F337928

General Info

Members Datasets Scaffolds Average Seq Length
225 146 450 140

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10062765|Ga0307509_100627654
Length 132
Sequence MDNNGPIIIIEDDXXXQDIIKEIFDGLNYPNEIIFFLNSEKALAPFLIMSDINMPVLNGFALRDKIRTDAKLHTKCIPYLFFSTASNQKTVIDAYSLSVQGFFVKHASLSELEKTIKVIMEYWKRCVAPNDF

Samples

Sample ID Description Type Environment
1 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
125 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
126 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
132 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
133 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
134 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
135 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
136 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
137 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
138 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
139 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
140 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
141 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
142 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
145 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
146 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.56
Nodule 0
Rhizoplane 2.22
Rhizosphere 92
Stem 0
Stem Tuber 0
Unclassified 15.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307509_10062765 3300031507 Bacteria 3916
2 Ga0055530_10052158 3300003791 Bacteria 945
3 Ga0065165_1083161 3300005262 Bacteria 827
4 Ga0065712_10098457 3300005290 Bacteria 2118
5 Ga0070658_10000869 3300005327 Bacteria 25832
6 Ga0070658_11588163 3300005327 Bacteria 567
7 Ga0070676_10000097 3300005328 Bacteria 30711
8 Ga0070683_100324260 3300005329 Bacteria 1466
9 Ga0070683_100511641 3300005329 Bacteria 1147
10 Ga0070683_101532667 3300005329 Unclassified 641
11 Ga0070690_100335004 3300005330 Bacteria 1094
12 Ga0070670_100362088 3300005331 Unclassified 1275
13 Ga0070666_10009847 3300005335 Bacteria 5968
14 Ga0070666_10031357 3300005335 Bacteria 3509
15 Ga0070682_100546851 3300005337 Bacteria 905
16 Ga0070682_100562360 3300005337 Bacteria 894
17 Ga0068868_100014890 3300005338 Bacteria 5741
18 Ga0070660_100554237 3300005339 Unclassified 959
19 Ga0070661_100057496 3300005344 Bacteria 2850
20 Ga0070661_100139818 3300005344 Bacteria 1824
21 Ga0070661_100172411 3300005344 Bacteria 1643
22 Ga0070668_100052633 3300005347 Bacteria 3138
23 Ga0070675_100135794 3300005354 Bacteria 2099
24 Ga0070671_100545706 3300005355 Unclassified 999
25 Ga0070671_101060057 3300005355 Unclassified 711
26 Ga0070674_100281927 3300005356 Bacteria 1317
27 Ga0070673_100009111 3300005364 Bacteria 6647
28 Ga0070688_100556742 3300005365 Bacteria 872
29 Ga0070659_100004638 3300005366 Bacteria 9818
30 Ga0070667_100001108 3300005367 Bacteria 24656
31 Ga0070678_100094624 3300005456 Bacteria 2300
32 Ga0070662_100003073 3300005457 Bacteria 10365
33 Ga0068867_100001305 3300005459 Bacteria 17233
34 Ga0070684_100016775 3300005535 Bacteria 5994
35 Ga0070684_101678397 3300005535 Unclassified 599
36 Ga0068853_100752698 3300005539 Bacteria 931
