F337704

General Info

Members Datasets Scaffolds Average Seq Length
225 148 224 196

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10272216|Ga0111539_102722162
Length 213
Sequence MDSIQTKVGKVGATCFSPKFVAMIRMLFLPLIIFFVCCSTTDKNTHVEIRTSIGSIEVELYPDKAPNSVAAFLSYVDSGFYENTSFYRVLTDQNQPSDAFKSNLIQGGLWRTGRRKNLTGIPHEPTNQTGIQHKNGVISLARLEPGTATTEFFICIGDQPGYDYGGENNPDKQGYAAFGRVVKGMDIVNRIYQLNESDQYFDPPVPIYNITRK

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
110 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
135 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
136 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
137 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
138 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
142 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
147 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
148 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.56
Nodule 0
Rhizoplane 0
Rhizosphere 79.11
Stem 0
Stem Tuber 0
Unclassified 9.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10091706 3300003316 Bacteria 2788
2 rootL2_10056000 3300003322 Bacteria 1945
3 rootL2_10361385 3300003322 Bacteria 1942
4 rootH1_10011869 3300003323 Bacteria 39408
5 rootH1_10093894 3300003323 Unclassified 3113
6 rootH1_10195167 3300003323 Bacteria 2318
7 rootH1_10200213 3300003323 Bacteria 1725
8 Ga0070658_10177171 3300005327 Bacteria 1793
9 Ga0070670_100695525 3300005331 Bacteria 914
10 Ga0070666_10000101 3300005335 Bacteria 58900
11 Ga0068868_100346591 3300005338 Bacteria 1271
12 Ga0070689_100121754 3300005340 Bacteria 2084
13 Ga0070661_100123293 3300005344 Bacteria 1942
14 Ga0070671_100349341 3300005355 Bacteria 1262
15 Ga0070674_100060304 3300005356 Bacteria 2644
16 Ga0070659_100268854 3300005366 Bacteria 1416
17 Ga0070667_100122113 3300005367 Bacteria 2266
18 Ga0068867_100552716 3300005459 Bacteria 997
19 Ga0070684_101026180 3300005535 Bacteria 774
20 Ga0070672_100650045 3300005543 Bacteria 921
21 Ga0070665_100000002 3300005548 Bacteria 849037
22 Ga0068855_100028799 3300005563 Bacteria 6645
23 Ga0068855_100066611 3300005563 Bacteria 4199
24 Ga0068855_100105097 3300005563 Bacteria 3247
25 Ga0068857_100006960 3300005577 Bacteria 9734
26 Ga0068857_100234873 3300005577 Bacteria 1677
27 Ga0068854_100017672 3300005578 Unclassified 4776
28 Ga0068856_100022494 3300005614 Bacteria 6130
29 Ga0068852_100002505 3300005616 Bacteria 12646
30 Ga0068852_100125840 3300005616 Bacteria 2353
31 Ga0068852_101232647 3300005616 Bacteria 769
32 Ga0068859_100000007 3300005617 Bacteria 390070
33 Ga0068859_100951632 3300005617 Bacteria 942
34 Ga0068864_100033096 3300005618 Bacteria 4394
35 Ga0068861_100082686 3300005719 Bacteria 2517
36 Ga0068863_100042265 3300005841 Bacteria 4331
37 Ga0068858_100014543 3300005842 Bacteria 7415
38 Ga0068860_100000003 3300005843 Bacteria 575741
39 Ga0068860_100141794 3300005843 Unclassified 2310
40 Ga0068862_100157335 3300005844 Bacteria 2026
41 Ga0068862_100555474 3300005844 Bacteria 1097
42 Ga0081455_10424504 3300005937 Bacteria 916
43 Ga0075366_10155297 3300006195 Bacteria 1386
44 Ga0097621_100015725 3300006237 Bacteria 5702
45 Ga0097621_100068359 3300006237 Bacteria 2930
46 Ga0097621_100519762 3300006237 Bacteria 1080
47 Ga0068871_100041939 3300006358 Bacteria 3671
48 Ga0068871_100449625 3300006358 Bacteria 1154
49 Ga0068865_100577425 3300006881 Bacteria 947
