F337924

General Info

Members Datasets Scaffolds Average Seq Length
225 120 450 270

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10004427|Ga0307513_100044277
Length 291
Sequence MSSRAASAVVLLVASLLGACASTPQRPAAPKAAPRDAATAAAIERVLAGDHRSAENRARDVNRHPLDTLLFFGIKPEMTVVEVWPGPDGWYTEILAPLLAERGKLYAAQFAPAPDNAYITGNLKSFADKLAARPDIYGKVQVTALGPGSESIAPPGSADLVVTFRNVHNWMSLDLAPQAFAAMFAALKPGGILGVVEHRGDPAKPQDPHATTGYVNEDYAIKLIEAAGFELVARSEINANPRDTKDYQQGVWTLPPSYRLGNRDRAKYEAIGESDRFTLKFRKKVTVPESR

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
67 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
74 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
77 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
78 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
79 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
80 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
81 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
82 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
83 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
84 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
120 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.22
Rhizosphere 95.11
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10004427 3300031456 Bacteria 18767
2 rootL2_10217693 3300003322 Unclassified 1957
3 Ga0065707_10084988 3300005295 Bacteria 6573
4 Ga0070690_100209759 3300005330 Unclassified 1359
5 Ga0070670_100129284 3300005331 Bacteria 2180
6 Ga0070677_10073403 3300005333 Bacteria 1445
7 Ga0068869_100046975 3300005334 Bacteria 3116
8 Ga0068869_100124590 3300005334 Bacteria 1975
9 Ga0070682_100009191 3300005337 Bacteria 5587
10 Ga0070682_100118601 3300005337 Bacteria 1773
11 Ga0070689_100001299 3300005340 Bacteria 15918
12 Ga0070689_100591063 3300005340 Bacteria 961
13 Ga0070669_100010307 3300005353 Bacteria 6638
14 Ga0070674_100142031 3300005356 Bacteria 1803
15 Ga0070710_10209043 3300005437 Bacteria 1236
16 Ga0070701_10289024 3300005438 Bacteria 1004
17 Ga0070700_100050702 3300005441 Bacteria 2580
18 Ga0070700_100257194 3300005441 Bacteria 1256
19 Ga0070700_100427944 3300005441 Bacteria 1002
20 Ga0070694_100019619 3300005444 Bacteria 4302
21 Ga0070681_10052817 3300005458 Bacteria 4053
22 Ga0068867_100014697 3300005459 Bacteria 5548
23 Ga0070672_100019968 3300005543 Bacteria 4878
24 Ga0070672_100284707 3300005543 Bacteria 1398
25 Ga0070686_100010876 3300005544 Bacteria 5150
26 Ga0070704_100104530 3300005549 Bacteria 2142
27 Ga0070704_100179267 3300005549 Bacteria 1693
28 Ga0070704_100204915 3300005549 Bacteria 1595
29 Ga0068855_100327427 3300005563 Bacteria 1692
30 Ga0068855_100679663 3300005563 Bacteria 1103
31 Ga0068859_100004602 3300005617 Bacteria 14073
32 Ga0068859_100426126 3300005617 Bacteria 1423
33 Ga0068864_100033753 3300005618 Bacteria 4351
34 Ga0068861_100001105 3300005719 Bacteria 16725
35 Ga0068861_100059864 3300005719 Bacteria 2917
36 Ga0068861_100072068 3300005719 Bacteria 2680
37 Ga0068861_100239144 3300005719 Bacteria 1544
38 Ga0068870_10159408 3300005840 Bacteria 1337
