0058278 3300046476 Bacteria 1865
60 Ga0495584_0067359 3300046491 Bacteria 1800
61 Ga0495585_0029423 3300046492 Bacteria 3127
62 Ga0495594_0066629 3300046499 Bacteria 1998
63 Ga0495607_0075643 3300046501 Bacteria 1865
64 Ga0495607_0132065 3300046501 Bacteria 1298
65 Ga0495606_0009690 3300046507 Bacteria 8106
66 Ga0495616_0005639 3300046513 Bacteria 7663
67 Ga0495620_0018507 3300046515 Bacteria 3448
68 Ga0495620_0019605 3300046515 Bacteria 3321
69 Ga0495628_0052076 3300046516 Bacteria 3234
70 Ga0495631_0032370 3300046518 Bacteria 2359
71 Ga0495631_0064482 3300046518 Bacteria 1586
72 Ga0495631_0108702 3300046518 Bacteria 1192
73 Ga0495643_0004235 3300046522 Bacteria 10153
74 Ga0495648_0039955 3300046524 Bacteria 2980
75 Ga0495642_0072886 3300046528 Bacteria 1438
76 Ga0495652_0244482 3300046529 Bacteria 1333
77 Ga0495640_0021484 3300046533 Bacteria 4735
78 Ga0495622_0021196 3300046557 Bacteria 3027
79 Ga0495668_0052760 3300046616 Bacteria 2249
80 Ga0495634_0320912 3300046642 Bacteria 932
81 Ga0495611_0018550 3300046648 Bacteria 2984
82 Ga0495625_0041353 3300046660 Bacteria 3356
83 Ga0495625_0041754 3300046660 Bacteria 3337
84 Ga0495625_0070116 3300046660 Bacteria 2461
85 Ga0495661_0169969 3300046665 Bacteria 1163
86 Ga0495657_0058370 3300046675 Bacteria 2562
87 Ga0495613_0008268 3300046689 Bacteria 7723
88 Ga0495613_0039979 3300046689 Bacteria 3475
89 Ga0495613_0195833 3300046689 Bacteria 1426
90 Ga0495613_0232663 3300046689 Bacteria 1290
91 Ga0495624_0032593 3300046690 Bacteria 3378
92 Ga0495624_0040149 3300046690 Bacteria 2998
93 Ga0495670_0060855 3300046691 Bacteria 1897
94 Ga0495671_0046375 3300046692 Bacteria 2173
95 Ga0495649_0015718 3300046694 Bacteria 4303
96 Ga0495589_0005595 3300046794 Bacteria 6627
97 Ga0495589_0007150 3300046794 Bacteria 5849
98 Ga0495589_0015461 3300046794 Bacteria 3926
99 Ga0495589_0016894 3300046794 Bacteria 3747
100 Ga0495600_0191144 3300046809 Bacteria 1316
101 Ga0495600_0323022 3300046809 Bacteria 970
102 Ga0495660_0089091 3300046810 Bacteria 1606
103 Ga0495660_0182129 3300046810 Bacteria 1015
104 Ga0495581_0093596 3300047315 Bacteria 1744
105 Ga0495581_0415457 3300047315 Bacteria 784
106 Ga0495604_0014252 3300047317 Bacteria 6337
107 Ga0495636_0028778 3300047318 Bacteria 2267
108 Ga0495676_0034225 3300047321 Bacteria 4265
109 Ga0495676_0034752 3300047321 Bacteria 4225
110 Ga0495683_0077027 3300047323 Bacteria 1630
111 Ga0495687_005607 3300047443 Bacteria 7936
112 Ga0495687_010178 3300047443 Bacteria 5174
113 Ga0495675_0143863 3300047444 Bacteria 1477
114 Ga0495685_000489 3300047447 Bacteria 12254
115 Ga0495685_002735 3300047447 Bacteria 5559
116 Ga0495685_009407 3300047447 Bacteria 3262
117 Ga0495685_046795 3300047447 Bacteria 1471
118 Ga0495681_0087185 3300047470 Bacteria 1384
119 Ga0495684_0283073 3300047471 Bacteria 1196
120 Ga0495686_0114037 3300047472 Bacteria 1618
121 Ga0495686_0382173 3300047472 Bacteria 759
122 Ga0495593_0183543 3300047673 Bacteria 1053
123 Ga0495614_0057080 3300048089 Bacteria 1676
124 Ga0495614_0110894 3300048089 Bacteria 1204
125 Ga0495626_0015237 3300048091 Bacteria 3940
126 Ga0496102_0854757 3300048905 Bacteria 832
127 Ga0496109_0072042 3300048912 Bacteria 3173
128 Ga0496110_0280842 3300048913 Bacteria 1516
129 Ga0495682_0013885 3300049460 Bacteria 3058
130 Ga0495682_0103917 3300049460 Bacteria 1019
131 Ga0501031_0027251 3300049568 Bacteria 3726
132 Ga0501031_0033616 3300049568 Bacteria 3346
133 Ga0501032_0008683 3300049569 Bacteria 7402
134 Ga0501033_0001228 3300049570 Bacteria 22982
135 Ga0501033_0032322 3300049570 Bacteria 3930
136 Ga0501034_0002717 3300049571 Bacteria 20840
137 Ga0501034_0021115 3300049571 Bacteria 6643
138 Ga0501034_0053485 3300049571 Bacteria 4065
139 Ga0501034_0185118 3300049571 Bacteria 2046
140 Ga0501036_0019401 3300049572 Bacteria 5707
141 Ga0501036_0171749 3300049572 Bacteria 1826
142 Ga0501036_0332042 3300049572 Bacteria 1270
143 Ga0501036_0670977 3300049572 Bacteria 857
144 Ga0501037_0005606 3300049573 Bacteria 9149
145 Ga0501037_0052466 3300049573 Bacteria 2982
146 Ga0501037_0123469 3300049573 Bacteria 1860
147 Ga0501037_0280643 3300049573 Bacteria 1161