50 Ga0097620_100000007 3300006931 Bacteria 390070
51 Ga0097620_100951705 3300006931 Bacteria 942
52 Ga0105240_10020206 3300009093 Bacteria 8890
53 Ga0105240_10110096 3300009093 Bacteria 3334
54 Ga0105240_11157108 3300009093 Unclassified 821
55 Ga0111539_10272216 3300009094 Bacteria 1971
56 Ga0111539_10528227 3300009094 Unclassified 1375
57 Ga0105245_10162185 3300009098 Bacteria 2122
58 Ga0105247_10017643 3300009101 Bacteria 4281
59 Ga0114129_10008068 3300009147 Bacteria 15001
60 Ga0105243_10255724 3300009148 Bacteria 1566
61 Ga0105241_10000622 3300009174 Bacteria 26623
62 Ga0105241_10000649 3300009174 Bacteria 26087
63 Ga0105241_10031204 3300009174 Bacteria 3989
64 Ga0105241_10091242 3300009174 Bacteria 2403
65 Ga0105242_11239621 3300009176 Bacteria 767
66 Ga0105237_10000553 3300009545 Bacteria 52367
67 Ga0105237_10001595 3300009545 Bacteria 29470
68 Ga0105237_10013341 3300009545 Bacteria 8620
69 Ga0105237_11421859 3300009545 Bacteria 700
70 Ga0105238_10023246 3300009551 Bacteria 6318
71 Ga0105238_10079136 3300009551 Unclassified 3277
72 Ga0105249_10583411 3300009553 Bacteria 1171
73 Ga0105249_11331627 3300009553 Bacteria 790
74 Ga0105239_10000746 3300010375 Bacteria 46202
75 Ga0105239_10089080 3300010375 Bacteria 3403
76 Ga0105239_10101724 3300010375 Unclassified 3179
77 Ga0105239_10166627 3300010375 Bacteria 2464
78 Ga0105246_10050969 3300011119 Bacteria 2841
79 Ga0105246_10182103 3300011119 Bacteria 1618
80 Ga0157373_10262052 3300013100 Unclassified 1223
81 Ga0157371_10002722 3300013102 Bacteria 16650
82 Ga0157371_10039731 3300013102 Bacteria 3364
83 Ga0157370_10015629 3300013104 Bacteria 7710
84 Ga0157370_10042686 3300013104 Bacteria 4369
85 Ga0157369_10110480 3300013105 Bacteria 2922
86 Ga0157374_10217658 3300013296 Unclassified 1874
87 Ga0157378_10019593 3300013297 Bacteria 5947
88 Ga0157378_10983364 3300013297 Bacteria 877
89 Ga0163162_10000712 3300013306 Bacteria 30828
90 Ga0163162_10695427 3300013306 Bacteria 1139
91 Ga0157372_10006426 3300013307 Bacteria 12511
92 Ga0157372_10078561 3300013307 Bacteria 3729
93 Ga0157372_10308178 3300013307 Bacteria 1843
94 Ga0157372_10512377 3300013307 Unclassified 1399
95 Ga0157375_10011496 3300013308 Bacteria 7820
96 Ga0163163_10794861 3300014325 Bacteria 1009
97 Ga0157376_10000780 3300014969 Bacteria 20811
98 Ga0157376_10550496 3300014969 Bacteria 1142
99 Ga0209646_1005857 3300025246 Bacteria 2110
100 Ga0207656_10313695 3300025321 Bacteria 778
101 Ga0207710_10013895 3300025900 Bacteria 3390
102 Ga0207680_10000015 3300025903 Bacteria 138253
103 Ga0207647_10007605 3300025904 Bacteria 7808
104 Ga0207647_10025812 3300025904 Bacteria 3852
105 Ga0207654_10003278 3300025911 Bacteria 8185
106 Ga0207654_10052252 3300025911 Bacteria 2355
107 Ga0207654_10347943 3300025911 Bacteria 1020
108 Ga0207707_10426084 3300025912 Unclassified 1137
109 Ga0207695_10003629 3300025913 Bacteria 21576
110 Ga0207695_10483794 3300025913 Unclassified 1120
111 Ga0207695_10774417 3300025913 Bacteria 840
112 Ga0207671_10001648 3300025914 Bacteria 25416
113 Ga0207671_10003155 3300025914 Bacteria 16685
114 Ga0207671_10004517 3300025914 Bacteria 13236
115 Ga0207671_10004537 3300025914 Bacteria 13192
116 Ga0207671_10020007 3300025914 Bacteria 5106
117 Ga0207671_10029591 3300025914 Bacteria 4089
118 Ga0207649_10604362 3300025920 Unclassified 844
119 Ga0207694_10007871 3300025924 Bacteria 8069
120 Ga0207694_10031411 3300025924 Bacteria 4057
