F337704
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 225 | 148 | 224 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10272216|Ga0111539_102722162 |
| Length | 213 |
| Sequence | MDSIQTKVGKVGATCFSPKFVAMIRMLFLPLIIFFVCCSTTDKNTHVEIRTSIGSIEVELYPDKAPNSVAAFLSYVDSGFYENTSFYRVLTDQNQPSDAFKSNLIQGGLWRTGRRKNLTGIPHEPTNQTGIQHKNGVISLARLEPGTATTEFFICIGDQPGYDYGGENNPDKQGYAAFGRVVKGMDIVNRIYQLNESDQYFDPPVPIYNITRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 97 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 98 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 99 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 100 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 101 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 102 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 103 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 104 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 109 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 110 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 111 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 112 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 113 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 114 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 115 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 116 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 117 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 118 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 119 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 120 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 121 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 122 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 123 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 131 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 132 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 135 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 136 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 137 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 138 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 139 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 140 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 141 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 142 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 143 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 144 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 145 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 146 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 147 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 148 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0 |
| Isolates | 0.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.56 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 79.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10091706 | 3300003316 | Bacteria | 2788 |
| 2 | rootL2_10056000 | 3300003322 | Bacteria | 1945 |
| 3 | rootL2_10361385 | 3300003322 | Bacteria | 1942 |
| 4 | rootH1_10011869 | 3300003323 | Bacteria | 39408 |
| 5 | rootH1_10093894 | 3300003323 | Unclassified | 3113 |
| 6 | rootH1_10195167 | 3300003323 | Bacteria | 2318 |
| 7 | rootH1_10200213 | 3300003323 | Bacteria | 1725 |
| 8 | Ga0070658_10177171 | 3300005327 | Bacteria | 1793 |
| 9 | Ga0070670_100695525 | 3300005331 | Bacteria | 914 |
| 10 | Ga0070666_10000101 | 3300005335 | Bacteria | 58900 |
| 11 | Ga0068868_100346591 | 3300005338 | Bacteria | 1271 |
| 12 | Ga0070689_100121754 | 3300005340 | Bacteria | 2084 |
| 13 | Ga0070661_100123293 | 3300005344 | Bacteria | 1942 |
| 14 | Ga0070671_100349341 | 3300005355 | Bacteria | 1262 |
| 15 | Ga0070674_100060304 | 3300005356 | Bacteria | 2644 |
| 16 | Ga0070659_100268854 | 3300005366 | Bacteria | 1416 |
| 17 | Ga0070667_100122113 | 3300005367 | Bacteria | 2266 |
| 18 | Ga0068867_100552716 | 3300005459 | Bacteria | 997 |
| 19 | Ga0070684_101026180 | 3300005535 | Bacteria | 774 |
| 20 | Ga0070672_100650045 | 3300005543 | Bacteria | 921 |
| 21 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 22 | Ga0068855_100028799 | 3300005563 | Bacteria | 6645 |
| 23 | Ga0068855_100066611 | 3300005563 | Bacteria | 4199 |
| 24 | Ga0068855_100105097 | 3300005563 | Bacteria | 3247 |
