F337729

General Info

Members Datasets Scaffolds Average Seq Length
225 181 178 123

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10009347|Ga0105241_100093477
Length 129
Sequence MVRRMRARLQKFLPVVLLALVMQVLAPIATCWAAGRAVADPLAAAGAICHSVDQSSSLGDQGGSPAAHSGACALCCLAQASASLDSPPHAALSAPLRHAERVVWREADASAIATYKGSSAQARGPPSFS

Samples

Sample ID Description Type Environment
1 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
4 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
5 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
6 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
7 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
8 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
9 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
10 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
11 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
12 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
13 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
14 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
15 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
16 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
17 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
18 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
19 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
20 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
21 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
22 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
23 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
24 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
25 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
26 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
27 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
28 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
29 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
30 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
31 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
32 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
33 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
34 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
35 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
36 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
37 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
38 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
39 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
40 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
41 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
42 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
43 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
48 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
49 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
92 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
93 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
166 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
167 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
168 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
171 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
172 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
173 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
174 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
175 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
176 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
177 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
178 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
179 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
180 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
181 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.11
Metatranscriptomes 0
Isolates 20.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.89
Nodule 13.78
Rhizoplane 4.44
Rhizosphere 44.44
Stem 0
Stem Tuber 0
Unclassified 12.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1003217 3300003214 Bacteria 4276
2 JGI25153J46596_10003092 3300003215 Bacteria 9379
3 JGI25153J46596_10006254 3300003215 Bacteria 6088
4 JGI25153J46596_10020371 3300003215 Bacteria 2509
5 JGI25153J46596_10021831 3300003215 Bacteria 2377
6 JGI25160J50197_1094671 3300003354 Bacteria 538
7 Ga0055542_1011474 3300003762 Bacteria 1571
8 Ga0055531_10003586 3300003794 Bacteria 9832
9 Ga0055543_1004622 3300004625 Bacteria 3693
10 Ga0065165_1002626 3300005262 Bacteria 14631
11 Ga0065165_1003267 3300005262 Bacteria 11699
12 Ga0065165_1044295 3300005262 Bacteria 1302
13 Ga0070666_10954784 3300005335 Bacteria 635
14 Ga0070682_100911015 3300005337 Bacteria 723
15 Ga0070660_100100527 3300005339 Bacteria 2291
16 Ga0070668_102163136 3300005347 Bacteria 514
17 Ga0070659_100357809 3300005366 Bacteria 1226
18 Ga0070662_100201661 3300005457 Bacteria 1579
19 Ga0068856_100310026 3300005614 Bacteria 1596
20 Ga0068852_100086017 3300005616 Bacteria 2802
21 Ga0068852_101267761 3300005616 Bacteria 759
22 Ga0070717_10400462 3300006028 Bacteria 1233
23 Ga0075365_10043397 3300006038 Bacteria 2944
24 Ga0075368_10302894 3300006042 Bacteria 690
25 Ga0075367_10740070 3300006178 Bacteria 626
26 Ga0075369_10007946 3300006186 Bacteria 4065
27 Ga0075366_10105826 3300006195 Bacteria 1691
28 Ga0075366_10184893 3300006195 Bacteria 1266
29 Ga0075370_10249065 3300006353 Bacteria 1053
30 Ga0099824_1029108 3300006942 Bacteria 2401
31 Ga0105240_10039775 3300009093 Bacteria 6019
32 Ga0105240_10826879 3300009093 Bacteria 1001
33 Ga0105245_10134756 3300009098 Bacteria 2320
34 Ga0105247_10649698 3300009101 Bacteria 788
35 Ga0105241_10009347 3300009174 Bacteria 7206
36 Ga0105241_10045565 3300009174 Bacteria 3328
37 Ga0105237_10071400 3300009545 Bacteria 3467
38 Ga0105239_10015570 3300010375 Bacteria 8422
39 Ga0105239_10021536 3300010375 Bacteria 7108
40 Ga0105239_10099745 3300010375 Bacteria 3211
41 Ga0105239_10247509 3300010375 Bacteria 2002
42 Ga0105239_10602043 3300010375 Bacteria 1254
43 Ga0105239_11183362 3300010375 Bacteria 881
44 Ga0105239_12766805 3300010375 Bacteria 572
45 Ga0157372_11916993 3300013307 Bacteria 681
46 Ga0157376_11098511 3300014969 Bacteria 821
47 Ga0213876_10618006 3300021384 Bacteria 577
48 Ga0209026_1034480 3300025250 Bacteria 744
49 Ga0209148_1000155 3300025254 Bacteria 143807
50 Ga0209233_1005486 3300025261 Bacteria 4203
51 Ga0209233_1010968 3300025261 Bacteria 2686
52 Ga0209455_1004009 3300025272 Bacteria 4985