121 Ga0207650_10058030 3300025925 Bacteria 2881
122 Ga0207650_10265212 3300025925 Bacteria 1394
123 Ga0207650_10939198 3300025925 Bacteria 735
124 Ga0207687_10297019 3300025927 Unclassified 1300
125 Ga0207644_10169600 3300025931 Bacteria 1703
126 Ga0207690_10307355 3300025932 Bacteria 1243
127 Ga0207686_10518224 3300025934 Bacteria 927
128 Ga0207669_10522298 3300025937 Bacteria 953
129 Ga0207691_10188755 3300025940 Bacteria 1798
130 Ga0207689_10003450 3300025942 Bacteria 14436
131 Ga0207667_10001058 3300025949 Bacteria 34902
132 Ga0207667_10087937 3300025949 Bacteria 3214
133 Ga0207667_10129137 3300025949 Bacteria 2603
134 Ga0207651_10265866 3300025960 Bacteria 1410
135 Ga0207712_10568200 3300025961 Bacteria 977
136 Ga0207668_10563587 3300025972 Bacteria 988
137 Ga0207640_10009598 3300025981 Bacteria 5425
138 Ga0207703_10000798 3300026035 Bacteria 31051
139 Ga0207639_10197016 3300026041 Bacteria 1725
140 Ga0207702_10024287 3300026078 Bacteria 5029
141 Ga0207702_10188488 3300026078 Bacteria 1904
142 Ga0207641_10000056 3300026088 Bacteria 170719
143 Ga0207676_10035456 3300026095 Bacteria 3786
144 Ga0207674_10004281 3300026116 Bacteria 17213
145 Ga0207675_100156943 3300026118 Bacteria 2168
146 Ga0207675_100753117 3300026118 Bacteria 985
147 Ga0207698_10002611 3300026142 Bacteria 10713
148 Ga0207698_10043182 3300026142 Bacteria 3376
149 Ga0268266_10000073 3300028379 Bacteria 232074
150 Ga0268265_10305989 3300028380 Bacteria 1433
151 Ga0268264_10000063 3300028381 Bacteria 301702
152 Ga0268264_10123165 3300028381 Unclassified 2288
153 Ga0268264_10384547 3300028381 Bacteria 1345
154 Ga0307517_10176074 3300028786 Bacteria 1393
155 Ga0307515_10000078 3300028794 Bacteria 227988
156 Ga0307511_10000418 3300030521 Bacteria 45353
157 Ga0307513_10056303 3300031456 Bacteria 4199
158 Ga0307513_10701356 3300031456 Bacteria 718
159 Ga0307509_10090724 3300031507 Bacteria 3130
160 Ga0307509_10103560 3300031507 Bacteria 2874
161 Ga0307509_10153481 3300031507 Bacteria 2213
162 Ga0307508_10000763 3300031616 Bacteria 38032
163 Ga0307510_10002127 3300033180 Bacteria 22383
164 Ga0373927_0188447 3300035695 Bacteria 1353
165 Ga0395899_0109412 3300037312 Bacteria 1988
166 Ga0395900_0189264 3300037418 Bacteria 2088
167 Ga0395905_0237681 3300037471 Bacteria 1703
168 Ga0395901_0038229 3300038443 Bacteria 4964
169 Ga0436365_1837098 3300039437 Bacteria 29699
170 Ga0439436_0009333 3300041404 Bacteria 3007
171 Ga0439439_0007913 3300041406 Bacteria 2499
172 Ga0451841_0364258 3300041498 Bacteria 1381
173 Ga0439457_004560 3300042014 Bacteria 3594
174 Ga0439457_076904 3300042014 Bacteria 765
175 Ga0439462_0003813 3300042015 Bacteria 3637
176 Ga0466969_0000371 3300044656 Bacteria 24624
177 Ga0466972_0000069 3300044658 Bacteria 100746
178 Ga0466972_0000075 3300044658 Bacteria 94290
179 Ga0466972_0012429 3300044658 Bacteria 4279
180 Ga0466966_0000131 3300044684 Bacteria 48304
181 Ga0466964_0196014 3300044706 Bacteria 967
182 Ga0466971_0043056 3300044719 Bacteria 2029
183 Ga0466968_0254426 3300044735 Bacteria 835
184 Ga0466970_0001235 3300044765 Bacteria 12398
185 Ga0466957_0001583 3300044842 Bacteria 11952
186 Ga0466959_0000003 3300045049 Bacteria 285164
187 Ga0495638_0032215 3300046460 Bacteria 3363
188 Ga0495648_0004428 3300046524 Bacteria 12000
189 Ga0495668_0000354 3300046616 Bacteria 60932
190 Ga0495668_0446281 3300046616 Bacteria 712