| 25 | Ga0068857_100006960 | 3300005577 | Bacteria | 9734 |
| 26 | Ga0068857_100234873 | 3300005577 | Bacteria | 1677 |
| 27 | Ga0068854_100017672 | 3300005578 | Unclassified | 4776 |
| 28 | Ga0068856_100022494 | 3300005614 | Bacteria | 6130 |
| 29 | Ga0068852_100002505 | 3300005616 | Bacteria | 12646 |
| 30 | Ga0068852_100125840 | 3300005616 | Bacteria | 2353 |
| 31 | Ga0068852_101232647 | 3300005616 | Bacteria | 769 |
| 32 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 33 | Ga0068859_100951632 | 3300005617 | Bacteria | 942 |
| 34 | Ga0068864_100033096 | 3300005618 | Bacteria | 4394 |
| 35 | Ga0068861_100082686 | 3300005719 | Bacteria | 2517 |
| 36 | Ga0068863_100042265 | 3300005841 | Bacteria | 4331 |
| 37 | Ga0068858_100014543 | 3300005842 | Bacteria | 7415 |
| 38 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 39 | Ga0068860_100141794 | 3300005843 | Unclassified | 2310 |
| 40 | Ga0068862_100157335 | 3300005844 | Bacteria | 2026 |
| 41 | Ga0068862_100555474 | 3300005844 | Bacteria | 1097 |
| 42 | Ga0081455_10424504 | 3300005937 | Bacteria | 916 |
| 43 | Ga0075366_10155297 | 3300006195 | Bacteria | 1386 |
| 44 | Ga0097621_100015725 | 3300006237 | Bacteria | 5702 |
| 45 | Ga0097621_100068359 | 3300006237 | Bacteria | 2930 |
| 46 | Ga0097621_100519762 | 3300006237 | Bacteria | 1080 |
| 47 | Ga0068871_100041939 | 3300006358 | Bacteria | 3671 |
| 48 | Ga0068871_100449625 | 3300006358 | Bacteria | 1154 |
| 49 | Ga0068865_100577425 | 3300006881 | Bacteria | 947 |
| 50 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 51 | Ga0097620_100951705 | 3300006931 | Bacteria | 942 |
| 52 | Ga0105240_10020206 | 3300009093 | Bacteria | 8890 |
| 53 | Ga0105240_10110096 | 3300009093 | Bacteria | 3334 |
| 54 | Ga0105240_11157108 | 3300009093 | Unclassified | 821 |
| 55 | Ga0111539_10272216 | 3300009094 | Bacteria | 1971 |
| 56 | Ga0111539_10528227 | 3300009094 | Unclassified | 1375 |
| 57 | Ga0105245_10162185 | 3300009098 | Bacteria | 2122 |
| 58 | Ga0105247_10017643 | 3300009101 | Bacteria | 4281 |
| 59 | Ga0114129_10008068 | 3300009147 | Bacteria | 15001 |
| 60 | Ga0105243_10255724 | 3300009148 | Bacteria | 1566 |
| 61 | Ga0105241_10000622 | 3300009174 | Bacteria | 26623 |
| 62 | Ga0105241_10000649 | 3300009174 | Bacteria | 26087 |
| 63 | Ga0105241_10031204 | 3300009174 | Bacteria | 3989 |
| 64 | Ga0105241_10091242 | 3300009174 | Bacteria | 2403 |
| 65 | Ga0105242_11239621 | 3300009176 | Bacteria | 767 |
| 66 | Ga0105237_10000553 | 3300009545 | Bacteria | 52367 |
| 67 | Ga0105237_10001595 | 3300009545 | Bacteria | 29470 |
| 68 | Ga0105237_10013341 | 3300009545 | Bacteria | 8620 |
| 69 | Ga0105237_11421859 | 3300009545 | Bacteria | 700 |
| 70 | Ga0105238_10023246 | 3300009551 | Bacteria | 6318 |
| 71 | Ga0105238_10079136 | 3300009551 | Unclassified | 3277 |
| 72 | Ga0105249_10583411 | 3300009553 | Bacteria | 1171 |
| 73 | Ga0105249_11331627 | 3300009553 | Bacteria | 790 |
| 74 | Ga0105239_10000746 | 3300010375 | Bacteria | 46202 |
| 75 | Ga0105239_10089080 | 3300010375 | Bacteria | 3403 |
| 76 | Ga0105239_10101724 | 3300010375 | Unclassified | 3179 |
| 77 | Ga0105239_10166627 | 3300010375 | Bacteria | 2464 |
| 78 | Ga0105246_10050969 | 3300011119 | Bacteria | 2841 |
| 79 | Ga0105246_10182103 | 3300011119 | Bacteria | 1618 |
| 80 | Ga0157373_10262052 | 3300013100 | Unclassified | 1223 |
| 81 | Ga0157371_10002722 | 3300013102 | Bacteria | 16650 |
| 82 | Ga0157371_10039731 | 3300013102 | Bacteria | 3364 |
| 83 | Ga0157370_10015629 | 3300013104 | Bacteria | 7710 |
| 84 | Ga0157370_10042686 | 3300013104 | Bacteria | 4369 |
| 85 | Ga0157369_10110480 | 3300013105 | Bacteria | 2922 |
| 86 | Ga0157374_10217658 | 3300013296 | Unclassified | 1874 |
| 87 | Ga0157378_10019593 | 3300013297 | Bacteria | 5947 |
| 88 | Ga0157378_10983364 | 3300013297 | Bacteria | 877 |
| 89 | Ga0163162_10000712 | 3300013306 | Bacteria | 30828 |
| 90 | Ga0163162_10695427 | 3300013306 | Bacteria | 1139 |
| 91 | Ga0157372_10006426 | 3300013307 | Bacteria | 12511 |
| 92 | Ga0157372_10078561 | 3300013307 | Bacteria | 3729 |
| 93 | Ga0157372_10308178 | 3300013307 | Bacteria | 1843 |
| 94 | Ga0157372_10512377 | 3300013307 | Unclassified | 1399 |
| 95 | Ga0157375_10011496 | 3300013308 | Bacteria | 7820 |
| 96 | Ga0163163_10794861 | 3300014325 | Bacteria | 1009 |