37 Ga0070672_100000633 3300005543 Bacteria 20584
38 Ga0070686_100060958 3300005544 Unclassified 2436
39 Ga0070665_100001963 3300005548 Bacteria 23141
40 Ga0070665_100003504 3300005548 Bacteria 16699
41 Ga0068855_100046420 3300005563 Bacteria 5135
42 Ga0068855_100452892 3300005563 Bacteria 1400
43 Ga0068855_101162818 3300005563 Bacteria 804
44 Ga0070664_100023390 3300005564 Bacteria 5103
45 Ga0070664_100062264 3300005564 Bacteria 3181
46 Ga0070664_100473977 3300005564 Unclassified 1151
47 Ga0070664_100965295 3300005564 Bacteria 800
48 Ga0068857_100816632 3300005577 Bacteria 891
49 Ga0068852_100000327 3300005616 Bacteria 32309
50 Ga0068852_100106088 3300005616 Bacteria 2546
51 Ga0068852_100164293 3300005616 Bacteria 2076
52 Ga0068852_100181352 3300005616 Bacteria 1980
53 Ga0068852_100684195 3300005616 Bacteria 1035
54 Ga0068852_101046857 3300005616 Bacteria 835
55 Ga0068852_101069179 3300005616 Bacteria 827
56 Ga0068864_100002317 3300005618 Bacteria 15748
57 Ga0068861_100050966 3300005719 Bacteria 3141
58 Ga0068851_10010013 3300005834 Bacteria 4414
59 Ga0068863_100021578 3300005841 Bacteria 6142
60 Ga0068858_100001289 3300005842 Bacteria 25885
61 Ga0068860_100025777 3300005843 Bacteria 5672
62 Ga0068862_101266109 3300005844 Unclassified 738
63 Ga0075366_10464603 3300006195 Bacteria 781
64 Ga0097621_100000393 3300006237 Bacteria 30466
65 Ga0068871_100665998 3300006358 Bacteria 951
66 Ga0068865_100099780 3300006881 Bacteria 2123
67 Ga0105244_10237115 3300009036 Bacteria 852
68 Ga0105240_10000176 3300009093 Bacteria 130109
69 Ga0105240_10016269 3300009093 Bacteria 10076
70 Ga0105240_10397263 3300009093 Bacteria 1554
71 Ga0105240_10505907 3300009093 Unclassified 1342
72 Ga0105247_10090852 3300009101 Bacteria 1938
73 Ga0105241_10157670 3300009174 Bacteria 1863
74 Ga0105241_10273264 3300009174 Bacteria 1441
75 Ga0105241_10963300 3300009174 Bacteria 796
76 Ga0105242_10037838 3300009176 Bacteria 3878
77 Ga0105242_11657087 3300009176 Bacteria 675
78 Ga0105248_10430504 3300009177 Bacteria 1486
79 Ga0105237_10196546 3300009545 Bacteria 2017
80 Ga0105237_10242069 3300009545 Bacteria 1805
81 Ga0105238_10442601 3300009551 Bacteria 1296
82 Ga0105238_11139468 3300009551 Bacteria 803
83 Ga0105249_10018253 3300009553 Bacteria 6236
84 Ga0105239_10076563 3300010375 Bacteria 3680
85 Ga0105239_10103105 3300010375 Bacteria 3157
86 Ga0157373_10517854 3300013100 Bacteria 863
87 Ga0157371_10005572 3300013102 Bacteria 10583
88 Ga0157371_10054871 3300013102 Unclassified 2828
89 Ga0157371_10147061 3300013102 Unclassified 1679
90 Ga0157371_10153980 3300013102 Bacteria 1640
91 Ga0157371_10515120 3300013102 Bacteria 884
92 Ga0157370_10118172 3300013104 Bacteria 2476
93 Ga0157370_10577433 3300013104 Bacteria 1030
94 Ga0157369_10215563 3300013105 Bacteria 2011
95 Ga0157369_10242015 3300013105 Bacteria 1884
96 Ga0157369_10622095 3300013105 Bacteria 1114
97 Ga0157374_10004948 3300013296 Bacteria 11184
98 Ga0157374_10039555 3300013296 Bacteria 4340
99 Ga0157374_10576344 3300013296 Bacteria 1134
100 Ga0157378_10125284 3300013297 Bacteria 2372
101 Ga0157378_12632549 3300013297 Unclassified 555
102 Ga0163162_10049795 3300013306 Bacteria 4200
103 Ga0163162_10586695 3300013306 Bacteria 1241