191 Ga0495611_0000037 3300046648 Bacteria 101602
192 Ga0495611_0050364 3300046648 Bacteria 1876
193 Ga0495625_0061030 3300046660 Bacteria 2669
194 Ga0495687_000040 3300047443 Bacteria 230786
195 Ga0495686_0000010 3300047472 Bacteria 573229
196 Ga0501225_0003596 3300049705 Bacteria 4672
197 nmdc:mga0k408_326670_c1 3300050493 Bacteria 915
198 nmdc:mga05p37_10194_c2 3300050507 Bacteria 9428
199 nmdc:mga08y16_134062_c1 3300050511 Bacteria 2574
200 nmdc:mga08y16_579890_c1 3300050511 Unclassified 1132
201 Ga0500578_0000091 3300053086 Bacteria 102427
202 Ga0500578_0047180 3300053086 Bacteria 2764
203 Ga0500646_0032581 3300053090 Unclassified 1439
204 Ga0500646_0088981 3300053090 Bacteria 953
205 Ga0500646_0228814 3300053090 Unclassified 647
206 Ga0500583_0000011 3300053092 Bacteria 160380
207 Ga0500583_0000236 3300053092 Bacteria 19755
208 Ga0500583_0189563 3300053092 Bacteria 1023
209 Ga0500642_0028130 3300053130 Bacteria 2315
210 Ga0500658_0278215 3300053134 Bacteria 769
211 Ga0500559_0034514 3300053136 Bacteria 2182
212 Ga0500573_0319397 3300053140 Bacteria 768
213 Ga0500589_046126 3300053147 Bacteria 2030
214 Ga0500604_0001758 3300053151 Bacteria 6061
215 Ga0500616_0000445 3300053153 Bacteria 54193
216 Ga0500619_079057 3300053154 Bacteria 1103
217 Ga0500622_0001414 3300053156 Bacteria 19338
218 Ga0500622_0009918 3300053156 Bacteria 5255
219 Ga0500622_0038868 3300053156 Bacteria 2482
220 Ga0500622_0098188 3300053156 Bacteria 1446
221 Ga0500636_0099613 3300053177 Bacteria 1654
222 Ga0500637_0316504 3300053178 Bacteria 845
223 Ga0500645_002604 3300053730 Bacteria 7923
224 Ga0500645_034826 3300053730 Bacteria 1503

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10039731 Ga0157371_100397312 181
2 3300013104 Ga0157370_10042686 Ga0157370_100426861 181
3 3300013307 Ga0157372_10078561 Ga0157372_100785612 181
4 3300037312 Ga0395899_0109412 Ga0395899_0109412_368_919 181
5 3300037418 Ga0395900_0189264 Ga0395900_0189264_1360_1911 181
6 3300037471 Ga0395905_0237681 Ga0395905_0237681_489_1040 181
7 3300038443 Ga0395901_0038229 Ga0395901_0038229_680_1231 181
8 3300053090 Ga0500646_0032581 Ga0500646_0032581_311_856 181
9 3300005331 Ga0070670_100695525 Ga0070670_1006955251 185
10 3300025925 Ga0207650_10939198 Ga0207650_109391981 185
11 3300005356 Ga0070674_100060304 Ga0070674_1000603042 188
12 3300009094 Ga0111539_10272216 Ga0111539_102722162 188
13 3300025937 Ga0207669_10522298 Ga0207669_105222981 188
14 3300050511 nmdc:mga08y16_134062_c1 nmdc:mga08y16_134062_c1_1422_2063 188
15 iso_pu_bacteria 2818991444 2819585585 190
16 3300005459 Ga0068867_100552716 Ga0068867_1005527161 191
17 3300025912 Ga0207707_10426084 Ga0207707_104260842 191
18 3300053136 Ga0500559_0034514 Ga0500559_0034514_478_1053 191
19 3300005844 Ga0068862_100157335 Ga0068862_1001573352 192
20 3300005937 Ga0081455_10424504 Ga0081455_104245041 192
21 3300009094 Ga0111539_10528227 Ga0111539_105282272 192
22 3300014969 Ga0157376_10550496 Ga0157376_105504961 192
23 3300028380 Ga0268265_10305989 Ga0268265_103059892 192
24 3300046460 Ga0495638_0032215 Ga0495638_0032215_1391_1969 192
25 3300046616 Ga0495668_0000354 Ga0495668_0000354_26357_26935 192
26 3300046648 Ga0495611_0050364 Ga0495611_0050364_522_1100 192
27 3300050511 nmdc:mga08y16_579890_c1 nmdc:mga08y16_579890_c1_272_850 192
28 3300053090 Ga0500646_0228814 Ga0500646_0228814_12_590 192