148 Ga0501038_0000239 3300049574 Bacteria 46316
149 Ga0501038_0020688 3300049574 Bacteria 5915
150 Ga0501038_0291580 3300049574 Bacteria 1282
151 Ga0501039_0001504 3300049575 Bacteria 17163
152 Ga0501042_0072987 3300049578 Bacteria 2455
153 Ga0501043_0001120 3300049579 Bacteria 23524
154 Ga0501043_0005096 3300049579 Bacteria 10635
155 Ga0501043_0053739 3300049579 Bacteria 3163
156 Ga0501043_0486114 3300049579 Bacteria 924
157 Ga0501046_0007718 3300049580 Bacteria 9432
158 Ga0501047_0020491 3300049581 Bacteria 6348
159 Ga0501047_0024709 3300049581 Bacteria 5769
160 Ga0501047_0098051 3300049581 Bacteria 2809
161 Ga0501047_0130144 3300049581 Bacteria 2397
162 Ga0501047_0650674 3300049581 Bacteria 873
163 Ga0501048_0013658 3300049582 Bacteria 6024
164 Ga0501048_0145858 3300049582 Bacteria 1674
165 Ga0501048_0412807 3300049582 Bacteria 965
166 Ga0501070_0002406 3300049586 Bacteria 16417
167 Ga0501070_0247340 3300049586 Bacteria 1459
168 Ga0501070_0611145 3300049586 Bacteria 868
169 Ga0501070_0620424 3300049586 Bacteria 861
170 Ga0501074_0140069 3300049590 Bacteria 1730
171 Ga0501080_0030154 3300049742 Bacteria 5053
172 Ga0501080_0095590 3300049742 Bacteria 2759
173 Ga0501035_0000667 3300049822 Bacteria 37784
174 Ga0501035_0058435 3300049822 Bacteria 3436
175 Ga0501035_0348079 3300049822 Bacteria 1240
176 Ga0501044_0009074 3300049823 Bacteria 10870
177 Ga0501044_0013085 3300049823 Bacteria 8980
178 Ga0495655_0069756 3300053083 Bacteria 980
179 Ga0500578_0076516 3300053086 Bacteria 2131
180 Ga0466962_0000983 3300061719 Bacteria 12982
181 2511365542 2511231022 Bacteria 6719296
182 2585306599 2582581313 Bacteria 10042643
183 2585311133 2582581313 Bacteria 10042643
184 2585320083 2582581314 Bacteria 11452267
185 2616693235 2616644814 Bacteria 11555299
186 2616904301 2616644941 Bacteria 8510691
187 2644268479 2643221647 Bacteria 10741251
188 2689991678 2687453743 Bacteria 8361025
189 2784586385 2784132148 Bacteria 8627943
190 2785372907 2784746768 Bacteria 10036182
191 2785372980 2784746768 Bacteria 10036182
192 2786666543 2786546132 Bacteria 10419719
193 2808916438 2808606375 Bacteria 9466072
194 2812354103 2811994879 Bacteria 9313447
195 2852635795 2852635781 Bacteria 8251373
196 2862178734 2862178590 Bacteria 8583590
197 2862385015 2862382967 Bacteria 10317375
198 2862580357 2862574272 Bacteria 10567477
199 2863412260 2863404153 Bacteria 9672205
200 2867430239 2867428634 Bacteria 9590268
201 2867476695 2867475112 Bacteria 6909112
202 2875398075 2875391855 Bacteria 7600475
203 2946071597 2946064051 Bacteria 8957905
204 2954681615 2954673503 Bacteria 9685905
205 2954711641 2954711539 Bacteria 10867210
206 2954719687 2954711539 Bacteria 10867210
207 2954720875 2954711539 Bacteria 10867210
208 2954721564 2954721474 Bacteria 10456478
209 2954729721 2954721474 Bacteria 10456478
210 2954730427 2954721474 Bacteria 10456478
211 2954731616 2954731030 Bacteria 10243860
212 2954732087 2954731030 Bacteria 10243860
213 2954740468 2954740390 Bacteria 10229294
214 2954748626 2954740390 Bacteria 10229294
215 2954749141 2954740390 Bacteria 10229294
216 2954750326 2954749733 Bacteria 10366972
217 2954751027 2954749733 Bacteria 10366972
218 2954759092 2954749733 Bacteria 10366972
219 2954759492 2954759201 Bacteria 9358192
220 2954767743 2954759201 Bacteria 9358192
221 2966605346 2966598605 Bacteria 7676064
222 2990062109 2990059506 Bacteria 9321252
223 2997453586 2997451912 Bacteria 8492419
224 8008560558 8008558824 Bacteria 10610750
225 8023626046 8023623736 Bacteria 8593882
226 Ga0307516_10269131
227 rootH1_10019582
228 rootH2_10013574
229 rootL2_10015084
230 rootH1_10074074
231 JGI25160J50197_1002334
232 Ga0070714_100013525
233 Ga0105238_10978212
234 Ga0105239_10729602
235 Ga0157370_10000853
236 Ga0207426_1000760
237 Ga0207426_1003430
238 Ga0207664_10050562
239 Ga0307512_10041953
240 Ga0307508_10010034
241 Ga0307514_10003170
242 Ga0307514_10035284
243 Ga0307514_10132169
244 Ga0307516_10006713
245 Ga0307516_10020835
246 Ga0307516_10030239
247 Ga0307510_10046965
248 Ga0395901_1248041
249 Ga0439436_0000450
250 Ga0439436_0000664
251 Ga0439439_0005336