53 Ga0209455_1018779 3300025272 Bacteria 1411
54 Ga0209758_1000021 3300025297 Bacteria 697691
55 Ga0209758_1000808 3300025297 Bacteria 44084
56 Ga0209758_1005279 3300025297 Bacteria 10098
57 Ga0209758_1007887 3300025297 Bacteria 7073
58 Ga0209758_1114986 3300025297 Bacteria 737
59 Ga0209256_1003095 3300025299 Bacteria 12191
60 Ga0207426_1041892 3300025302 Bacteria 1416
61 Ga0209257_1002206 3300025304 Bacteria 20108
62 Ga0207654_10036299 3300025911 Bacteria 2752
63 Ga0207654_10373643 3300025911 Bacteria 986
64 Ga0207695_10000278 3300025913 Bacteria 127446
65 Ga0207671_10014408 3300025914 Bacteria 6251
66 Ga0207657_10108803 3300025919 Bacteria 2291
67 Ga0207640_10073189 3300025981 Bacteria 2315
68 Ga0207702_11098885 3300026078 Bacteria 789
69 Ga0207674_10130181 3300026116 Bacteria 2480
70 Ga0207698_10194303 3300026142 Bacteria 1811
71 Ga0207698_10904486 3300026142 Bacteria 890
72 Ga0209389_1000026 3300027296 Bacteria 147580
73 Ga0209589_1000022 3300027357 Bacteria 180757
74 Ga0209489_100058 3300027361 Bacteria 147117
75 Ga0307510_10024391 3300033180 Bacteria 6989
76 Ga0373927_1184098 3300035695 Bacteria 504
77 Ga0395905_0006572 3300037471 Bacteria 11681
78 Ga0395901_0083497 3300038443 Bacteria 3339
79 Ga0395901_1189637 3300038443 Bacteria 729
80 Ga0436365_0375807 3300039437 Bacteria 1044
81 Ga0466969_0049264 3300044656 Bacteria 2079
82 Ga0466965_0192681 3300044683 Bacteria 1079
83 Ga0466966_0000461 3300044684 Bacteria 26075
84 Ga0466961_0000015 3300044693 Bacteria 112812
85 Ga0466963_0363515 3300044694 Bacteria 1019
86 Ga0466968_0121658 3300044735 Bacteria 1181
87 Ga0466960_0168337 3300044901 Bacteria 1181
88 Ga0466959_0043463 3300045049 Bacteria 3312
89 Ga0466967_0199884 3300045976 Bacteria 1892
90 Ga0466967_0729989 3300045976 Bacteria 982
91 Ga0495592_0214576 3300046454 Bacteria 1290
92 Ga0495592_0476899 3300046454 Bacteria 778
93 Ga0495590_0055756 3300046457 Bacteria 1381
94 Ga0495651_0021798 3300046462 Bacteria 4981
95 Ga0495664_0647778 3300046477 Bacteria 626
96 Ga0495664_0648949 3300046477 Bacteria 625
97 Ga0495607_0417325 3300046501 Bacteria 608
98 Ga0495583_0040099 3300046506 Bacteria 2202
99 Ga0495606_0031429 3300046507 Bacteria 3691
100 Ga0495628_0072920 3300046516 Bacteria 2675
101 Ga0495628_1258293 3300046516 Bacteria 500
102 Ga0495643_0285316 3300046522 Bacteria 758
103 Ga0495643_0526239 3300046522 Bacteria 506
104 Ga0495648_0063283 3300046524 Bacteria 2185
105 Ga0495648_0263346 3300046524 Bacteria 826
106 Ga0495652_0066896 3300046529 Bacteria 3013
107 Ga0495652_0156166 3300046529 Bacteria 1776
108 Ga0495640_0784833 3300046533 Bacteria 568
109 Ga0495587_0010262 3300046536 Bacteria 5970
110 Ga0495645_0107434 3300046543 Bacteria 1978
111 Ga0495634_0444532 3300046642 Bacteria 766
112 Ga0495611_0310887 3300046648 Bacteria 726
113 Ga0495625_0040873 3300046660 Bacteria 3379
114 Ga0495625_0676729 3300046660 Bacteria 612
115 Ga0495657_0008942 3300046675 Bacteria 7622
116 Ga0495599_0005099 3300046678 Bacteria 7823
117 Ga0495623_0006496 3300046679 Bacteria 7610
118 Ga0495646_0304558 3300046680 Bacteria 842
119 Ga0495646_0414199 3300046680 Bacteria 699
120 Ga0495624_0207292 3300046690 Bacteria 1190
121 Ga0495624_0464154 3300046690 Bacteria 758