29 3300053130 Ga0500642_0028130 Ga0500642_0028130_1222_1800 192
30 3300053151 Ga0500604_0001758 Ga0500604_0001758_152_730 192
31 3300053156 Ga0500622_0038868 Ga0500622_0038868_1142_1720 192
32 3300053730 Ga0500645_002604 Ga0500645_002604_2431_3009 192
33 3300053730 Ga0500645_034826 Ga0500645_034826_434_1027 192
34 3300003323 rootH1_10093894 rootH1_100938943 193
35 3300005563 Ga0068855_100066611 Ga0068855_1000666114 193
36 3300005577 Ga0068857_100234873 Ga0068857_1002348733 193
37 3300009147 Ga0114129_10008068 Ga0114129_100080685 193
38 3300009174 Ga0105241_10031204 Ga0105241_100312044 193
39 3300010375 Ga0105239_10000746 Ga0105239_1000074636 193
40 3300010375 Ga0105239_10166627 Ga0105239_101666273 193
41 3300013307 Ga0157372_10308178 Ga0157372_103081781 193
42 3300025914 Ga0207671_10029591 Ga0207671_100295913 193
43 3300025949 Ga0207667_10087937 Ga0207667_100879374 193
44 3300026078 Ga0207702_10188488 Ga0207702_101884882 193
45 3300031507 Ga0307509_10090724 Ga0307509_100907242 193
46 3300031507 Ga0307509_10103560 Ga0307509_101035602 193
47 3300044656 Ga0466969_0000371 Ga0466969_0000371_12492_13076 193
48 3300044684 Ga0466966_0000131 Ga0466966_0000131_19266_19850 193
49 3300044706 Ga0466964_0196014 Ga0466964_0196014_50_634 193
50 3300044719 Ga0466971_0043056 Ga0466971_0043056_340_924 193
51 3300044735 Ga0466968_0254426 Ga0466968_0254426_46_630 193
52 3300044842 Ga0466957_0001583 Ga0466957_0001583_744_1328 193
53 3300045049 Ga0466959_0000003 Ga0466959_0000003_34703_35287 193
54 3300049705 Ga0501225_0003596 Ga0501225_0003596_2661_3245 193
55 3300050507 nmdc:mga05p37_10194_c2 nmdc:mga05p37_10194_c2_7986_8570 193
56 3300003322 rootL2_10056000 rootL2_100560002 194
57 3300003322 rootL2_10361385 rootL2_103613852 194
58 3300003323 rootH1_10011869 rootH1_1001186923 194
59 3300003323 rootH1_10195167 rootH1_101951672 194
60 3300003323 rootH1_10200213 rootH1_102002132 194
61 3300005548 Ga0070665_100000002 Ga0070665_100000002541 194
62 3300005719 Ga0068861_100082686 Ga0068861_1000826862 194
63 3300005843 Ga0068860_100000003 Ga0068860_100000003158 194
64 3300006195 Ga0075366_10155297 Ga0075366_101552973 194
65 3300009174 Ga0105241_10000649 Ga0105241_1000064925 194
66 3300009545 Ga0105237_10013341 Ga0105237_100133417 194
67 3300013297 Ga0157378_10983364 Ga0157378_109833641 194
68 3300013306 Ga0163162_10000712 Ga0163162_1000071230 194
69 3300025246 Ga0209646_1005857 Ga0209646_10058574 194
70 3300025911 Ga0207654_10052252 Ga0207654_100522521 194
71 3300025913 Ga0207695_10003629 Ga0207695_1000362910 194
72 3300025914 Ga0207671_10004537 Ga0207671_1000453713 194
73 3300025924 Ga0207694_10007871 Ga0207694_100078717 194
74 3300026041 Ga0207639_10197016 Ga0207639_101970162 194
75 3300026118 Ga0207675_100156943 Ga0207675_1001569432 194
76 3300028379 Ga0268266_10000073 Ga0268266_10000073107 194
77 3300028381 Ga0268264_10000063 Ga0268264_1000006376 194
78 3300031456 Ga0307513_10056303 Ga0307513_100563031 194
79 3300031456 Ga0307513_10701356 Ga0307513_107013561 194
80 3300031616 Ga0307508_10000763 Ga0307508_1000076326 194
81 3300035695 Ga0373927_0188447 Ga0373927_0188447_342_929 194
82 3300041404 Ga0439436_0009333 Ga0439436_0009333_483_1070 194
83 3300041406 Ga0439439_0007913 Ga0439439_0007913_485_1072 194
84 3300041498 Ga0451841_0364258 Ga0451841_0364258_271_858 194
85 3300042014 Ga0439457_004560 Ga0439457_004560_2121_2708 194
86 3300042014 Ga0439457_076904 Ga0439457_076904_109_696 194