| 97 | Ga0157376_10000780 | 3300014969 | Bacteria | 20811 |
| 98 | Ga0157376_10550496 | 3300014969 | Bacteria | 1142 |
| 99 | Ga0209646_1005857 | 3300025246 | Bacteria | 2110 |
| 100 | Ga0207656_10313695 | 3300025321 | Bacteria | 778 |
| 101 | Ga0207710_10013895 | 3300025900 | Bacteria | 3390 |
| 102 | Ga0207680_10000015 | 3300025903 | Bacteria | 138253 |
| 103 | Ga0207647_10007605 | 3300025904 | Bacteria | 7808 |
| 104 | Ga0207647_10025812 | 3300025904 | Bacteria | 3852 |
| 105 | Ga0207654_10003278 | 3300025911 | Bacteria | 8185 |
| 106 | Ga0207654_10052252 | 3300025911 | Bacteria | 2355 |
| 107 | Ga0207654_10347943 | 3300025911 | Bacteria | 1020 |
| 108 | Ga0207707_10426084 | 3300025912 | Unclassified | 1137 |
| 109 | Ga0207695_10003629 | 3300025913 | Bacteria | 21576 |
| 110 | Ga0207695_10483794 | 3300025913 | Unclassified | 1120 |
| 111 | Ga0207695_10774417 | 3300025913 | Bacteria | 840 |
| 112 | Ga0207671_10001648 | 3300025914 | Bacteria | 25416 |
| 113 | Ga0207671_10003155 | 3300025914 | Bacteria | 16685 |
| 114 | Ga0207671_10004517 | 3300025914 | Bacteria | 13236 |
| 115 | Ga0207671_10004537 | 3300025914 | Bacteria | 13192 |
| 116 | Ga0207671_10020007 | 3300025914 | Bacteria | 5106 |
| 117 | Ga0207671_10029591 | 3300025914 | Bacteria | 4089 |
| 118 | Ga0207649_10604362 | 3300025920 | Unclassified | 844 |
| 119 | Ga0207694_10007871 | 3300025924 | Bacteria | 8069 |
| 120 | Ga0207694_10031411 | 3300025924 | Bacteria | 4057 |
| 121 | Ga0207650_10058030 | 3300025925 | Bacteria | 2881 |
| 122 | Ga0207650_10265212 | 3300025925 | Bacteria | 1394 |
| 123 | Ga0207650_10939198 | 3300025925 | Bacteria | 735 |
| 124 | Ga0207687_10297019 | 3300025927 | Unclassified | 1300 |
| 125 | Ga0207644_10169600 | 3300025931 | Bacteria | 1703 |
| 126 | Ga0207690_10307355 | 3300025932 | Bacteria | 1243 |
| 127 | Ga0207686_10518224 | 3300025934 | Bacteria | 927 |
| 128 | Ga0207669_10522298 | 3300025937 | Bacteria | 953 |
| 129 | Ga0207691_10188755 | 3300025940 | Bacteria | 1798 |
| 130 | Ga0207689_10003450 | 3300025942 | Bacteria | 14436 |
| 131 | Ga0207667_10001058 | 3300025949 | Bacteria | 34902 |
| 132 | Ga0207667_10087937 | 3300025949 | Bacteria | 3214 |
| 133 | Ga0207667_10129137 | 3300025949 | Bacteria | 2603 |
| 134 | Ga0207651_10265866 | 3300025960 | Bacteria | 1410 |
| 135 | Ga0207712_10568200 | 3300025961 | Bacteria | 977 |
| 136 | Ga0207668_10563587 | 3300025972 | Bacteria | 988 |
| 137 | Ga0207640_10009598 | 3300025981 | Bacteria | 5425 |
| 138 | Ga0207703_10000798 | 3300026035 | Bacteria | 31051 |
| 139 | Ga0207639_10197016 | 3300026041 | Bacteria | 1725 |
| 140 | Ga0207702_10024287 | 3300026078 | Bacteria | 5029 |
| 141 | Ga0207702_10188488 | 3300026078 | Bacteria | 1904 |
| 142 | Ga0207641_10000056 | 3300026088 | Bacteria | 170719 |
| 143 | Ga0207676_10035456 | 3300026095 | Bacteria | 3786 |
| 144 | Ga0207674_10004281 | 3300026116 | Bacteria | 17213 |
| 145 | Ga0207675_100156943 | 3300026118 | Bacteria | 2168 |
| 146 | Ga0207675_100753117 | 3300026118 | Bacteria | 985 |
| 147 | Ga0207698_10002611 | 3300026142 | Bacteria | 10713 |
| 148 | Ga0207698_10043182 | 3300026142 | Bacteria | 3376 |
| 149 | Ga0268266_10000073 | 3300028379 | Bacteria | 232074 |
| 150 | Ga0268265_10305989 | 3300028380 | Bacteria | 1433 |
| 151 | Ga0268264_10000063 | 3300028381 | Bacteria | 301702 |
| 152 | Ga0268264_10123165 | 3300028381 | Unclassified | 2288 |
| 153 | Ga0268264_10384547 | 3300028381 | Bacteria | 1345 |
| 154 | Ga0307517_10176074 | 3300028786 | Bacteria | 1393 |
| 155 | Ga0307515_10000078 | 3300028794 | Bacteria | 227988 |
| 156 | Ga0307511_10000418 | 3300030521 | Bacteria | 45353 |
| 157 | Ga0307513_10056303 | 3300031456 | Bacteria | 4199 |
| 158 | Ga0307513_10701356 | 3300031456 | Bacteria | 718 |
| 159 | Ga0307509_10090724 | 3300031507 | Bacteria | 3130 |
| 160 | Ga0307509_10103560 | 3300031507 | Bacteria | 2874 |
| 161 | Ga0307509_10153481 | 3300031507 | Bacteria | 2213 |
| 162 | Ga0307508_10000763 | 3300031616 | Bacteria | 38032 |
| 163 | Ga0307510_10002127 | 3300033180 | Bacteria | 22383 |
| 164 | Ga0373927_0188447 | 3300035695 | Bacteria | 1353 |
| 165 | Ga0395899_0109412 | 3300037312 | Bacteria | 1988 |
| 166 | Ga0395900_0189264 | 3300037418 | Bacteria | 2088 |
| 167 | Ga0395905_0237681 | 3300037471 | Bacteria | 1703 |