104 Ga0163162_11103725 3300013306 Bacteria 899
105 Ga0157372_10003268 3300013307 Bacteria 17515
106 Ga0157372_10005808 3300013307 Bacteria 13145
107 Ga0157372_10125662 3300013307 Bacteria 2949
108 Ga0157372_10145871 3300013307 Bacteria 2729
109 Ga0157372_10160787 3300013307 Bacteria 2596
110 Ga0157372_10366460 3300013307 Bacteria 1679
111 Ga0157372_10383954 3300013307 Unclassified 1636
112 Ga0157372_10552787 3300013307 Unclassified 1342
113 Ga0157372_10624757 3300013307 Bacteria 1255
114 Ga0157372_11001292 3300013307 Unclassified 968
115 Ga0157372_11230566 3300013307 Bacteria 865
116 Ga0157372_11317140 3300013307 Bacteria 833
117 Ga0157372_12786745 3300013307 Bacteria 560
118 Ga0157375_10058641 3300013308 Bacteria 3809
119 Ga0157375_10431059 3300013308 Bacteria 1484
120 Ga0157375_11162000 3300013308 Unclassified 905
121 Ga0157375_12501216 3300013308 Bacteria 616
122 Ga0163163_10268015 3300014325 Bacteria 1759
123 Ga0163163_10446689 3300014325 Bacteria 1353
124 Ga0157380_12583308 3300014326 Bacteria 574
125 Ga0157379_10000895 3300014968 Bacteria 24098
126 Ga0157379_10115886 3300014968 Bacteria 2409
127 Ga0157379_10687994 3300014968 Bacteria 959
128 Ga0157376_10024113 3300014969 Bacteria 4772
129 Ga0163161_10012184 3300017792 Bacteria 5963
130 Ga0163161_11330168 3300017792 Bacteria 625
131 Ga0209050_1004446 3300025298 Bacteria 9467
132 Ga0207697_10014670 3300025315 Bacteria 3247
133 Ga0207656_10005236 3300025321 Bacteria 4569
134 Ga0207680_10018151 3300025903 Bacteria 3733
135 Ga0207680_10118605 3300025903 Bacteria 1727
136 Ga0207647_10000139 3300025904 Bacteria 57477
137 Ga0207647_10000562 3300025904 Bacteria 29264
138 Ga0207645_10000332 3300025907 Bacteria 39392
139 Ga0207705_10018346 3300025909 Bacteria 5004
140 Ga0207654_10689804 3300025911 Bacteria 733
141 Ga0207695_10000102 3300025913 Bacteria 257838
142 Ga0207695_10013688 3300025913 Bacteria 9656
143 Ga0207695_10080501 3300025913 Bacteria 3298
144 Ga0207671_10209814 3300025914 Bacteria 1523
145 Ga0207671_10224234 3300025914 Unclassified 1473
146 Ga0207657_10065207 3300025919 Bacteria 3106
147 Ga0207649_10044608 3300025920 Unclassified 2715
148 Ga0207694_11431939 3300025924 Bacteria 584
149 Ga0207650_10126800 3300025925 Unclassified 1993
150 Ga0207659_10107347 3300025926 Bacteria 2116
151 Ga0207687_11287011 3300025927 Bacteria 628
152 Ga0207690_10014296 3300025932 Bacteria 4793
153 Ga0207706_10065537 3300025933 Bacteria 3198
154 Ga0207669_10716900 3300025937 Bacteria 823
155 Ga0207704_10028103 3300025938 Bacteria 3115
156 Ga0207691_10000164 3300025940 Bacteria 61768
157 Ga0207689_10017885 3300025942 Bacteria 5987
158 Ga0207661_11119046 3300025944 Bacteria 725
159 Ga0207679_10290902 3300025945 Bacteria 1404
160 Ga0207667_10033080 3300025949 Bacteria 5563
161 Ga0207667_10525322 3300025949 Bacteria 1199
162 Ga0207667_11032400 3300025949 Bacteria 808
163 Ga0207651_10000648 3300025960 Bacteria 14769
164 Ga0207668_10000264 3300025972 Bacteria 34945
165 Ga0207668_11479201 3300025972 Bacteria 613
166 Ga0207658_10000445 3300025986 Bacteria 38969
167 Ga0207677_10014476 3300026023 Bacteria 4608
168 Ga0207703_10001076 3300026035 Bacteria 25996
169 Ga0207639_10694714 3300026041 Bacteria 944
170 Ga0207641_10040722 3300026088 Bacteria 3891
171 Ga0207648_10081662 3300026089 Bacteria 2819
172 Ga0207676_11140409 3300026095 Bacteria 771
173 Ga0207674_10453009 3300026116 Bacteria 1240
174 Ga0207698_10000979 3300026142 Bacteria 16617
175 Ga0207698_10160858 3300026142 Bacteria 1963
176 Ga0207698_10209106 3300026142 Bacteria 1754
177 Ga0207698_10458678 3300026142 Bacteria 1232
178 Ga0207698_11527975 3300026142 Unclassified 683
179 Ga0268266_10025180 3300028379 Bacteria 5064
180 Ga0268266_10215521 3300028379 Bacteria 1762
181 Ga0268264_10000982 3300028381 Bacteria 29187
182 Ga0265334_10089433 3300028573 Bacteria 1125
183 Ga0307515_10105146 3300028794 Unclassified 3364
184 Ga0307515_10155217 3300028794 Unclassified 2367
185 Ga0307515_10155911 3300028794 Bacteria 2357
186 Ga0265338_10189771 3300028800 Bacteria 1559
187 Ga0265338_10244239 3300028800 Bacteria 1328
188 Ga0265324_10026551 3300029957 Bacteria 2049
189 Ga0265332_10213565 3300031238 Bacteria 801
190 Ga0265340_10185748 3300031247 Bacteria 939
191 Ga0265340_10360842 3300031247 Unclassified 642
192 Ga0265327_10000306 3300031251 Bacteria 95199
193 Ga0307413_11673344 3300031824 Unclassified 567
194 Ga0307409_101249839 3300031995 Bacteria 767
195 Ga0307416_102521845 3300032002 Unclassified 613
196 Ga0307414_10166712 3300032004 Bacteria 1756
197 Ga0307411_11551308 3300032005 Unclassified 610
198 Ga0307415_101147295 3300032126 Unclassified 730
199 Ga0395899_0595633 3300037312 Unclassified 705
200 Ga0395900_0994694 3300037418 Bacteria 759
201 Ga0439465_0011729 3300041413 Bacteria 2747
202 Ga0451791_0907453 3300041451 Unclassified 513
203 Ga0451802_0637096 3300041460 Bacteria 627
204 Ga0451804_0532286 3300041463 Bacteria 682
205 Ga0451807_0355010 3300041486 Unclassified 1536
206 Ga0451853_3174714 3300041512 Bacteria 546
207 Ga0451577_0252020 3300042876 Bacteria 1598
208 Ga0496108_1407771 3300048911 Unclassified 583
209 Ga0501292_083855 3300049515 Bacteria 610
210 Ga0501198_125393 3300049649 Bacteria 545
211 Ga0501201_010214 3300049651 Bacteria 917
212 Ga0501222_034402 3300049662 Bacteria 704
213 Ga0501223_042003 3300049663 Bacteria 887
214 Ga0501250_040695 3300049680 Bacteria 681
215 Ga0501250_074619 3300049680 Unclassified 566
216 Ga0501252_065133 3300049682 Bacteria 577
217 Ga0501257_037672 3300049686 Bacteria 1180
218 Ga0501259_028757 3300049688 Bacteria 1037
219 Ga0501221_066916 3300049704 Bacteria 841
220 Ga0501225_0138068 3300049705 Bacteria 735
221 Ga0501234_007710 3300049707 Bacteria 1682
222 nmdc:mga0k408_1660_c1 3300050493 Bacteria 12015
223 Ga0500578_0137973 3300053086 Bacteria 1526
224 Ga0500651_0472529 3300053093 Unclassified 695
225 Ga0500622_0000214 3300053156 Bacteria 61277
226 Ga0307509_10062765
227 Ga0055530_10052158
228 Ga0065165_1083161
229 Ga0065712_10098457
230 Ga0070658_10000869
231 Ga0070658_11588163
232 Ga0070676_10000097
233 Ga0070683_100324260
234 Ga0070683_100511641
235 Ga0070683_101532667
236 Ga0070690_100335004
237 Ga0070670_100362088
238 Ga0070666_10009847
239 Ga0070666_10031357
240 Ga0070682_100546851
241 Ga0070682_100562360
242 Ga0068868_100014890
243 Ga0070660_100554237
244 Ga0070661_100057496
245 Ga0070661_100139818
246 Ga0070661_100172411
247 Ga0070668_100052633
248 Ga0070675_100135794
249 Ga0070671_100545706
250 Ga0070671_101060057
251 Ga0070674_100281927
252 Ga0070673_100009111
253 Ga0070688_100556742
254 Ga0070659_100004638
255 Ga0070667_100001108
256 Ga0070678_100094624
257 Ga0070662_100003073
258 Ga0068867_100001305
259 Ga0070684_100016775
260 Ga0070684_101678397
261 Ga0068853_100752698
262 Ga0070672_100000633
263 Ga0070686_100060958
264 Ga0070665_100001963
265 Ga0070665_100003504
266 Ga0068855_100046420
267 Ga0068855_100452892
268 Ga0068855_101162818
269 Ga0070664_100023390
270 Ga0070664_100062264
271 Ga0070664_100473977
272 Ga0070664_100965295
273 Ga0068857_100816632
274 Ga0068852_100000327
275 Ga0068852_100106088
276 Ga0068852_100164293
277 Ga0068852_100181352
278 Ga0068852_100684195
279 Ga0068852_101046857
280 Ga0068852_101069179
281 Ga0068864_100002317
282 Ga0068861_100050966
283 Ga0068851_10010013
284 Ga0068863_100021578
285 Ga0068858_100001289
286 Ga0068860_100025777
287 Ga0068862_101266109
288 Ga0075366_10464603
289 Ga0097621_100000393
290 Ga0068871_100665998
291 Ga0068865_100099780
292 Ga0105244_10237115
293 Ga0105240_10000176
294 Ga0105240_10016269
295 Ga0105240_10397263
296 Ga0105240_10505907
297 Ga0105247_10090852
298 Ga0105241_10157670
299 Ga0105241_10273264
300 Ga0105241_10963300
301 Ga0105242_10037838
302 Ga0105242_11657087
303 Ga0105248_10430504
304 Ga0105237_10196546
305 Ga0105237_10242069
306 Ga0105238_10442601
307 Ga0105238_11139468
308 Ga0105249_10018253
309 Ga0105239_10076563
310 Ga0105239_10103105
311 Ga0157373_10517854
312 Ga0157371_10005572
313 Ga0157371_10054871
314 Ga0157371_10147061
315 Ga0157371_10153980
316 Ga0157371_10515120
317 Ga0157370_10118172
318 Ga0157370_10577433
319 Ga0157369_10215563
320 Ga0157369_10242015
321 Ga0157369_10622095
322 Ga0157374_10004948
323 Ga0157374_10039555
324 Ga0157374_10576344
325 Ga0157378_10125284
326 Ga0157378_12632549
327 Ga0163162_10049795
328 Ga0163162_10586695
329 Ga0163162_11103725
330 Ga0157372_10003268
331 Ga0157372_10005808
332 Ga0157372_10125662
333 Ga0157372_10145871
334 Ga0157372_10160787
335 Ga0157372_10366460
336 Ga0157372_10383954
337 Ga0157372_10552787
338 Ga0157372_10624757
339 Ga0157372_11001292
340 Ga0157372_11230566
341 Ga0157372_11317140
342 Ga0157372_12786745
343 Ga0157375_10058641
344 Ga0157375_10431059
345 Ga0157375_11162000
346 Ga0157375_12501216
347 Ga0163163_10268015
348 Ga0163163_10446689
349 Ga0157380_12583308
350 Ga0157379_10000895
351 Ga0157379_10115886
352 Ga0157379_10687994
353 Ga0157376_10024113
354 Ga0163161_10012184
355 Ga0163161_11330168
356 Ga0209050_1004446
357 Ga0207697_10014670
358 Ga0207656_10005236
359 Ga0207680_10018151
360 Ga0207680_10118605
361 Ga0207647_10000139
362 Ga0207647_10000562
363 Ga0207645_10000332
364 Ga0207705_10018346
365 Ga0207654_10689804
366 Ga0207695_10000102
367 Ga0207695_10013688
368 Ga0207695_10080501
369 Ga0207671_10209814
370 Ga0207671_10224234
371 Ga0207657_10065207
372 Ga0207649_10044608
373 Ga0207694_11431939
374 Ga0207650_10126800
375 Ga0207659_10107347
376 Ga0207687_11287011
377 Ga0207690_10014296
378 Ga0207706_10065537
379 Ga0207669_10716900
380 Ga0207704_10028103
381 Ga0207691_10000164
382 Ga0207689_10017885
383 Ga0207661_11119046
384 Ga0207679_10290902
385 Ga0207667_10033080
386 Ga0207667_10525322
387 Ga0207667_11032400
388 Ga0207651_10000648
389 Ga0207668_10000264
390 Ga0207668_11479201
391 Ga0207658_10000445
392 Ga0207677_10014476
393 Ga0207703_10001076
394 Ga0207639_10694714
395 Ga0207641_10040722
396 Ga0207648_10081662
397 Ga0207676_11140409
398 Ga0207674_10453009
399 Ga0207698_10000979
400 Ga0207698_10160858
401 Ga0207698_10209106
402 Ga0207698_10458678
403 Ga0207698_11527975
404 Ga0268266_10025180
405 Ga0268266_10215521
406 Ga0268264_10000982
407 Ga0265334_10089433
408 Ga0307515_10105146
409 Ga0307515_10155217
410 Ga0307515_10155911
411 Ga0265338_10189771
412 Ga0265338_10244239
413 Ga0265324_10026551
414 Ga0265332_10213565
415 Ga0265340_10185748
416 Ga0265340_10360842
417 Ga0265327_10000306
418 Ga0307413_11673344
419 Ga0307409_101249839
420 Ga0307416_102521845
421 Ga0307414_10166712
422 Ga0307411_11551308
423 Ga0307415_101147295
424 Ga0395899_0595633
425 Ga0395900_0994694
426 Ga0439465_0011729
427 Ga0451791_0907453
428 Ga0451802_0637096
429 Ga0451804_0532286
430 Ga0451807_0355010
431 Ga0451853_3174714
432 Ga0451577_0252020
433 Ga0496108_1407771
434 Ga0501292_083855
435 Ga0501198_125393
436 Ga0501201_010214
437 Ga0501222_034402
438 Ga0501223_042003
439 Ga0501250_040695
440 Ga0501250_074619
441 Ga0501252_065133
442 Ga0501257_037672
443 Ga0501259_028757
444 Ga0501221_066916
445 Ga0501225_0138068
446 Ga0501234_007710
447 nmdc:mga0k408_1660_c1
448 Ga0500578_0137973
449 Ga0500651_0472529
450 Ga0500622_0000214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

7

117

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c1j-assembly1.cif.gz_A crystal structure of the receiver domain of sensor histidine kinase pa1611 (pa1611rec) from pseudomonas aeruginosa pao1 with magnesium ion coordinated in the active site cleft 0.7625 2 126
3kht-assembly1.cif.gz_A crystal structure of response regulator from hahella chejuensis 0.7511 2 123
4zyl-assembly1.cif.gz_A crystal structure of response regulator rpa3017 in red light signaling of r. palustris 0.7492 3 128
3h1f-assembly1.cif.gz_A crystal structure of chey mutant d53a of helicobacter pylori 0.747 1 119
3h1g-assembly1.cif.gz_A crystal structure of chey mutant t84a of helicobacter pylori 0.742 1 119
ID Description Score Start End Superfamily
3khtA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7537 2 123 3.40.50.2300
4zylA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.749 3 128 3.40.50.2300
1m5uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7301 2 120 3.40.50.2300
3h1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7299 3 119 3.40.50.2300
3gt7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7256 2 127 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7J5TUU1-F1-model_v4 Response regulator 0.8406 2 129 GO:0000160
AF-A0A519K2C1-F1-model_v4 Response regulator 0.8208 2 129 GO:0000160
AF-A0A4Q5WPD8-F1-model_v4 Response regulator 0.819 2 129 GO:0000160
AF-A0A7W1PWC1-F1-model_v4 Response regulator 0.8188 2 130 GO:0000160
AF-A0A7G5GYZ0-F1-model_v4 Response regulator 0.8171 2 133 GO:0000160

Map