87 3300042015 Ga0439462_0003813 Ga0439462_0003813_39_626 194
88 3300044658 Ga0466972_0000075 Ga0466972_0000075_47432_48019 194
89 3300044658 Ga0466972_0012429 Ga0466972_0012429_3592_4179 194
90 3300046524 Ga0495648_0004428 Ga0495648_0004428_11182_11892 194
91 3300046660 Ga0495625_0061030 Ga0495625_0061030_1897_2607 194
92 3300047443 Ga0495687_000040 Ga0495687_000040_96079_96702 194
93 3300050493 nmdc:mga0k408_326670_c1 nmdc:mga0k408_326670_c1_238_825 194
94 3300053086 Ga0500578_0000091 Ga0500578_0000091_85331_85918 194
95 3300053086 Ga0500578_0047180 Ga0500578_0047180_1931_2518 194
96 3300053092 Ga0500583_0000011 Ga0500583_0000011_94567_95154 194
97 3300053092 Ga0500583_0000236 Ga0500583_0000236_7831_8418 194
98 3300053134 Ga0500658_0278215 Ga0500658_0278215_47_634 194
99 3300053140 Ga0500573_0319397 Ga0500573_0319397_20_607 194
100 3300053147 Ga0500589_046126 Ga0500589_046126_578_1165 194
101 3300053154 Ga0500619_079057 Ga0500619_079057_304_891 194
102 3300053156 Ga0500622_0001414 Ga0500622_0001414_10714_11298 194
103 3300053156 Ga0500622_0009918 Ga0500622_0009918_2226_2813 194
104 3300053156 Ga0500622_0098188 Ga0500622_0098188_410_997 194
105 3300053177 Ga0500636_0099613 Ga0500636_0099613_455_1042 194
106 3300003316 rootH1_10091706 rootH1_100917064 195
107 3300005327 Ga0070658_10177171 Ga0070658_101771712 195
108 3300005335 Ga0070666_10000101 Ga0070666_1000010133 195
109 3300005338 Ga0068868_100346591 Ga0068868_1003465912 195
110 3300005340 Ga0070689_100121754 Ga0070689_1001217542 195
111 3300005344 Ga0070661_100123293 Ga0070661_1001232932 195
112 3300005355 Ga0070671_100349341 Ga0070671_1003493412 195
113 3300005366 Ga0070659_100268854 Ga0070659_1002688542 195
114 3300005367 Ga0070667_100122113 Ga0070667_1001221132 195
115 3300005535 Ga0070684_101026180 Ga0070684_1010261801 195
116 3300005543 Ga0070672_100650045 Ga0070672_1006500451 195
117 3300005563 Ga0068855_100028799 Ga0068855_1000287996 195
118 3300005563 Ga0068855_100105097 Ga0068855_1001050973 195
119 3300005577 Ga0068857_100006960 Ga0068857_1000069604 195
120 3300005578 Ga0068854_100017672 Ga0068854_1000176724 195
121 3300005614 Ga0068856_100022494 Ga0068856_1000224944 195
122 3300005616 Ga0068852_100002505 Ga0068852_1000025056 195
123 3300005616 Ga0068852_100125840 Ga0068852_1001258402 195
124 3300005616 Ga0068852_101232647 Ga0068852_1012326471 195
125 3300005617 Ga0068859_100000007 Ga0068859_100000007130 195
126 3300005617 Ga0068859_100951632 Ga0068859_1009516321 195
127 3300005618 Ga0068864_100033096 Ga0068864_1000330962 195
128 3300005841 Ga0068863_100042265 Ga0068863_1000422653 195
129 3300005842 Ga0068858_100014543 Ga0068858_1000145433 195
130 3300005843 Ga0068860_100141794 Ga0068860_1001417943 195
131 3300005844 Ga0068862_100555474 Ga0068862_1005554742 195
132 3300006237 Ga0097621_100015725 Ga0097621_1000157253 195
133 3300006237 Ga0097621_100068359 Ga0097621_1000683593 195
134 3300006237 Ga0097621_100519762 Ga0097621_1005197621 195
135 3300006358 Ga0068871_100041939 Ga0068871_1000419392 195
136 3300006358 Ga0068871_100449625 Ga0068871_1004496252 195
137 3300006881 Ga0068865_100577425 Ga0068865_1005774252 195
138 3300006931 Ga0097620_100000007 Ga0097620_100000007131 195
139 3300006931 Ga0097620_100951705 Ga0097620_1009517051 195
140 3300009093 Ga0105240_10020206 Ga0105240_100202066 195
141 3300009093 Ga0105240_10110096 Ga0105240_101100964 195