252 Ga0439465_0146165
253 Ga0451802_1165734
254 Ga0451841_0008731
255 Ga0451853_2321433
256 Ga0439442_010440
257 Ga0439449_0016465
258 Ga0439449_0045847
259 Ga0439450_135728
260 Ga0439457_000791
261 Ga0439457_004704
262 Ga0450903_000099
263 Ga0439458_0000593
264 Ga0466969_0139259
265 Ga0466972_0051257
266 Ga0466965_0001381
267 Ga0466966_0029058
268 Ga0466961_0003324
269 Ga0466964_0002881
270 Ga0466971_0012249
271 Ga0466970_0027498
272 Ga0466958_0000924
273 Ga0466967_0031007
274 Ga0466967_0086729
275 Ga0495592_0102786
276 Ga0495603_0076177
277 Ga0495603_0085508
278 Ga0495629_0033569
279 Ga0495629_0281649
280 Ga0495638_0296179
281 Ga0495651_0066958
282 Ga0495580_0211839
283 Ga0495605_0020357
284 Ga0495662_0058278
285 Ga0495584_0067359
286 Ga0495585_0029423
287 Ga0495594_0066629
288 Ga0495607_0075643
289 Ga0495607_0132065
290 Ga0495606_0009690
291 Ga0495616_0005639
292 Ga0495620_0018507
293 Ga0495620_0019605
294 Ga0495628_0052076
295 Ga0495631_0032370
296 Ga0495631_0064482
297 Ga0495631_0108702
298 Ga0495643_0004235
299 Ga0495648_0039955
300 Ga0495642_0072886
301 Ga0495652_0244482
302 Ga0495640_0021484
303 Ga0495622_0021196
304 Ga0495668_0052760
305 Ga0495634_0320912
306 Ga0495611_0018550
307 Ga0495625_0041353
308 Ga0495625_0041754
309 Ga0495625_0070116
310 Ga0495661_0169969
311 Ga0495657_0058370
312 Ga0495613_0008268
313 Ga0495613_0039979
314 Ga0495613_0195833
315 Ga0495613_0232663
316 Ga0495624_0032593
317 Ga0495624_0040149
318 Ga0495670_0060855
319 Ga0495671_0046375
320 Ga0495649_0015718
321 Ga0495589_0005595
322 Ga0495589_0007150
323 Ga0495589_0015461
324 Ga0495589_0016894
325 Ga0495600_0191144
326 Ga0495600_0323022
327 Ga0495660_0089091
328 Ga0495660_0182129
329 Ga0495581_0093596
330 Ga0495581_0415457
331 Ga0495604_0014252
332 Ga0495636_0028778
333 Ga0495676_0034225
334 Ga0495676_0034752
335 Ga0495683_0077027
336 Ga0495687_005607
337 Ga0495687_010178
338 Ga0495675_0143863
339 Ga0495685_000489
340 Ga0495685_002735
341 Ga0495685_009407
342 Ga0495685_046795
343 Ga0495681_0087185
344 Ga0495684_0283073
345 Ga0495686_0114037
346 Ga0495686_0382173
347 Ga0495593_0183543
348 Ga0495614_0057080
349 Ga0495614_0110894
350 Ga0495626_0015237
351 Ga0496102_0854757
352 Ga0496109_0072042
353 Ga0496110_0280842
354 Ga0495682_0013885
355 Ga0495682_0103917
356 Ga0501031_0027251
357 Ga0501031_0033616
358 Ga0501032_0008683
359 Ga0501033_0001228
360 Ga0501033_0032322
361 Ga0501034_0002717
362 Ga0501034_0021115
363 Ga0501034_0053485
364 Ga0501034_0185118
365 Ga0501036_0019401
366 Ga0501036_0171749
367 Ga0501036_0332042
368 Ga0501036_0670977
369 Ga0501037_0005606
370 Ga0501037_0052466
371 Ga0501037_0123469
372 Ga0501037_0280643
373 Ga0501038_0000239
374 Ga0501038_0020688
375 Ga0501038_0291580
376 Ga0501039_0001504
377 Ga0501042_0072987
378 Ga0501043_0001120
379 Ga0501043_0005096
380 Ga0501043_0053739
381 Ga0501043_0486114
382 Ga0501046_0007718
383 Ga0501047_0020491
384 Ga0501047_0024709
385 Ga0501047_0098051
386 Ga0501047_0130144
387 Ga0501047_0650674
388 Ga0501048_0013658
389 Ga0501048_0145858
390 Ga0501048_0412807
391 Ga0501070_0002406
392 Ga0501070_0247340
393 Ga0501070_0611145
394 Ga0501070_0620424
395 Ga0501074_0140069
396 Ga0501080_0030154
397 Ga0501080_0095590
398 Ga0501035_0000667
399 Ga0501035_0058435
400 Ga0501035_0348079
401 Ga0501044_0009074
402 Ga0501044_0013085
403 Ga0495655_0069756
404 Ga0500578_0076516
405 Ga0466962_0000983
406 2511365542
407 2585306599
408 2585311133
409 2585320083
410 2616693235
411 2616904301
412 2644268479
413 2689991678
414 2784586385
415 2785372907
416 2785372980
417 2786666543
418 2808916438
419 2812354103
420 2852635795
421 2862178734
422 2862385015
423 2862580357
424 2863412260
425 2867430239
426 2867476695
427 2875398075
428 2946071597
429 2954681615
430 2954711641
431 2954719687
432 2954720875
433 2954721564
434 2954729721
435 2954730427
436 2954731616
437 2954732087
438 2954740468
439 2954748626
440 2954749141
441 2954750326
442 2954751027
443 2954759092
444 2954759492
445 2954767743
446 2966605346
447 2990062109
448 2997453586
449 8008560558
450 8023626046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21597