39 Ga0068863_100013648 3300005841 Bacteria 7838
40 Ga0068863_100271173 3300005841 Bacteria 1643
41 Ga0068862_100034552 3300005844 Bacteria 4278
42 Ga0081455_10002212 3300005937 Bacteria 23167
43 Ga0097621_100062587 3300006237 Bacteria 3055
44 Ga0097621_100073869 3300006237 Bacteria 2824
45 Ga0097621_100152417 3300006237 Bacteria 1983
46 Ga0068871_100019063 3300006358 Bacteria 5231
47 Ga0068871_100041199 3300006358 Bacteria 3702
48 Ga0068871_100207402 3300006358 Bacteria 1694
49 Ga0068865_100075045 3300006881 Bacteria 2410
50 Ga0097620_100004602 3300006931 Bacteria 14073
51 Ga0097620_100426103 3300006931 Bacteria 1423
52 Ga0099794_10001404 3300007265 Bacteria 8406
53 Ga0105240_10202978 3300009093 Bacteria 2322
54 Ga0157378_10010163 3300013297 Bacteria 8209
55 Ga0157375_10294412 3300013308 Bacteria 1786
56 Ga0163163_10236965 3300014325 Bacteria 1874
57 Ga0157380_10023273 3300014326 Bacteria 4671
58 Ga0157380_10280416 3300014326 Bacteria 1524
59 Ga0157380_10446645 3300014326 Bacteria 1240
60 Ga0207643_10141438 3300025908 Bacteria 1437
61 Ga0207707_10041188 3300025912 Bacteria 4034
62 Ga0207663_10215331 3300025916 Bacteria 1395
63 Ga0207659_10525894 3300025926 Bacteria 1003
64 Ga0207670_10215566 3300025936 Bacteria 1466
65 Ga0207704_10064962 3300025938 Bacteria 2283
66 Ga0207691_10021859 3300025940 Bacteria 6038
67 Ga0207679_10309709 3300025945 Bacteria 1364
68 Ga0207703_10385507 3300026035 Bacteria 1297
69 Ga0207678_10070569 3300026067 Bacteria 2995
70 Ga0207708_10018316 3300026075 Bacteria 5274
71 Ga0207708_10020915 3300026075 Bacteria 4937
72 Ga0207708_10163219 3300026075 Bacteria 1760
73 Ga0207641_10082659 3300026088 Bacteria 2791
74 Ga0207641_10209663 3300026088 Bacteria 1801
75 Ga0207648_10022460 3300026089 Bacteria 5663
76 Ga0207676_10016777 3300026095 Bacteria 5302
77 Ga0207674_10242165 3300026116 Bacteria 1751
78 Ga0207675_100006119 3300026118 Bacteria 11437
79 Ga0207675_100006362 3300026118 Bacteria 11196
80 Ga0207675_100195129 3300026118 Bacteria 1943
81 Ga0207675_100304284 3300026118 Bacteria 1553
82 Ga0207428_10041224 3300027907 Bacteria 3739
83 Ga0268265_10004387 3300028380 Bacteria 9802
84 Ga0268265_10152607 3300028380 Bacteria 1950
85 Ga0307513_10114189 3300031456 Bacteria 2686
86 Ga0307509_10035699 3300031507 Bacteria 5454
87 Ga0307509_10263890 3300031507 Bacteria 1495
88 Ga0316578_10163218 3300031728 Bacteria 1343
89 Ga0307415_100266916 3300032126 Bacteria 1400
90 Ga0373955_0080586 3300035172 Unclassified 1839
91 Ga0316574_0064422 3300035398 Bacteria 2306
92 Ga0316574_0093831 3300035398 Bacteria 1916
93 Ga0373927_0125207 3300035695 Bacteria 1678
94 Ga0373937_0223105 3300036401 Unclassified 1774
95 Ga0316584_0031332 3300036712 Bacteria 3932
96 Ga0373925_0230826 3300037068 Bacteria 1480
97 Ga0451791_0851670 3300041451 Bacteria 1679
98 Ga0451800_0078004 3300041459 Bacteria 1247
99 Ga0451807_2527441 3300041486 Bacteria 3174
100 Ga0451807_2557735 3300041486 Bacteria 1138
101 Ga0451833_0092662 3300041491 Bacteria 1153
102 Ga0466966_0119261 3300044684 Bacteria 1622