| 168 | Ga0395901_0038229 | 3300038443 | Bacteria | 4964 |
| 169 | Ga0436365_1837098 | 3300039437 | Bacteria | 29699 |
| 170 | Ga0439436_0009333 | 3300041404 | Bacteria | 3007 |
| 171 | Ga0439439_0007913 | 3300041406 | Bacteria | 2499 |
| 172 | Ga0451841_0364258 | 3300041498 | Bacteria | 1381 |
| 173 | Ga0439457_004560 | 3300042014 | Bacteria | 3594 |
| 174 | Ga0439457_076904 | 3300042014 | Bacteria | 765 |
| 175 | Ga0439462_0003813 | 3300042015 | Bacteria | 3637 |
| 176 | Ga0466969_0000371 | 3300044656 | Bacteria | 24624 |
| 177 | Ga0466972_0000069 | 3300044658 | Bacteria | 100746 |
| 178 | Ga0466972_0000075 | 3300044658 | Bacteria | 94290 |
| 179 | Ga0466972_0012429 | 3300044658 | Bacteria | 4279 |
| 180 | Ga0466966_0000131 | 3300044684 | Bacteria | 48304 |
| 181 | Ga0466964_0196014 | 3300044706 | Bacteria | 967 |
| 182 | Ga0466971_0043056 | 3300044719 | Bacteria | 2029 |
| 183 | Ga0466968_0254426 | 3300044735 | Bacteria | 835 |
| 184 | Ga0466970_0001235 | 3300044765 | Bacteria | 12398 |
| 185 | Ga0466957_0001583 | 3300044842 | Bacteria | 11952 |
| 186 | Ga0466959_0000003 | 3300045049 | Bacteria | 285164 |
| 187 | Ga0495638_0032215 | 3300046460 | Bacteria | 3363 |
| 188 | Ga0495648_0004428 | 3300046524 | Bacteria | 12000 |
| 189 | Ga0495668_0000354 | 3300046616 | Bacteria | 60932 |
| 190 | Ga0495668_0446281 | 3300046616 | Bacteria | 712 |
| 191 | Ga0495611_0000037 | 3300046648 | Bacteria | 101602 |
| 192 | Ga0495611_0050364 | 3300046648 | Bacteria | 1876 |
| 193 | Ga0495625_0061030 | 3300046660 | Bacteria | 2669 |
| 194 | Ga0495687_000040 | 3300047443 | Bacteria | 230786 |
| 195 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 196 | Ga0501225_0003596 | 3300049705 | Bacteria | 4672 |
| 197 | nmdc:mga0k408_326670_c1 | 3300050493 | Bacteria | 915 |
| 198 | nmdc:mga05p37_10194_c2 | 3300050507 | Bacteria | 9428 |
| 199 | nmdc:mga08y16_134062_c1 | 3300050511 | Bacteria | 2574 |
| 200 | nmdc:mga08y16_579890_c1 | 3300050511 | Unclassified | 1132 |
| 201 | Ga0500578_0000091 | 3300053086 | Bacteria | 102427 |
| 202 | Ga0500578_0047180 | 3300053086 | Bacteria | 2764 |
| 203 | Ga0500646_0032581 | 3300053090 | Unclassified | 1439 |
| 204 | Ga0500646_0088981 | 3300053090 | Bacteria | 953 |
| 205 | Ga0500646_0228814 | 3300053090 | Unclassified | 647 |
| 206 | Ga0500583_0000011 | 3300053092 | Bacteria | 160380 |
| 207 | Ga0500583_0000236 | 3300053092 | Bacteria | 19755 |
| 208 | Ga0500583_0189563 | 3300053092 | Bacteria | 1023 |
| 209 | Ga0500642_0028130 | 3300053130 | Bacteria | 2315 |
| 210 | Ga0500658_0278215 | 3300053134 | Bacteria | 769 |
| 211 | Ga0500559_0034514 | 3300053136 | Bacteria | 2182 |
| 212 | Ga0500573_0319397 | 3300053140 | Bacteria | 768 |
| 213 | Ga0500589_046126 | 3300053147 | Bacteria | 2030 |
| 214 | Ga0500604_0001758 | 3300053151 | Bacteria | 6061 |
| 215 | Ga0500616_0000445 | 3300053153 | Bacteria | 54193 |
| 216 | Ga0500619_079057 | 3300053154 | Bacteria | 1103 |
| 217 | Ga0500622_0001414 | 3300053156 | Bacteria | 19338 |
| 218 | Ga0500622_0009918 | 3300053156 | Bacteria | 5255 |
| 219 | Ga0500622_0038868 | 3300053156 | Bacteria | 2482 |
| 220 | Ga0500622_0098188 | 3300053156 | Bacteria | 1446 |
| 221 | Ga0500636_0099613 | 3300053177 | Bacteria | 1654 |
| 222 | Ga0500637_0316504 | 3300053178 | Bacteria | 845 |
| 223 | Ga0500645_002604 | 3300053730 | Bacteria | 7923 |
| 224 | Ga0500645_034826 | 3300053730 | Bacteria | 1503 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013102 | Ga0157371_10039731 | Ga0157371_100397312 | 181 |
| 2 | 3300013104 | Ga0157370_10042686 | Ga0157370_100426861 | 181 |
| 3 | 3300013307 | Ga0157372_10078561 | Ga0157372_100785612 | 181 |
| 4 | 3300037312 | Ga0395899_0109412 | Ga0395899_0109412_368_919 | 181 |
| 5 | 3300037418 | Ga0395900_0189264 | Ga0395900_0189264_1360_1911 | 181 |
| 6 | 3300037471 | Ga0395905_0237681 | Ga0395905_0237681_489_1040 | 181 |
| 7 | 3300038443 | Ga0395901_0038229 | Ga0395901_0038229_680_1231 | 181 |
| 8 | 3300053090 | Ga0500646_0032581 | Ga0500646_0032581_311_856 | 181 |
| 9 | 3300005331 | Ga0070670_100695525 | Ga0070670_1006955251 | 185 |
| 10 | 3300025925 | Ga0207650_10939198 | Ga0207650_109391981 | 185 |
| 11 | 3300005356 | Ga0070674_100060304 | Ga0070674_1000603042 | 188 |
| 12 | 3300009094 | Ga0111539_10272216 | Ga0111539_102722162 | 188 |