142 3300009093 Ga0105240_11157108 Ga0105240_111571081 195
143 3300009098 Ga0105245_10162185 Ga0105245_101621852 195
144 3300009101 Ga0105247_10017643 Ga0105247_100176433 195
145 3300009148 Ga0105243_10255724 Ga0105243_102557242 195
146 3300009174 Ga0105241_10000622 Ga0105241_100006229 195
147 3300009174 Ga0105241_10091242 Ga0105241_100912422 195
148 3300009176 Ga0105242_11239621 Ga0105242_112396211 195
149 3300009545 Ga0105237_10000553 Ga0105237_1000055343 195
150 3300009545 Ga0105237_10001595 Ga0105237_100015955 195
151 3300009545 Ga0105237_11421859 Ga0105237_114218591 195
152 3300009551 Ga0105238_10023246 Ga0105238_100232466 195
153 3300009551 Ga0105238_10079136 Ga0105238_100791362 195
154 3300009553 Ga0105249_10583411 Ga0105249_105834111 195
155 3300009553 Ga0105249_11331627 Ga0105249_113316271 195
156 3300010375 Ga0105239_10089080 Ga0105239_100890805 195
157 3300010375 Ga0105239_10101724 Ga0105239_101017243 195
158 3300011119 Ga0105246_10050969 Ga0105246_100509692 195
159 3300011119 Ga0105246_10182103 Ga0105246_101821031 195
160 3300013100 Ga0157373_10262052 Ga0157373_102620521 195
161 3300013102 Ga0157371_10002722 Ga0157371_100027224 195
162 3300013104 Ga0157370_10015629 Ga0157370_100156296 195
163 3300013105 Ga0157369_10110480 Ga0157369_101104803 195
164 3300013296 Ga0157374_10217658 Ga0157374_102176582 195
165 3300013297 Ga0157378_10019593 Ga0157378_100195933 195
166 3300013306 Ga0163162_10695427 Ga0163162_106954271 195
167 3300013307 Ga0157372_10006426 Ga0157372_100064268 195
168 3300013307 Ga0157372_10512377 Ga0157372_105123772 195
169 3300013308 Ga0157375_10011496 Ga0157375_100114963 195
170 3300014325 Ga0163163_10794861 Ga0163163_107948612 195
171 3300014969 Ga0157376_10000780 Ga0157376_100007807 195
172 3300025321 Ga0207656_10313695 Ga0207656_103136951 195
173 3300025900 Ga0207710_10013895 Ga0207710_100138953 195
174 3300025903 Ga0207680_10000015 Ga0207680_10000015123 195
175 3300025904 Ga0207647_10007605 Ga0207647_100076054 195
176 3300025904 Ga0207647_10025812 Ga0207647_100258123 195
177 3300025911 Ga0207654_10003278 Ga0207654_100032782 195
178 3300025911 Ga0207654_10347943 Ga0207654_103479432 195
179 3300025913 Ga0207695_10483794 Ga0207695_104837942 195
180 3300025913 Ga0207695_10774417 Ga0207695_107744172 195
181 3300025914 Ga0207671_10001648 Ga0207671_100016488 195
182 3300025914 Ga0207671_10003155 Ga0207671_100031552 195
183 3300025914 Ga0207671_10004517 Ga0207671_1000451713 195
184 3300025914 Ga0207671_10020007 Ga0207671_100200073 195
185 3300025920 Ga0207649_10604362 Ga0207649_106043621 195
186 3300025924 Ga0207694_10031411 Ga0207694_100314113 195
187 3300025925 Ga0207650_10058030 Ga0207650_100580302 195
188 3300025925 Ga0207650_10265212 Ga0207650_102652122 195
189 3300025927 Ga0207687_10297019 Ga0207687_102970192 195
190 3300025931 Ga0207644_10169600 Ga0207644_101696002 195
191 3300025932 Ga0207690_10307355 Ga0207690_103073552 195
192 3300025934 Ga0207686_10518224 Ga0207686_105182241 195
193 3300025940 Ga0207691_10188755 Ga0207691_101887552 195
194 3300025942 Ga0207689_10003450 Ga0207689_1000345014 195
195 3300025949 Ga0207667_10001058 Ga0207667_100010586 195
196 3300025949 Ga0207667_10129137 Ga0207667_101291373 195
197 3300025960 Ga0207651_10265866 Ga0207651_102658662 195
198 3300025961 Ga0207712_10568200 Ga0207712_105682001 195
199 3300025972 Ga0207668_10563587 Ga0207668_105635872 195
200 3300025981 Ga0207640_10009598 Ga0207640_100095984 195
201 3300026035 Ga0207703_10000798 Ga0207703_100007988 195
202 3300026078 Ga0207702_10024287 Ga0207702_100242874 195
203 3300026088 Ga0207641_10000056 Ga0207641_10000056122 195
204 3300026095 Ga0207676_10035456 Ga0207676_100354563 195
205 3300026116 Ga0207674_10004281 Ga0207674_1000428110 195
206 3300026118 Ga0207675_100753117 Ga0207675_1007531171 195
207 3300026142 Ga0207698_10002611 Ga0207698_100026116 195
208 3300026142 Ga0207698_10043182 Ga0207698_100431823 195
209 3300028381 Ga0268264_10123165 Ga0268264_101231653 195
210 3300028381 Ga0268264_10384547 Ga0268264_103845472 195
211 3300028786 Ga0307517_10176074 Ga0307517_101760742 195
212 3300028794 Ga0307515_10000078 Ga0307515_1000007898 195
213 3300030521 Ga0307511_10000418 Ga0307511_1000041832 195
214 3300031507 Ga0307509_10153481 Ga0307509_101534813 195
215 3300033180 Ga0307510_10002127 Ga0307510_1000212716 195
216 3300039437 Ga0436365_1837098 Ga0436365_1837098_17755_18351 195
217 3300044658 Ga0466972_0000069 Ga0466972_0000069_67424_68014 195
218 3300044765 Ga0466970_0001235 Ga0466970_0001235_8295_8885 195
219 3300046616 Ga0495668_0446281 Ga0495668_0446281_29_649 195
220 3300046648 Ga0495611_0000037 Ga0495611_0000037_81923_82543 195
221 3300047472 Ga0495686_0000010 Ga0495686_0000010_422518_423105 195
222 3300053090 Ga0500646_0088981 Ga0500646_0088981_191_811 195
223 3300053092 Ga0500583_0189563 Ga0500583_0189563_282_896 195
224 3300053153 Ga0500616_0000445 Ga0500616_0000445_36613_37242 195
225 3300053178 Ga0500637_0316504 Ga0500637_0316504_213_806 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

46

212

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jb9-assembly1.cif.gz_d cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.8834 25 195
2fu0-assembly1.cif.gz_A plasmodium falciparum cyclophilin pfe0505w putative cyclosporin-binding domain 0.8776 26 192
5xjc-assembly1.cif.gz_S cryo-em structure of the human spliceosome just prior to exon ligation at 3.6 angstrom 0.8731 23 193
3jb9-assembly1.cif.gz_d cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.8726 25 195
3s6m-assembly1.cif.gz_A the structure of a peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei 0.8681 24 195
ID Description Score Start End Superfamily
1xyhA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8604 26 193 2.40.100.10
af_Q9XXI7_1_179_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8464 24 194 2.40.100.10
af_A0A0R4J2Z8_2_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8422 18 195 2.40.100.10
af_Q9FJX0_326_510_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8404 18 195 2.40.100.10
2mvzA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8357 24 195 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A4Q0AU89-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9712 18 195 GO:0140839
GO:0140840
AF-A0A3D4T8Y9-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9682 17 195 GO:0140839
GO:0140840
AF-A0A7C2NHI9-F1-model_v4 Peptidylprolyl isomerase 0.9575 63 187 GO:0005737
GO:0006457
GO:0016018
GO:0140839
GO:0140840
AF-A0A7Y2ZEH7-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.948 24 194 GO:0003755
AF-A0A1F5CS97-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9477 21 195 GO:0140839
GO:0140840

Feature Viewer

pLDDT pTM Quality
90.3 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map