122 Ga0495649_0035728 3300046694 Bacteria 2732
123 Ga0495589_0066525 3300046794 Bacteria 1765
124 Ga0495600_0082019 3300046809 Bacteria 2104
125 Ga0495604_0049343 3300047317 Bacteria 3271
126 Ga0495604_0102220 3300047317 Bacteria 2104
127 Ga0495674_0025732 3300047319 Bacteria 5390
128 Ga0495672_0128172 3300047320 Bacteria 1339
129 Ga0495680_0002707 3300047322 Bacteria 17888
130 Ga0495683_0032448 3300047323 Bacteria 2660
131 Ga0495673_0133955 3300047469 Bacteria 972
132 Ga0495673_0340389 3300047469 Bacteria 531
133 Ga0495684_0056076 3300047471 Bacteria 3005
134 Ga0495686_0196047 3300047472 Bacteria 1161
135 Ga0495593_0349272 3300047673 Bacteria 739
136 Ga0495602_0153781 3300048088 Bacteria 1804
137 Ga0495626_0277135 3300048091 Bacteria 667
138 Ga0496101_1093347 3300048904 Bacteria 626
139 Ga0496106_0039508 3300048909 Bacteria 3534
140 Ga0496107_0038503 3300048910 Bacteria 3430
141 Ga0496109_0181216 3300048912 Bacteria 1978
142 Ga0496109_1260466 3300048912 Bacteria 675
143 Ga0496110_0087301 3300048913 Bacteria 2786
144 Ga0496111_0285567 3300048914 Bacteria 1224
145 Ga0496112_0026277 3300048915 Bacteria 5599
146 Ga0496113_0243924 3300048916 Bacteria 1434
147 Ga0496115_0489869 3300048918 Bacteria 989
148 Ga0496118_0398575 3300048921 Bacteria 716
149 Ga0496121_0434622 3300048924 Bacteria 850
150 Ga0496126_0293333 3300048929 Bacteria 1344
151 Ga0496126_0589304 3300048929 Bacteria 877
152 Ga0495682_0009475 3300049460 Bacteria 3799
153 Ga0501083_1117552 3300049744 Bacteria 513
154 nmdc:mga00v17_24572_c1 3300050491 Bacteria 3496
155 nmdc:mga0yw44_14411_c1 3300050492 Bacteria 4198
156 nmdc:mga06z11_131404_c1 3300050494 Bacteria 1406
157 nmdc:mga06z11_183052_c1 3300050494 Bacteria 1209
158 nmdc:mga07m45_228776_c1 3300050496 Bacteria 1082
159 nmdc:mga0sz30_5035_c1 3300050516 Bacteria 4827
160 Ga0495619_0099660 3300053085 Bacteria 1976
161 Ga0500578_0774000 3300053086 Bacteria 510
162 Ga0500640_269004 3300053095 Bacteria 532
163 Ga0500648_285635 3300053097 Bacteria 739
164 Ga0500569_118123 3300053109 Bacteria 881
165 Ga0500572_053375 3300053111 Bacteria 1210
166 Ga0500595_080927 3300053119 Bacteria 950
167 Ga0500595_135368 3300053119 Bacteria 692
168 Ga0500595_178780 3300053119 Bacteria 588
169 Ga0500607_051520 3300053121 Bacteria 2188
170 Ga0500608_052844 3300053122 Bacteria 1951
171 Ga0500564_018367 3300053138 Bacteria 3188
172 Ga0500577_0430447 3300053142 Bacteria 577
173 Ga0500620_027159 3300053155 Bacteria 1779
174 Ga0500624_101694 3300053157 Bacteria 591
175 Ga0500638_107057 3300053162 Bacteria 1296
176 Ga0500636_0000333 3300053177 Bacteria 26138
177 Ga0500636_0402023 3300053177 Bacteria 635
178 Ga0500661_031976 3300055283 Bacteria 928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025299 Ga0209256_1003095 Ga0209256_100309510 103
2 3300047469 Ga0495673_0340389 Ga0495673_0340389_11_334 107
3 3300048912 Ga0496109_1260466 Ga0496109_1260466_28_351 107
4 3300048924 Ga0496121_0434622 Ga0496121_0434622_32_355 107
5 3300053086 Ga0500578_0774000 Ga0500578_0774000_157_480 107
6 3300053142 Ga0500577_0430447 Ga0500577_0430447_32_355 107
7 3300055283 Ga0500661_031976 Ga0500661_031976_19_342 107
8 3300037471 Ga0395905_0006572 Ga0395905_0006572_10863_11237 108