| 13 | 3300025937 | Ga0207669_10522298 | Ga0207669_105222981 | 188 |
| 14 | 3300050511 | nmdc:mga08y16_134062_c1 | nmdc:mga08y16_134062_c1_1422_2063 | 188 |
| 15 | iso_pu_bacteria | 2818991444 | 2819585585 | 190 |
| 16 | 3300005459 | Ga0068867_100552716 | Ga0068867_1005527161 | 191 |
| 17 | 3300025912 | Ga0207707_10426084 | Ga0207707_104260842 | 191 |
| 18 | 3300053136 | Ga0500559_0034514 | Ga0500559_0034514_478_1053 | 191 |
| 19 | 3300005844 | Ga0068862_100157335 | Ga0068862_1001573352 | 192 |
| 20 | 3300005937 | Ga0081455_10424504 | Ga0081455_104245041 | 192 |
| 21 | 3300009094 | Ga0111539_10528227 | Ga0111539_105282272 | 192 |
| 22 | 3300014969 | Ga0157376_10550496 | Ga0157376_105504961 | 192 |
| 23 | 3300028380 | Ga0268265_10305989 | Ga0268265_103059892 | 192 |
| 24 | 3300046460 | Ga0495638_0032215 | Ga0495638_0032215_1391_1969 | 192 |
| 25 | 3300046616 | Ga0495668_0000354 | Ga0495668_0000354_26357_26935 | 192 |
| 26 | 3300046648 | Ga0495611_0050364 | Ga0495611_0050364_522_1100 | 192 |
| 27 | 3300050511 | nmdc:mga08y16_579890_c1 | nmdc:mga08y16_579890_c1_272_850 | 192 |
| 28 | 3300053090 | Ga0500646_0228814 | Ga0500646_0228814_12_590 | 192 |
| 29 | 3300053130 | Ga0500642_0028130 | Ga0500642_0028130_1222_1800 | 192 |
| 30 | 3300053151 | Ga0500604_0001758 | Ga0500604_0001758_152_730 | 192 |
| 31 | 3300053156 | Ga0500622_0038868 | Ga0500622_0038868_1142_1720 | 192 |
| 32 | 3300053730 | Ga0500645_002604 | Ga0500645_002604_2431_3009 | 192 |
| 33 | 3300053730 | Ga0500645_034826 | Ga0500645_034826_434_1027 | 192 |
| 34 | 3300003323 | rootH1_10093894 | rootH1_100938943 | 193 |
| 35 | 3300005563 | Ga0068855_100066611 | Ga0068855_1000666114 | 193 |
| 36 | 3300005577 | Ga0068857_100234873 | Ga0068857_1002348733 | 193 |
| 37 | 3300009147 | Ga0114129_10008068 | Ga0114129_100080685 | 193 |
| 38 | 3300009174 | Ga0105241_10031204 | Ga0105241_100312044 | 193 |
| 39 | 3300010375 | Ga0105239_10000746 | Ga0105239_1000074636 | 193 |
| 40 | 3300010375 | Ga0105239_10166627 | Ga0105239_101666273 | 193 |
| 41 | 3300013307 | Ga0157372_10308178 | Ga0157372_103081781 | 193 |
| 42 | 3300025914 | Ga0207671_10029591 | Ga0207671_100295913 | 193 |
| 43 | 3300025949 | Ga0207667_10087937 | Ga0207667_100879374 | 193 |
| 44 | 3300026078 | Ga0207702_10188488 | Ga0207702_101884882 | 193 |
| 45 | 3300031507 | Ga0307509_10090724 | Ga0307509_100907242 | 193 |
| 46 | 3300031507 | Ga0307509_10103560 | Ga0307509_101035602 | 193 |
| 47 | 3300044656 | Ga0466969_0000371 | Ga0466969_0000371_12492_13076 | 193 |
| 48 | 3300044684 | Ga0466966_0000131 | Ga0466966_0000131_19266_19850 | 193 |
| 49 | 3300044706 | Ga0466964_0196014 | Ga0466964_0196014_50_634 | 193 |
| 50 | 3300044719 | Ga0466971_0043056 | Ga0466971_0043056_340_924 | 193 |
| 51 | 3300044735 | Ga0466968_0254426 | Ga0466968_0254426_46_630 | 193 |
| 52 | 3300044842 | Ga0466957_0001583 | Ga0466957_0001583_744_1328 | 193 |
| 53 | 3300045049 | Ga0466959_0000003 | Ga0466959_0000003_34703_35287 | 193 |
| 54 | 3300049705 | Ga0501225_0003596 | Ga0501225_0003596_2661_3245 | 193 |
| 55 | 3300050507 | nmdc:mga05p37_10194_c2 | nmdc:mga05p37_10194_c2_7986_8570 | 193 |
| 56 | 3300003322 | rootL2_10056000 | rootL2_100560002 | 194 |
| 57 | 3300003322 | rootL2_10361385 | rootL2_103613852 | 194 |
| 58 | 3300003323 | rootH1_10011869 | rootH1_1001186923 | 194 |
| 59 | 3300003323 | rootH1_10195167 | rootH1_101951672 | 194 |
| 60 | 3300003323 | rootH1_10200213 | rootH1_102002132 | 194 |
| 61 | 3300005548 | Ga0070665_100000002 | Ga0070665_100000002541 | 194 |
| 62 | 3300005719 | Ga0068861_100082686 | Ga0068861_1000826862 | 194 |
| 63 | 3300005843 | Ga0068860_100000003 | Ga0068860_100000003158 | 194 |
| 64 | 3300006195 | Ga0075366_10155297 | Ga0075366_101552973 | 194 |
| 65 | 3300009174 | Ga0105241_10000649 | Ga0105241_1000064925 | 194 |
| 66 | 3300009545 | Ga0105237_10013341 | Ga0105237_100133417 | 194 |
| 67 | 3300013297 | Ga0157378_10983364 | Ga0157378_109833641 | 194 |
| 68 | 3300013306 | Ga0163162_10000712 | Ga0163162_1000071230 | 194 |
| 69 | 3300025246 | Ga0209646_1005857 | Ga0209646_10058574 | 194 |
| 70 | 3300025911 | Ga0207654_10052252 | Ga0207654_100522521 | 194 |
| 71 | 3300025913 | Ga0207695_10003629 | Ga0207695_1000362910 | 194 |
| 72 | 3300025914 | Ga0207671_10004537 | Ga0207671_1000453713 | 194 |
| 73 | 3300025924 | Ga0207694_10007871 | Ga0207694_100078717 | 194 |