103 Ga0466966_0346265 3300044684 Bacteria 893
104 Ga0466963_0196333 3300044694 Unclassified 1411
105 Ga0451576_0193817 3300045051 Unclassified 2122
106 Ga0495591_005460 3300046458 Bacteria 5882
107 Ga0495638_0002457 3300046460 Bacteria 15106
108 Ga0495638_0006087 3300046460 Bacteria 8832
109 Ga0495580_0022445 3300046472 Bacteria 4644
110 Ga0495585_0045651 3300046492 Bacteria 2445
111 Ga0495616_0000872 3300046513 Bacteria 21922
112 Ga0495632_0127499 3300046519 Bacteria 1186
113 Ga0495644_0013290 3300046523 Bacteria 3161
114 Ga0495654_0092121 3300046530 Bacteria 1405
115 Ga0495647_0000652 3300046681 Bacteria 10265
116 Ga0495658_0014604 3300046683 Bacteria 4016
117 Ga0495671_0059601 3300046692 Bacteria 1886
118 Ga0495649_0009863 3300046694 Bacteria 5652
119 Ga0496104_0487853 3300048907 Bacteria 1143
120 Ga0501031_0003341 3300049568 Bacteria 10297
121 Ga0501031_0004987 3300049568 Bacteria 8633
122 Ga0501031_0067548 3300049568 Bacteria 2329
123 Ga0501032_0081061 3300049569 Bacteria 2159
124 Ga0501033_0006345 3300049570 Bacteria 9267
125 Ga0501033_0065674 3300049570 Bacteria 2669
126 Ga0501033_0108806 3300049570 Bacteria 2019
127 Ga0501034_0251664 3300049571 Bacteria 1711
128 Ga0501036_0009110 3300049572 Bacteria 8163
129 Ga0501036_0027539 3300049572 Bacteria 4802
130 Ga0501036_0511158 3300049572 Bacteria 999
131 Ga0501037_0037572 3300049573 Bacteria 3570
132 Ga0501038_0017624 3300049574 Bacteria 6453
133 Ga0501038_0026791 3300049574 Bacteria 5131
134 Ga0501039_0004958 3300049575 Bacteria 10098
135 Ga0501039_0011395 3300049575 Bacteria 6770
136 Ga0501039_0210906 3300049575 Bacteria 1527
137 Ga0501039_0285105 3300049575 Bacteria 1298
138 Ga0501040_0002906 3300049576 Bacteria 11073
139 Ga0501040_0005340 3300049576 Bacteria 8306
140 Ga0501040_0107008 3300049576 Bacteria 1954
141 Ga0501040_0166055 3300049576 Bacteria 1562
142 Ga0501041_0001077 3300049577 Bacteria 14945
143 Ga0501041_0005765 3300049577 Bacteria 7235
144 Ga0501041_0024581 3300049577 Bacteria 3617
145 Ga0501041_0133808 3300049577 Bacteria 1544
146 Ga0501041_0210514 3300049577 Bacteria 1219
147 Ga0501041_0302950 3300049577 Bacteria 1007
148 Ga0501042_0000053 3300049578 Bacteria 40232
149 Ga0501042_0049793 3300049578 Bacteria 2989
150 Ga0501042_0211132 3300049578 Bacteria 1400
151 Ga0501046_0012419 3300049580 Bacteria 7251
152 Ga0501046_0055961 3300049580 Bacteria 3098
153 Ga0501046_0284207 3300049580 Bacteria 1211
154 Ga0501046_0421378 3300049580 Bacteria 962
155 Ga0501048_0001930 3300049582 Bacteria 15760
156 Ga0501048_0013386 3300049582 Bacteria 6088
157 Ga0501048_0024087 3300049582 Bacteria 4445
158 Ga0501067_0015589 3300049583 Bacteria 4207
159 Ga0501068_0001206 3300049584 Bacteria 13744
160 Ga0501068_0006762 3300049584 Bacteria 6334
161 Ga0501068_0040231 3300049584 Bacteria 2805
162 Ga0501068_0211722 3300049584 Bacteria 1231
163 Ga0501070_0024594 3300049586 Bacteria 5050
164 Ga0501070_0067166 3300049586 Bacteria 2969
165 Ga0501071_0001097 3300049587 Bacteria 15074
166 Ga0501071_0017096 3300049587 Bacteria 4997
167 Ga0501071_0042521 3300049587 Bacteria 3257