TetR_C_43

Transcriptional regulator SbtR-like, C-terminal domain

84

186

0.91

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

20

64

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q24-assembly1.cif.gz_B crystal structure of tetr transcriptional regulator sco0520 from streptomyces coelicolor 0.9018 17 186
2q24-assembly1.cif.gz_B crystal structure of tetr transcriptional regulator sco0520 from streptomyces coelicolor 0.8731 17 186
2qwt-assembly1.cif.gz_A crystal structure of the tetr transcription regulatory protein from mycobacterium vanbaalenii 0.806 8 186
2rek-assembly1.cif.gz_A crystal structure of tetr-family transcriptional regulator 0.804 12 185
2qwt-assembly1.cif.gz_A crystal structure of the tetr transcription regulatory protein from mycobacterium vanbaalenii 0.7973 8 186
ID Description Score Start End Superfamily
2q24A00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9141 17 186 1.10.357.10
2q24A00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.8989 17 186 1.10.357.10
2qwtA00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.806 8 186 1.10.357.10
2rekA00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.804 12 185 1.10.357.10
2qwtA00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.7973 8 186 1.10.357.10
ID Description Score Start End GO Terms
AF-A0A498E227-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9789 10 186 GO:0000976
GO:0003700
AF-A0A0M9YQ87-F1-model_v4 TetR family transcriptional regulator 0.9715 22 192 GO:0000976
GO:0003700
AF-A0A0M9YQ87-F1-model_v4 TetR family transcriptional regulator 0.9605 22 192 GO:0000976
GO:0003700
AF-A0A499V4K7-F1-model_v4 HTH tetR-type domain-containing protein 0.9584 1 150 GO:0000976
GO:0003700
AF-A0A6B1LZ51-F1-model_v4 deleted 0.9513 9 190

Map