| 74 | 3300026041 | Ga0207639_10197016 | Ga0207639_101970162 | 194 |
| 75 | 3300026118 | Ga0207675_100156943 | Ga0207675_1001569432 | 194 |
| 76 | 3300028379 | Ga0268266_10000073 | Ga0268266_10000073107 | 194 |
| 77 | 3300028381 | Ga0268264_10000063 | Ga0268264_1000006376 | 194 |
| 78 | 3300031456 | Ga0307513_10056303 | Ga0307513_100563031 | 194 |
| 79 | 3300031456 | Ga0307513_10701356 | Ga0307513_107013561 | 194 |
| 80 | 3300031616 | Ga0307508_10000763 | Ga0307508_1000076326 | 194 |
| 81 | 3300035695 | Ga0373927_0188447 | Ga0373927_0188447_342_929 | 194 |
| 82 | 3300041404 | Ga0439436_0009333 | Ga0439436_0009333_483_1070 | 194 |
| 83 | 3300041406 | Ga0439439_0007913 | Ga0439439_0007913_485_1072 | 194 |
| 84 | 3300041498 | Ga0451841_0364258 | Ga0451841_0364258_271_858 | 194 |
| 85 | 3300042014 | Ga0439457_004560 | Ga0439457_004560_2121_2708 | 194 |
| 86 | 3300042014 | Ga0439457_076904 | Ga0439457_076904_109_696 | 194 |
| 87 | 3300042015 | Ga0439462_0003813 | Ga0439462_0003813_39_626 | 194 |
| 88 | 3300044658 | Ga0466972_0000075 | Ga0466972_0000075_47432_48019 | 194 |
| 89 | 3300044658 | Ga0466972_0012429 | Ga0466972_0012429_3592_4179 | 194 |
| 90 | 3300046524 | Ga0495648_0004428 | Ga0495648_0004428_11182_11892 | 194 |
| 91 | 3300046660 | Ga0495625_0061030 | Ga0495625_0061030_1897_2607 | 194 |
| 92 | 3300047443 | Ga0495687_000040 | Ga0495687_000040_96079_96702 | 194 |
| 93 | 3300050493 | nmdc:mga0k408_326670_c1 | nmdc:mga0k408_326670_c1_238_825 | 194 |
| 94 | 3300053086 | Ga0500578_0000091 | Ga0500578_0000091_85331_85918 | 194 |
| 95 | 3300053086 | Ga0500578_0047180 | Ga0500578_0047180_1931_2518 | 194 |
| 96 | 3300053092 | Ga0500583_0000011 | Ga0500583_0000011_94567_95154 | 194 |
| 97 | 3300053092 | Ga0500583_0000236 | Ga0500583_0000236_7831_8418 | 194 |
| 98 | 3300053134 | Ga0500658_0278215 | Ga0500658_0278215_47_634 | 194 |
| 99 | 3300053140 | Ga0500573_0319397 | Ga0500573_0319397_20_607 | 194 |
| 100 | 3300053147 | Ga0500589_046126 | Ga0500589_046126_578_1165 | 194 |
| 101 | 3300053154 | Ga0500619_079057 | Ga0500619_079057_304_891 | 194 |
| 102 | 3300053156 | Ga0500622_0001414 | Ga0500622_0001414_10714_11298 | 194 |
| 103 | 3300053156 | Ga0500622_0009918 | Ga0500622_0009918_2226_2813 | 194 |
| 104 | 3300053156 | Ga0500622_0098188 | Ga0500622_0098188_410_997 | 194 |
| 105 | 3300053177 | Ga0500636_0099613 | Ga0500636_0099613_455_1042 | 194 |
| 106 | 3300003316 | rootH1_10091706 | rootH1_100917064 | 195 |
| 107 | 3300005327 | Ga0070658_10177171 | Ga0070658_101771712 | 195 |
| 108 | 3300005335 | Ga0070666_10000101 | Ga0070666_1000010133 | 195 |
| 109 | 3300005338 | Ga0068868_100346591 | Ga0068868_1003465912 | 195 |
| 110 | 3300005340 | Ga0070689_100121754 | Ga0070689_1001217542 | 195 |
| 111 | 3300005344 | Ga0070661_100123293 | Ga0070661_1001232932 | 195 |
| 112 | 3300005355 | Ga0070671_100349341 | Ga0070671_1003493412 | 195 |
| 113 | 3300005366 | Ga0070659_100268854 | Ga0070659_1002688542 | 195 |
| 114 | 3300005367 | Ga0070667_100122113 | Ga0070667_1001221132 | 195 |
| 115 | 3300005535 | Ga0070684_101026180 | Ga0070684_1010261801 | 195 |
| 116 | 3300005543 | Ga0070672_100650045 | Ga0070672_1006500451 | 195 |
| 117 | 3300005563 | Ga0068855_100028799 | Ga0068855_1000287996 | 195 |
| 118 | 3300005563 | Ga0068855_100105097 | Ga0068855_1001050973 | 195 |
| 119 | 3300005577 | Ga0068857_100006960 | Ga0068857_1000069604 | 195 |
| 120 | 3300005578 | Ga0068854_100017672 | Ga0068854_1000176724 | 195 |
| 121 | 3300005614 | Ga0068856_100022494 | Ga0068856_1000224944 | 195 |
| 122 | 3300005616 | Ga0068852_100002505 | Ga0068852_1000025056 | 195 |
| 123 | 3300005616 | Ga0068852_100125840 | Ga0068852_1001258402 | 195 |
| 124 | 3300005616 | Ga0068852_101232647 | Ga0068852_1012326471 | 195 |
| 125 | 3300005617 | Ga0068859_100000007 | Ga0068859_100000007130 | 195 |
| 126 | 3300005617 | Ga0068859_100951632 | Ga0068859_1009516321 | 195 |
| 127 | 3300005618 | Ga0068864_100033096 | Ga0068864_1000330962 | 195 |
| 128 | 3300005841 | Ga0068863_100042265 | Ga0068863_1000422653 | 195 |
| 129 | 3300005842 | Ga0068858_100014543 | Ga0068858_1000145433 | 195 |
| 130 | 3300005843 | Ga0068860_100141794 | Ga0068860_1001417943 | 195 |
| 131 | 3300005844 | Ga0068862_100555474 | Ga0068862_1005554742 | 195 |