168 Ga0501071_0047529 3300049587 Bacteria 3083
169 Ga0501072_0000660 3300049588 Bacteria 24888
170 Ga0501072_0015865 3300049588 Bacteria 5775
171 Ga0501072_0031958 3300049588 Bacteria 4120
172 Ga0501072_0230646 3300049588 Bacteria 1475
173 Ga0501073_0001141 3300049589 Bacteria 19332
174 Ga0501074_0000962 3300049590 Bacteria 18634
175 Ga0501074_0225604 3300049590 Bacteria 1334
176 Ga0501075_0000508 3300049591 Bacteria 23424
177 Ga0501075_0007975 3300049591 Bacteria 7358
178 Ga0501075_0122752 3300049591 Bacteria 1977
179 Ga0501075_0208308 3300049591 Bacteria 1491
180 Ga0501076_0002087 3300049592 Bacteria 13708
181 Ga0501076_0012145 3300049592 Bacteria 6438
182 Ga0501076_0104799 3300049592 Bacteria 2282
183 Ga0501076_0191689 3300049592 Bacteria 1668
184 Ga0501077_0001010 3300049593 Bacteria 16995
185 Ga0501077_0003783 3300049593 Bacteria 9109
186 Ga0501077_0004258 3300049593 Bacteria 8647
187 Ga0501079_0000908 3300049741 Bacteria 20314
188 Ga0501079_0002191 3300049741 Bacteria 14082
189 Ga0501079_0263294 3300049741 Bacteria 1348
190 Ga0501079_0406911 3300049741 Bacteria 1067
191 Ga0501080_0000468 3300049742 Bacteria 31379
192 Ga0501080_0010532 3300049742 Bacteria 8468
193 Ga0501080_0069522 3300049742 Bacteria 3275
194 Ga0501080_0126307 3300049742 Bacteria 2369
195 Ga0501081_0000059 3300049743 Bacteria 42443
196 Ga0501081_0000490 3300049743 Bacteria 22061
197 Ga0501081_0066904 3300049743 Bacteria 2499
198 Ga0501081_0076699 3300049743 Bacteria 2334
199 Ga0501081_0178708 3300049743 Bacteria 1534
200 Ga0501081_0221797 3300049743 Bacteria 1375
201 Ga0501081_0367866 3300049743 Bacteria 1061
202 Ga0501083_0002400 3300049744 Bacteria 12830
203 Ga0501083_0066864 3300049744 Bacteria 2393
204 Ga0501035_0023864 3300049822 Bacteria 5612
205 Ga0501035_0028231 3300049822 Bacteria 5122
206 Ga0501035_0034535 3300049822 Bacteria 4595
207 Ga0501044_0118086 3300049823 Bacteria 2656
208 Ga0501044_0152108 3300049823 Bacteria 2296
209 Ga0501044_0223859 3300049823 Bacteria 1831
210 Ga0501045_0001622 3300049824 Bacteria 15076
211 Ga0501045_0060949 3300049824 Bacteria 2767
212 Ga0501045_0100021 3300049824 Bacteria 2146
213 nmdc:mga08y16_115463_c1 3300050511 Bacteria 2795
214 Ga0501084_0000562 3300054114 Bacteria 28420
215 Ga0501084_0018706 3300054114 Bacteria 5768
216 Ga0501084_0044360 3300054114 Bacteria 3723
217 Ga0501082_0001287 3300060353 Bacteria 21991
218 Ga0501082_0027709 3300060353 Bacteria 4877
219 Ga0501082_0031777 3300060353 Bacteria 4553
220 Ga0501082_0150296 3300060353 Bacteria 2022
221 Ga0501082_0156626 3300060353 Bacteria 1979
222 Ga0530510_0001199 3300061734 Bacteria 17262
223 Ga0530510_0007276 3300061734 Bacteria 7700
224 Ga0530510_0040457 3300061734 Bacteria 3364
225 8054358799 8054357960 Bacteria 2867777
226 Ga0307513_10004427
227 rootL2_10217693
228 Ga0065707_10084988
229 Ga0070690_100209759
230 Ga0070670_100129284
231 Ga0070677_10073403
232 Ga0068869_100046975
233 Ga0068869_100124590
234 Ga0070682_100009191
235 Ga0070682_100118601
236 Ga0070689_100001299
237 Ga0070689_100591063
238 Ga0070669_100010307
239 Ga0070674_100142031
240 Ga0070710_10209043
241 Ga0070701_10289024
242 Ga0070700_100050702
243 Ga0070700_100257194
244 Ga0070700_100427944
245 Ga0070694_100019619
246 Ga0070681_10052817
247 Ga0068867_100014697
248 Ga0070672_100019968
249 Ga0070672_100284707
250 Ga0070686_100010876
251 Ga0070704_100104530
252 Ga0070704_100179267
253 Ga0070704_100204915
254 Ga0068855_100327427
255 Ga0068855_100679663
256 Ga0068859_100004602
257 Ga0068859_100426126
258 Ga0068864_100033753
259 Ga0068861_100001105
260 Ga0068861_100059864
261 Ga0068861_100072068
262 Ga0068861_100239144
263 Ga0068870_10159408
264 Ga0068863_100013648
265 Ga0068863_100271173
266 Ga0068862_100034552
267 Ga0081455_10002212
268 Ga0097621_100062587
269 Ga0097621_100073869
270 Ga0097621_100152417
271 Ga0068871_100019063
272 Ga0068871_100041199
273 Ga0068871_100207402
274 Ga0068865_100075045
275 Ga0097620_100004602
276 Ga0097620_100426103
277 Ga0099794_10001404
278 Ga0105240_10202978
279 Ga0157378_10010163
280 Ga0157375_10294412
281 Ga0163163_10236965
282 Ga0157380_10023273
283 Ga0157380_10280416
284 Ga0157380_10446645
285 Ga0207643_10141438
286 Ga0207707_10041188
287 Ga0207663_10215331
288 Ga0207659_10525894
289 Ga0207670_10215566
290 Ga0207704_10064962
291 Ga0207691_10021859
292 Ga0207679_10309709
293 Ga0207703_10385507
294 Ga0207678_10070569
295 Ga0207708_10018316
296 Ga0207708_10020915
297 Ga0207708_10163219
298 Ga0207641_10082659
299 Ga0207641_10209663
300 Ga0207648_10022460
301 Ga0207676_10016777
302 Ga0207674_10242165
303 Ga0207675_100006119
304 Ga0207675_100006362
305 Ga0207675_100195129
306 Ga0207675_100304284
307 Ga0207428_10041224
308 Ga0268265_10004387
309 Ga0268265_10152607
310 Ga0307513_10114189
311 Ga0307509_10035699
312 Ga0307509_10263890
313 Ga0316578_10163218
314 Ga0307415_100266916
315 Ga0373955_0080586
316 Ga0316574_0064422
317 Ga0316574_0093831
318 Ga0373927_0125207
319 Ga0373937_0223105
320 Ga0316584_0031332
321 Ga0373925_0230826
322 Ga0451791_0851670
323 Ga0451800_0078004
324 Ga0451807_2527441
325 Ga0451807_2557735
326 Ga0451833_0092662
327 Ga0466966_0119261
328 Ga0466966_0346265
329 Ga0466963_0196333
330 Ga0451576_0193817
331 Ga0495591_005460
332 Ga0495638_0002457
333 Ga0495638_0006087
334 Ga0495580_0022445
335 Ga0495585_0045651
336 Ga0495616_0000872
337 Ga0495632_0127499
338 Ga0495644_0013290
339 Ga0495654_0092121
340 Ga0495647_0000652
341 Ga0495658_0014604
342 Ga0495671_0059601
343 Ga0495649_0009863
344 Ga0496104_0487853
345 Ga0501031_0003341
346 Ga0501031_0004987
347 Ga0501031_0067548
348 Ga0501032_0081061
349 Ga0501033_0006345
350 Ga0501033_0065674
351 Ga0501033_0108806
352 Ga0501034_0251664
353 Ga0501036_0009110
354 Ga0501036_0027539
355 Ga0501036_0511158
356 Ga0501037_0037572
357 Ga0501038_0017624
358 Ga0501038_0026791
359 Ga0501039_0004958
360 Ga0501039_0011395
361 Ga0501039_0210906
362 Ga0501039_0285105
363 Ga0501040_0002906
364 Ga0501040_0005340
365 Ga0501040_0107008
366 Ga0501040_0166055
367 Ga0501041_0001077
368 Ga0501041_0005765
369 Ga0501041_0024581
370 Ga0501041_0133808
371 Ga0501041_0210514
372 Ga0501041_0302950
373 Ga0501042_0000053
374 Ga0501042_0049793
375 Ga0501042_0211132
376 Ga0501046_0012419
377 Ga0501046_0055961
378 Ga0501046_0284207
379 Ga0501046_0421378
380 Ga0501048_0001930
381 Ga0501048_0013386
382 Ga0501048_0024087
383 Ga0501067_0015589
384 Ga0501068_0001206
385 Ga0501068_0006762
386 Ga0501068_0040231
387 Ga0501068_0211722
388 Ga0501070_0024594
389 Ga0501070_0067166
390 Ga0501071_0001097
391 Ga0501071_0017096
392 Ga0501071_0042521
393 Ga0501071_0047529
394 Ga0501072_0000660
395 Ga0501072_0015865
396 Ga0501072_0031958
397 Ga0501072_0230646
398 Ga0501073_0001141
399 Ga0501074_0000962
400 Ga0501074_0225604
401 Ga0501075_0000508
402 Ga0501075_0007975
403 Ga0501075_0122752
404 Ga0501075_0208308
405 Ga0501076_0002087
406 Ga0501076_0012145
407 Ga0501076_0104799
408 Ga0501076_0191689
409 Ga0501077_0001010
410 Ga0501077_0003783
411 Ga0501077_0004258
412 Ga0501079_0000908
413 Ga0501079_0002191
414 Ga0501079_0263294
415 Ga0501079_0406911
416 Ga0501080_0000468
417 Ga0501080_0010532
418 Ga0501080_0069522
419 Ga0501080_0126307
420 Ga0501081_0000059
421 Ga0501081_0000490
422 Ga0501081_0066904
423 Ga0501081_0076699
424 Ga0501081_0178708
425 Ga0501081_0221797
426 Ga0501081_0367866
427 Ga0501083_0002400
428 Ga0501083_0066864
429 Ga0501035_0023864
430 Ga0501035_0028231
431 Ga0501035_0034535
432 Ga0501044_0118086
433 Ga0501044_0152108
434 Ga0501044_0223859
435 Ga0501045_0001622
436 Ga0501045_0060949
437 Ga0501045_0100021
438 nmdc:mga08y16_115463_c1
439 Ga0501084_0000562
440 Ga0501084_0018706
441 Ga0501084_0044360
442 Ga0501082_0001287
443 Ga0501082_0027709
444 Ga0501082_0031777
445 Ga0501082_0150296
446 Ga0501082_0156626
447 Ga0530510_0001199
448 Ga0530510_0007276
449 Ga0530510_0040457
450 8054358799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8023 40 282
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.7787 40 282
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.7656 64 196
7bgg-assembly1.cif.gz_A crystal structure of the heterocyclic toxin methyltransferase from mycobacterium tuberculosis 0.7513 66 235
4qtt-assembly2.cif.gz_D structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (apo-form) 0.7499 57 282
ID Description Score Start End Superfamily
3dh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8023 40 282 3.40.50.150
af_I1L8V0_149_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7998 155 285 3.40.50.150
3dh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7787 40 282 3.40.50.150
3dp7B03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7772 78 283 3.40.50.150
af_Q5ZAM6_92_238_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7726 74 285 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A257MXU4-F1-model_v4 Methyltransferase 0.9921 152 285
AF-A0A848YCC3-F1-model_v4 Class I SAM-dependent methyltransferase 0.9853 35 284 GO:0008168
GO:0032259
AF-A0A6N7CVK5-F1-model_v4 Methyltransferase 0.9828 192 284
AF-A0A7Z8QKB8-F1-model_v4 Methyltransferase 0.9796 183 284
AF-A0A3D5DCP0-F1-model_v4 Methyltransferase 0.9781 37 285 GO:0008168
GO:0032259

Map