9 3300038443 Ga0395901_0083497 Ga0395901_0083497_323_697 108
10 3300003215 JGI25153J46596_10003092 JGI25153J46596_100030928 109
11 3300003354 JGI25160J50197_1094671 JGI25160J50197_10946711 109
12 3300003794 Ga0055531_10003586 Ga0055531_100035867 109
13 3300005262 Ga0065165_1003267 Ga0065165_10032679 109
14 3300025297 Ga0209758_1000021 Ga0209758_100002158 109
15 3300025302 Ga0207426_1041892 Ga0207426_10418921 109
16 3300025304 Ga0209257_1002206 Ga0209257_100220614 109
17 iso_pu_bacteria 2874612657 2874612869 110
18 3300048912 Ga0496109_0181216 Ga0496109_0181216_21_368 115
19 iso_pu_bacteria 2906626472 2906628453 116
20 iso_pu_bacteria 2885383462 2885386441 118
21 iso_pu_bacteria 2513237092 2513627209 120
22 iso_pu_bacteria 2513237139 2513876485 120
23 iso_pu_bacteria 2513237161 2514010827 120
24 iso_pu_bacteria 2617270735 2617354093 120
25 iso_pu_bacteria 2791355196 2793064012 120
26 iso_pu_bacteria 2802429603 2805919764 120
27 iso_pu_bacteria 2824600985 2824603325 120
28 iso_pu_bacteria 2824609381 2824614025 120
29 iso_pu_bacteria 2824671348 2824675649 120
30 iso_pu_bacteria 2824687955 2824691856 120
31 iso_pu_bacteria 2824696289 2824699149 120
32 iso_pu_bacteria 2838122688 2838126514 120
33 iso_pu_bacteria 2841941048 2841947172 120
34 iso_pu_bacteria 2841966195 2841966929 120
35 iso_pu_bacteria 2841974524 2841975678 120
36 iso_pu_bacteria 2841983080 2841990041 120
37 iso_pu_bacteria 2844315083 2844318413 120
38 iso_pu_bacteria 2847939898 2847945889 120
39 iso_pu_bacteria 2874620515 2874627914 120
40 iso_pu_bacteria 2876761206 2876770690 120
41 iso_pu_bacteria 2881665667 2881670849 120
42 iso_pu_bacteria 2885366525 2885371808 120
43 iso_pu_bacteria 2903727486 2903729361 120
44 iso_pu_bacteria 2904666416 2904672766 120
45 iso_pu_bacteria 2906602504 2906605998 120
46 iso_pu_bacteria 2906643746 2906650093 120
47 iso_pu_bacteria 8016583857 8016592725 120
48 3300003215 JGI25153J46596_10020371 JGI25153J46596_100203711 122
49 3300025297 Ga0209758_1005279 Ga0209758_10052798 122
50 3300038443 Ga0395901_1189637 Ga0395901_1189637_23_391 122
51 3300044683 Ga0466965_0192681 Ga0466965_0192681_147_527 122
52 3300048904 Ga0496101_1093347 Ga0496101_1093347_207_575 122
53 3300048909 Ga0496106_0039508 Ga0496106_0039508_1609_1977 122
54 3300048910 Ga0496107_0038503 Ga0496107_0038503_2794_3162 122
55 3300048913 Ga0496110_0087301 Ga0496110_0087301_248_616 122
56 3300048914 Ga0496111_0285567 Ga0496111_0285567_461_829 122
57 3300048915 Ga0496112_0026277 Ga0496112_0026277_940_1308 122
58 3300048916 Ga0496113_0243924 Ga0496113_0243924_184_552 122
59 3300048918 Ga0496115_0489869 Ga0496115_0489869_318_686 122
60 iso_pu_bacteria 2932801729 2932803469 123
61 iso_pu_bacteria 2935959822 2935960419 123
62 iso_pu_bacteria 3005594810 3005598510 123
63 iso_pu_bacteria 3005710791 3005714184 123
64 3300003214 JGI25165J46597_1003217 JGI25165J46597_10032173 124
65 3300003215 JGI25153J46596_10006254 JGI25153J46596_100062545 124
66 3300003215 JGI25153J46596_10021831 JGI25153J46596_100218312 124
67 3300003762 Ga0055542_1011474 Ga0055542_10114742 124
68 3300004625 Ga0055543_1004622 Ga0055543_10046222 124
69 3300005262 Ga0065165_1002626 Ga0065165_10026265 124
70 3300005262 Ga0065165_1044295 Ga0065165_10442951 124
71 3300005335 Ga0070666_10954784 Ga0070666_109547841 124
72 3300005337 Ga0070682_100911015 Ga0070682_1009110151 124
73 3300005339 Ga0070660_100100527 Ga0070660_1001005272 124
74 3300005347 Ga0070668_102163136 Ga0070668_1021631361 124
75 3300005366 Ga0070659_100357809 Ga0070659_1003578091 124
76 3300005457 Ga0070662_100201661 Ga0070662_1002016612 124
77 3300005614 Ga0068856_100310026 Ga0068856_1003100261 124
78 3300005616 Ga0068852_100086017 Ga0068852_1000860172 124
79 3300005616 Ga0068852_101267761 Ga0068852_1012677612 124
80 3300006028 Ga0070717_10400462 Ga0070717_104004621 124
81 3300006038 Ga0075365_10043397 Ga0075365_100433972 124
82 3300006042 Ga0075368_10302894 Ga0075368_103028941 124
83 3300006178 Ga0075367_10740070 Ga0075367_107400701 124
84 3300006186 Ga0075369_10007946 Ga0075369_100079461 124
85 3300006195 Ga0075366_10105826 Ga0075366_101058261 124
86 3300006195 Ga0075366_10184893 Ga0075366_101848932 124
87 3300006353 Ga0075370_10249065 Ga0075370_102490651 124
88 3300006942 Ga0099824_1029108 Ga0099824_10291081 124
89 3300009093 Ga0105240_10039775 Ga0105240_100397755 124
90 3300009093 Ga0105240_10826879 Ga0105240_108268791 124
91 3300009098 Ga0105245_10134756 Ga0105245_101347562 124
92 3300009101 Ga0105247_10649698 Ga0105247_106496981 124
93 3300009174 Ga0105241_10009347 Ga0105241_100093477 124
94 3300009174 Ga0105241_10045565 Ga0105241_100455652 124
95 3300009545 Ga0105237_10071400 Ga0105237_100714002 124
96 3300010375 Ga0105239_10015570 Ga0105239_100155707 124
97 3300010375 Ga0105239_10021536 Ga0105239_100215361 124
98 3300010375 Ga0105239_10099745 Ga0105239_100997452 124
99 3300010375 Ga0105239_10247509 Ga0105239_102475092 124
100 3300010375 Ga0105239_10602043 Ga0105239_106020432 124
101 3300010375 Ga0105239_11183362 Ga0105239_111833622 124
102 3300010375 Ga0105239_12766805 Ga0105239_127668051 124
103 3300013307 Ga0157372_11916993 Ga0157372_119169931 124
104 3300014969 Ga0157376_11098511 Ga0157376_110985111 124
105 3300021384 Ga0213876_10618006 Ga0213876_106180061 124
106 3300025250 Ga0209026_1034480 Ga0209026_10344801 124
107 3300025254 Ga0209148_1000155 Ga0209148_1000155101 124
108 3300025261 Ga0209233_1005486 Ga0209233_10054864 124
109 3300025261 Ga0209233_1010968 Ga0209233_10109682 124
110 3300025272 Ga0209455_1004009 Ga0209455_10040092 124
111 3300025272 Ga0209455_1018779 Ga0209455_10187791 124
112 3300025297 Ga0209758_1000808 Ga0209758_100080825 124
113 3300025297 Ga0209758_1007887 Ga0209758_10078875 124
114 3300025297 Ga0209758_1114986 Ga0209758_11149861 124
115 3300025911 Ga0207654_10036299 Ga0207654_100362991 124
116 3300025911 Ga0207654_10373643 Ga0207654_103736432 124
117 3300025913 Ga0207695_10000278 Ga0207695_100002782 124
118 3300025914 Ga0207671_10014408 Ga0207671_100144086 124
119 3300025919 Ga0207657_10108803 Ga0207657_101088033 124
120 3300025981 Ga0207640_10073189 Ga0207640_100731891 124
121 3300026078 Ga0207702_11098885 Ga0207702_110988851 124
122 3300026116 Ga0207674_10130181 Ga0207674_101301812 124
123 3300026142 Ga0207698_10194303 Ga0207698_101943032 124
124 3300026142 Ga0207698_10904486 Ga0207698_109044861 124
125 3300027296 Ga0209389_1000026 Ga0209389_1000026118 124
126 3300027357 Ga0209589_1000022 Ga0209589_1000022118 124
127 3300027361 Ga0209489_100058 Ga0209489_100058119 124
128 3300033180 Ga0307510_10024391 Ga0307510_100243915 124
129 3300035695 Ga0373927_1184098 Ga0373927_1184098_57_443 124
130 3300039437 Ga0436365_0375807 Ga0436365_0375807_91_477 124
131 3300044656 Ga0466969_0049264 Ga0466969_0049264_1520_1894 124
132 3300044684 Ga0466966_0000461 Ga0466966_0000461_10311_10685 124
133 3300044693 Ga0466961_0000015 Ga0466961_0000015_20185_20559 124
134 3300044694 Ga0466963_0363515 Ga0466963_0363515_540_926 124
135 3300044735 Ga0466968_0121658 Ga0466968_0121658_420_794 124
136 3300044901 Ga0466960_0168337 Ga0466960_0168337_338_712 124
137 3300045049 Ga0466959_0043463 Ga0466959_0043463_1465_1839 124
138 3300045976 Ga0466967_0199884 Ga0466967_0199884_50_436 124
139 3300045976 Ga0466967_0729989 Ga0466967_0729989_326_700 124
140 3300046454 Ga0495592_0214576 Ga0495592_0214576_342_728 124
141 3300046454 Ga0495592_0476899 Ga0495592_0476899_106_480 124
142 3300046457 Ga0495590_0055756 Ga0495590_0055756_867_1241 124
143 3300046462 Ga0495651_0021798 Ga0495651_0021798_2178_2564 124
144 3300046477 Ga0495664_0647778 Ga0495664_0647778_158_532 124
145 3300046477 Ga0495664_0648949 Ga0495664_0648949_175_561 124
146 3300046501 Ga0495607_0417325 Ga0495607_0417325_58_432 124
147 3300046506 Ga0495583_0040099 Ga0495583_0040099_1077_1451 124
148 3300046507 Ga0495606_0031429 Ga0495606_0031429_752_1126 124
149 3300046516 Ga0495628_0072920 Ga0495628_0072920_2026_2400 124
150 3300046516 Ga0495628_1258293 Ga0495628_1258293_86_472 124
151 3300046522 Ga0495643_0285316 Ga0495643_0285316_169_543 124
152 3300046522 Ga0495643_0526239 Ga0495643_0526239_61_435 124
153 3300046524 Ga0495648_0063283 Ga0495648_0063283_1306_1680 124
154 3300046524 Ga0495648_0263346 Ga0495648_0263346_118_492 124
155 3300046529 Ga0495652_0066896 Ga0495652_0066896_1228_1614 124
156 3300046529 Ga0495652_0156166 Ga0495652_0156166_362_748 124
157 3300046533 Ga0495640_0784833 Ga0495640_0784833_61_447 124
158 3300046536 Ga0495587_0010262 Ga0495587_0010262_5550_5936 124
159 3300046543 Ga0495645_0107434 Ga0495645_0107434_338_724 124
160 3300046642 Ga0495634_0444532 Ga0495634_0444532_341_715 124
161 3300046648 Ga0495611_0310887 Ga0495611_0310887_159_533 124
162 3300046660 Ga0495625_0040873 Ga0495625_0040873_1793_2167 124
163 3300046660 Ga0495625_0676729 Ga0495625_0676729_167_541 124
164 3300046675 Ga0495657_0008942 Ga0495657_0008942_2007_2393 124
165 3300046678 Ga0495599_0005099 Ga0495599_0005099_1893_2279 124
166 3300046679 Ga0495623_0006496 Ga0495623_0006496_3153_3539 124
167 3300046680 Ga0495646_0304558 Ga0495646_0304558_279_665 124
168 3300046680 Ga0495646_0414199 Ga0495646_0414199_167_553 124
169 3300046690 Ga0495624_0207292 Ga0495624_0207292_86_460 124
170 3300046690 Ga0495624_0464154 Ga0495624_0464154_79_465 124
171 3300046694 Ga0495649_0035728 Ga0495649_0035728_1112_1486 124
172 3300046794 Ga0495589_0066525 Ga0495589_0066525_700_1074 124
173 3300046809 Ga0495600_0082019 Ga0495600_0082019_1282_1668 124
174 3300047317 Ga0495604_0049343 Ga0495604_0049343_2563_2949 124
175 3300047317 Ga0495604_0102220 Ga0495604_0102220_1563_1949 124
176 3300047319 Ga0495674_0025732 Ga0495674_0025732_3806_4192 124
177 3300047320 Ga0495672_0128172 Ga0495672_0128172_733_1107 124
178 3300047322 Ga0495680_0002707 Ga0495680_0002707_4719_5105 124
179 3300047323 Ga0495683_0032448 Ga0495683_0032448_798_1172 124
180 3300047469 Ga0495673_0133955 Ga0495673_0133955_197_571 124
181 3300047471 Ga0495684_0056076 Ga0495684_0056076_953_1339 124
182 3300047472 Ga0495686_0196047 Ga0495686_0196047_146_520 124
183 3300047673 Ga0495593_0349272 Ga0495593_0349272_297_683 124
184 3300048088 Ga0495602_0153781 Ga0495602_0153781_323_709 124
185 3300048091 Ga0495626_0277135 Ga0495626_0277135_148_522 124
186 3300048921 Ga0496118_0398575 Ga0496118_0398575_16_390 124
187 3300048929 Ga0496126_0293333 Ga0496126_0293333_137_511 124
188 3300048929 Ga0496126_0589304 Ga0496126_0589304_158_532 124
189 3300049460 Ga0495682_0009475 Ga0495682_0009475_1845_2219 124
190 3300049744 Ga0501083_1117552 Ga0501083_1117552_118_492 124
191 3300050491 nmdc:mga00v17_24572_c1 nmdc:mga00v17_24572_c1_2650_3024 124
192 3300050492 nmdc:mga0yw44_14411_c1 nmdc:mga0yw44_14411_c1_2396_2770 124
193 3300050494 nmdc:mga06z11_131404_c1 nmdc:mga06z11_131404_c1_284_658 124
194 3300050494 nmdc:mga06z11_183052_c1 nmdc:mga06z11_183052_c1_46_432 124
195 3300050496 nmdc:mga07m45_228776_c1 nmdc:mga07m45_228776_c1_396_770 124
196 3300050516 nmdc:mga0sz30_5035_c1 nmdc:mga0sz30_5035_c1_655_1029 124
197 3300053085 Ga0495619_0099660 Ga0495619_0099660_1155_1541 124
198 3300053095 Ga0500640_269004 Ga0500640_269004_115_489 124
199 3300053097 Ga0500648_285635 Ga0500648_285635_170_544 124
200 3300053109 Ga0500569_118123 Ga0500569_118123_378_752 124
201 3300053111 Ga0500572_053375 Ga0500572_053375_255_629 124
202 3300053119 Ga0500595_080927 Ga0500595_080927_80_454 124
203 3300053119 Ga0500595_135368 Ga0500595_135368_180_554 124
204 3300053119 Ga0500595_178780 Ga0500595_178780_188_574 124
205 3300053121 Ga0500607_051520 Ga0500607_051520_247_621 124
206 3300053122 Ga0500608_052844 Ga0500608_052844_997_1371 124
207 3300053138 Ga0500564_018367 Ga0500564_018367_2481_2855 124
208 3300053155 Ga0500620_027159 Ga0500620_027159_1089_1463 124
209 3300053157 Ga0500624_101694 Ga0500624_101694_179_553 124
210 3300053162 Ga0500638_107057 Ga0500638_107057_277_663 124
211 3300053177 Ga0500636_0000333 Ga0500636_0000333_9610_9984 124
212 3300053177 Ga0500636_0402023 Ga0500636_0402023_222_608 124
213 iso_pu_bacteria 2513237094 2513637882 124
214 iso_pu_bacteria 2513237094 2513637886 124
215 iso_pu_bacteria 2744054633 2745081107 124
216 iso_pu_bacteria 2824773399 2824779118 124
217 iso_pu_bacteria 2841949485 2841950615 124
218 iso_pu_bacteria 2876761206 2876770694 124
219 iso_pu_bacteria 2881364244 2881366727 124
220 iso_pu_bacteria 2932794094 2932796535 124
221 iso_pu_bacteria 2935883170 2935886538 124
222 iso_pu_bacteria 2941531003 2941534165 124
223 iso_pu_bacteria 3005718088 3005721684 124
224 iso_pu_bacteria 8019648815 8019657551 124
225 iso_pu_bacteria 8056967851 8056972770 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11162

DUF2946

Protein of unknown function (DUF2946)

14

126

0.84

Feature Viewer

pLDDT pTM Quality
55.87 0.23 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map