| 132 | 3300006237 | Ga0097621_100015725 | Ga0097621_1000157253 | 195 |
| 133 | 3300006237 | Ga0097621_100068359 | Ga0097621_1000683593 | 195 |
| 134 | 3300006237 | Ga0097621_100519762 | Ga0097621_1005197621 | 195 |
| 135 | 3300006358 | Ga0068871_100041939 | Ga0068871_1000419392 | 195 |
| 136 | 3300006358 | Ga0068871_100449625 | Ga0068871_1004496252 | 195 |
| 137 | 3300006881 | Ga0068865_100577425 | Ga0068865_1005774252 | 195 |
| 138 | 3300006931 | Ga0097620_100000007 | Ga0097620_100000007131 | 195 |
| 139 | 3300006931 | Ga0097620_100951705 | Ga0097620_1009517051 | 195 |
| 140 | 3300009093 | Ga0105240_10020206 | Ga0105240_100202066 | 195 |
| 141 | 3300009093 | Ga0105240_10110096 | Ga0105240_101100964 | 195 |
| 142 | 3300009093 | Ga0105240_11157108 | Ga0105240_111571081 | 195 |
| 143 | 3300009098 | Ga0105245_10162185 | Ga0105245_101621852 | 195 |
| 144 | 3300009101 | Ga0105247_10017643 | Ga0105247_100176433 | 195 |
| 145 | 3300009148 | Ga0105243_10255724 | Ga0105243_102557242 | 195 |
| 146 | 3300009174 | Ga0105241_10000622 | Ga0105241_100006229 | 195 |
| 147 | 3300009174 | Ga0105241_10091242 | Ga0105241_100912422 | 195 |
| 148 | 3300009176 | Ga0105242_11239621 | Ga0105242_112396211 | 195 |
| 149 | 3300009545 | Ga0105237_10000553 | Ga0105237_1000055343 | 195 |
| 150 | 3300009545 | Ga0105237_10001595 | Ga0105237_100015955 | 195 |
| 151 | 3300009545 | Ga0105237_11421859 | Ga0105237_114218591 | 195 |
| 152 | 3300009551 | Ga0105238_10023246 | Ga0105238_100232466 | 195 |
| 153 | 3300009551 | Ga0105238_10079136 | Ga0105238_100791362 | 195 |
| 154 | 3300009553 | Ga0105249_10583411 | Ga0105249_105834111 | 195 |
| 155 | 3300009553 | Ga0105249_11331627 | Ga0105249_113316271 | 195 |
| 156 | 3300010375 | Ga0105239_10089080 | Ga0105239_100890805 | 195 |
| 157 | 3300010375 | Ga0105239_10101724 | Ga0105239_101017243 | 195 |
| 158 | 3300011119 | Ga0105246_10050969 | Ga0105246_100509692 | 195 |
| 159 | 3300011119 | Ga0105246_10182103 | Ga0105246_101821031 | 195 |
| 160 | 3300013100 | Ga0157373_10262052 | Ga0157373_102620521 | 195 |
| 161 | 3300013102 | Ga0157371_10002722 | Ga0157371_100027224 | 195 |
| 162 | 3300013104 | Ga0157370_10015629 | Ga0157370_100156296 | 195 |
| 163 | 3300013105 | Ga0157369_10110480 | Ga0157369_101104803 | 195 |
| 164 | 3300013296 | Ga0157374_10217658 | Ga0157374_102176582 | 195 |
| 165 | 3300013297 | Ga0157378_10019593 | Ga0157378_100195933 | 195 |
| 166 | 3300013306 | Ga0163162_10695427 | Ga0163162_106954271 | 195 |
| 167 | 3300013307 | Ga0157372_10006426 | Ga0157372_100064268 | 195 |
| 168 | 3300013307 | Ga0157372_10512377 | Ga0157372_105123772 | 195 |
| 169 | 3300013308 | Ga0157375_10011496 | Ga0157375_100114963 | 195 |
| 170 | 3300014325 | Ga0163163_10794861 | Ga0163163_107948612 | 195 |
| 171 | 3300014969 | Ga0157376_10000780 | Ga0157376_100007807 | 195 |
| 172 | 3300025321 | Ga0207656_10313695 | Ga0207656_103136951 | 195 |
| 173 | 3300025900 | Ga0207710_10013895 | Ga0207710_100138953 | 195 |
| 174 | 3300025903 | Ga0207680_10000015 | Ga0207680_10000015123 | 195 |
| 175 | 3300025904 | Ga0207647_10007605 | Ga0207647_100076054 | 195 |
| 176 | 3300025904 | Ga0207647_10025812 | Ga0207647_100258123 | 195 |
| 177 | 3300025911 | Ga0207654_10003278 | Ga0207654_100032782 | 195 |
| 178 | 3300025911 | Ga0207654_10347943 | Ga0207654_103479432 | 195 |
| 179 | 3300025913 | Ga0207695_10483794 | Ga0207695_104837942 | 195 |
| 180 | 3300025913 | Ga0207695_10774417 | Ga0207695_107744172 | 195 |
| 181 | 3300025914 | Ga0207671_10001648 | Ga0207671_100016488 | 195 |
| 182 | 3300025914 | Ga0207671_10003155 | Ga0207671_100031552 | 195 |
| 183 | 3300025914 | Ga0207671_10004517 | Ga0207671_1000451713 | 195 |
| 184 | 3300025914 | Ga0207671_10020007 | Ga0207671_100200073 | 195 |
| 185 | 3300025920 | Ga0207649_10604362 | Ga0207649_106043621 | 195 |
| 186 | 3300025924 | Ga0207694_10031411 | Ga0207694_100314113 | 195 |
| 187 | 3300025925 | Ga0207650_10058030 | Ga0207650_100580302 | 195 |
| 188 | 3300025925 | Ga0207650_10265212 | Ga0207650_102652122 | 195 |
| 189 | 3300025927 | Ga0207687_10297019 | Ga0207687_102970192 | 195 |
| 190 | 3300025931 | Ga0207644_10169600 | Ga0207644_101696002 | 195 |
| 191 | 3300025932 | Ga0207690_10307355 | Ga0207690_103073552 | 195 |
| 192 | 3300025934 | Ga0207686_10518224 | Ga0207686_105182241 | 195 |
| 193 | 3300025940 | Ga0207691_10188755 | Ga0207691_101887552 | 195 |
| 194 | 3300025942 | Ga0207689_10003450 | Ga0207689_1000345014 | 195 |
| 195 | 3300025949 | Ga0207667_10001058 | Ga0207667_100010586 | 195 |
| 196 | 3300025949 | Ga0207667_10129137 | Ga0207667_101291373 | 195 |
| 197 | 3300025960 | Ga0207651_10265866 | Ga0207651_102658662 | 195 |
| 198 | 3300025961 | Ga0207712_10568200 | Ga0207712_105682001 | 195 |
| 199 | 3300025972 | Ga0207668_10563587 | Ga0207668_105635872 | 195 |
| 200 | 3300025981 | Ga0207640_10009598 | Ga0207640_100095984 | 195 |
| 201 | 3300026035 | Ga0207703_10000798 | Ga0207703_100007988 | 195 |
| 202 | 3300026078 | Ga0207702_10024287 | Ga0207702_100242874 | 195 |
| 203 | 3300026088 | Ga0207641_10000056 | Ga0207641_10000056122 | 195 |
| 204 | 3300026095 | Ga0207676_10035456 | Ga0207676_100354563 | 195 |
| 205 | 3300026116 | Ga0207674_10004281 | Ga0207674_1000428110 | 195 |
| 206 | 3300026118 | Ga0207675_100753117 | Ga0207675_1007531171 | 195 |
| 207 | 3300026142 | Ga0207698_10002611 | Ga0207698_100026116 | 195 |
| 208 | 3300026142 | Ga0207698_10043182 | Ga0207698_100431823 | 195 |
| 209 | 3300028381 | Ga0268264_10123165 | Ga0268264_101231653 | 195 |
| 210 | 3300028381 | Ga0268264_10384547 | Ga0268264_103845472 | 195 |
| 211 | 3300028786 | Ga0307517_10176074 | Ga0307517_101760742 | 195 |
| 212 | 3300028794 | Ga0307515_10000078 | Ga0307515_1000007898 | 195 |
| 213 | 3300030521 | Ga0307511_10000418 | Ga0307511_1000041832 | 195 |
| 214 | 3300031507 | Ga0307509_10153481 | Ga0307509_101534813 | 195 |
| 215 | 3300033180 | Ga0307510_10002127 | Ga0307510_1000212716 | 195 |
| 216 | 3300039437 | Ga0436365_1837098 | Ga0436365_1837098_17755_18351 | 195 |
| 217 | 3300044658 | Ga0466972_0000069 | Ga0466972_0000069_67424_68014 | 195 |
| 218 | 3300044765 | Ga0466970_0001235 | Ga0466970_0001235_8295_8885 | 195 |
| 219 | 3300046616 | Ga0495668_0446281 | Ga0495668_0446281_29_649 | 195 |
| 220 | 3300046648 | Ga0495611_0000037 | Ga0495611_0000037_81923_82543 | 195 |
| 221 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_422518_423105 | 195 |
| 222 | 3300053090 | Ga0500646_0088981 | Ga0500646_0088981_191_811 | 195 |
| 223 | 3300053092 | Ga0500583_0189563 | Ga0500583_0189563_282_896 | 195 |
| 224 | 3300053153 | Ga0500616_0000445 | Ga0500616_0000445_36613_37242 | 195 |
| 225 | 3300053178 | Ga0500637_0316504 | Ga0500637_0316504_213_806 | 195 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jb9-assembly1.cif.gz_d | cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution | 0.8834 | 25 | 195 |
| 2fu0-assembly1.cif.gz_A | plasmodium falciparum cyclophilin pfe0505w putative cyclosporin-binding domain | 0.8776 | 26 | 192 |
| 5xjc-assembly1.cif.gz_S | cryo-em structure of the human spliceosome just prior to exon ligation at 3.6 angstrom | 0.8731 | 23 | 193 |
| 3jb9-assembly1.cif.gz_d | cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution | 0.8726 | 25 | 195 |
| 3s6m-assembly1.cif.gz_A | the structure of a peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei | 0.8681 | 24 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xyhA00 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.8604 | 26 | 193 | 2.40.100.10 |
| af_Q9XXI7_1_179_2.40.100.10 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.8464 | 24 | 194 | 2.40.100.10 |
| af_A0A0R4J2Z8_2_164_2.40.100.10 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.8422 | 18 | 195 | 2.40.100.10 |
| af_Q9FJX0_326_510_2.40.100.10 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.8404 | 18 | 195 | 2.40.100.10 |
| 2mvzA00 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.8357 | 24 | 195 | 2.40.100.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q0AU89-F1-model_v4 | Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) | 0.9712 | 18 | 195 |
GO:0140839
GO:0140840 |
| AF-A0A3D4T8Y9-F1-model_v4 | peptidylprolyl isomerase (EC 5.2.1.8) | 0.9682 | 17 | 195 |
GO:0140839
GO:0140840 |
| AF-A0A7C2NHI9-F1-model_v4 | Peptidylprolyl isomerase | 0.9575 | 63 | 187 |
GO:0005737
GO:0006457 GO:0016018 GO:0140839 GO:0140840 |
| AF-A0A7Y2ZEH7-F1-model_v4 | peptidylprolyl isomerase (EC 5.2.1.8) | 0.948 | 24 | 194 |
GO:0003755
|
| AF-A0A1F5CS97-F1-model_v4 | peptidylprolyl isomerase (EC 5.2.1.8) | 0.9477 | 21 | 195 |
GO:0140839
GO:0140840 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar