F337671

General Info

Members Datasets Scaffolds Average Seq Length
225 132 450 277

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100036046|Ga0075434_1000360467
Length 286
Sequence MSEGPLEVETALPHHILVVANETVVSRSLVELIQERAAQGDVVVTVLAPVNQPRQGYVVYYDTRRAAARRRLDKTLDLLHEAGVHANGVVVETDPVSALRDAIDQLQPDEVIVSTHTQQKSGWLRRNAVDQMRRVAGNLPFQHVVVDLAAEHGETNVLVVANQTVLGTPLLDKIRERAAKSPAAFLIISPQGDAEGSYEEAERRLLRAVTLLRSEGIEAHGQISHPDPYSAVMQTLEDERVDELIVSTFPDARSGWLRRNLLERLRDDTKLPLEHVEVDVPAGAVA

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 11.11
Rhizosphere 87.56
Stem 0
Stem Tuber 0
Unclassified 10.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100036046 3300006871 Bacteria 4891
2 rootH1_10189230 3300003323 Archaea 1077
3 Ga0070658_10001923 3300005327 Bacteria 17483
4 Ga0070658_10009312 3300005327 Bacteria 7897
5 Ga0070658_10098703 3300005327 Bacteria 2413
6 Ga0070683_100003875 3300005329 Bacteria 12235
7 Ga0070680_100220337 3300005336 Bacteria 1602
8 Ga0070680_100397816 3300005336 Unclassified 1174
9 Ga0070682_100012139 3300005337 Bacteria 4931
10 Ga0070682_100174851 3300005337 Bacteria 1495
11 Ga0070660_100014142 3300005339 Bacteria 5745
12 Ga0070660_100018143 3300005339 Bacteria 5136
13 Ga0070660_100314901 3300005339 Unclassified 1284
14 Ga0070660_100358757 3300005339 Bacteria 1201
15 Ga0070661_100098331 3300005344 Bacteria 2174
16 Ga0070661_100101685 3300005344 Bacteria 2138
17 Ga0070661_100143781 3300005344 Bacteria 1799
18 Ga0070674_100137306 3300005356 Bacteria 1831
19 Ga0070673_100362325 3300005364 Bacteria 1289
20 Ga0070709_10165610 3300005434 Bacteria 1540
21 Ga0070714_100002694 3300005435 Bacteria 13092
22 Ga0070714_100026064 3300005435 Bacteria 4829
23 Ga0070714_100053814 3300005435 Bacteria 3437
24 Ga0070714_100079429 3300005435 Bacteria 2853
25 Ga0070714_100170856 3300005435 Bacteria 1973
26 Ga0070714_100250832 3300005435 Bacteria 1636
27 Ga0070681_10064288 3300005458 Bacteria 3640
28 Ga0070681_10112465 3300005458 Bacteria 2662
29 Ga0070681_10216014 3300005458 Bacteria 1833
30 Ga0070681_10537331 3300005458 Bacteria 1082
31 Ga0070706_100123592 3300005467 Bacteria 2413
32 Ga0070707_100192445 3300005468 Bacteria 1989
33 Ga0070698_100054564 3300005471 Bacteria 4056
34 Ga0070698_100095006 3300005471 Bacteria 2959
35 Ga0070698_100104128 3300005471 Bacteria 2808
36 Ga0070698_100313502 3300005471 Bacteria 1499
37 Ga0070679_100233054 3300005530 Bacteria 1800
38 Ga0070679_100245746 3300005530 Bacteria 1746
39 Ga0070679_100256100 3300005530 Bacteria 1705
40 Ga0070679_100302153 3300005530 Unclassified 1551
41 Ga0070679_100392063 3300005530 Bacteria 1335
42 Ga0070679_100601849 3300005530 Unclassified 1042
43 Ga0070686_100438313 3300005544 Bacteria 1002
44 Ga0070695_100445564 3300005545 Bacteria 991
45 Ga0068855_100208575 3300005563 Bacteria 2197
46 Ga0068854_100376367 3300005578 Bacteria 1169
47 Ga0068856_100514571 3300005614 Bacteria 1218
48 Ga0068852_100038086 3300005616 Bacteria 4038
49 Ga0070717_10139346 3300006028 Bacteria 2091
50 Ga0075365_10114489 3300006038 Bacteria 1856
51 Ga0070712_100032500 3300006175 Bacteria 3525
52 Ga0075436_100124047 3300006914 Bacteria 1809
53 Ga0105240_10019802 3300009093 Bacteria 8987
54 Ga0105240_10144946 3300009093 Bacteria 2835
55 Ga0105240_10171837 3300009093 Bacteria 2566
56 Ga0105237_10688859 3300009545 Unclassified 1029
57 Ga0105249_10180519 3300009553 Bacteria 2053
58 Ga0105239_10446388 3300010375 Bacteria 1467
59 Ga0157370_10011840 3300013104 Bacteria 9099
60 Ga0157370_10281625 3300013104 Bacteria 1536
61 Ga0157369_10024176 3300013105 Bacteria 6762
62 Ga0157369_10047050 3300013105 Bacteria 4686
63 Ga0182008_10051097 3300014497 Bacteria 2051
64 Ga0182008_10061633 3300014497 Bacteria 1849
65 Ga0197907_11164713 3300020069 Bacteria 3466
66 Ga0206356_10660088 3300020070 Bacteria 2942
67 Ga0206356_11265938 3300020070 Unclassified 1383
68 Ga0206356_11547155 3300020070 Bacteria 1876
69 Ga0206354_11476729 3300020081 Bacteria 1169
70 Ga0206353_10084500 3300020082 Bacteria 1438
71 Ga0206353_10100643 3300020082 Bacteria 1478
72 Ga0206353_12030858 3300020082 Bacteria 1503
73 Ga0224712_10015343 3300022467 Bacteria 2491
74 Ga0207699_10084465 3300025906 Bacteria 1977
75 Ga0207699_10125996 3300025906 Bacteria 1663
76 Ga0207705_10020415 3300025909 Bacteria 4734
77 Ga0207705_10149880 3300025909 Bacteria 1747
78 Ga0207705_10202833 3300025909 Bacteria 1503
79 Ga0207707_10008036 3300025912 Bacteria 9163
80 Ga0207707_10146531 3300025912 Bacteria 2064
81 Ga0207707_10155054 3300025912 Bacteria 2003
82 Ga0207693_10083222 3300025915 Bacteria 2506
83 Ga0207663_10046061 3300025916 Bacteria 2685
84 Ga0207660_10063661 3300025917 Bacteria 2660
85 Ga0207657_10009553 3300025919 Bacteria 9734
86 Ga0207657_10011660 3300025919 Bacteria 8713
87 Ga0207657_10052448 3300025919 Bacteria 3539
88 Ga0207657_10296489 3300025919 Unclassified 1281
89 Ga0207652_10141314 3300025921 Bacteria 2153
90 Ga0207652_10216096 3300025921 Bacteria 1727
91 Ga0207652_10260626 3300025921 Unclassified 1564
92 Ga0207652_10387751 3300025921 Bacteria 1261
93 Ga0207652_10463486 3300025921 Unclassified 1142
94 Ga0207646_10058728 3300025922 Bacteria 3436
95 Ga0207687_10218772 3300025927 Bacteria 1498
96 Ga0207664_10086824 3300025929 Bacteria 2556
97 Ga0207664_10090443 3300025929 Bacteria 2508
98 Ga0207664_10139764 3300025929 Bacteria 2047
99 Ga0207644_10309697 3300025931 Bacteria 1275
100 Ga0207702_10423443 3300026078 Bacteria 1288
101 Ga0207698_10287810 3300026142 Bacteria 1523
102 Ga0268266_10535800 3300028379 Bacteria 1121
103 Ga0265337_1015031 3300028556 Bacteria 2548
104 Ga0265326_10024445 3300028558 Bacteria 1724
105 Ga0265319_1015462 3300028563 Bacteria 2959
106 Ga0265334_10000531 3300028573 Bacteria 19440
107 Ga0265318_10000197 3300028577 Bacteria 52920
108 Ga0265318_10001153 3300028577 Bacteria 16417
109 Ga0265318_10026984 3300028577 Bacteria 2260
110 Ga0265323_10016588 3300028653 Bacteria 2872
111 Ga0265322_10011001 3300028654 Bacteria 2624
112 Ga0265322_10066665 3300028654 Bacteria 1020
113 Ga0265336_10015563 3300028666 Bacteria 2498
114 Ga0265338_10005668 3300028800 Bacteria 16194
115 Ga0265338_10013542 3300028800 Bacteria 9194
116 Ga0265338_10159091 3300028800 Bacteria 1746
117 Ga0265324_10009154 3300029957 Bacteria 3883
118 Ga0265330_10000626 3300031235 Bacteria 22841
119 Ga0265330_10014950 3300031235 Bacteria 3595
120 Ga0265330_10048072 3300031235 Bacteria 1876
121 Ga0265332_10017312 3300031238 Bacteria 3181
122 Ga0265332_10080334 3300031238 Bacteria 1384
123 Ga0265320_10026916 3300031240 Bacteria 3004
124 Ga0265325_10002011 3300031241 Bacteria 13964
125 Ga0265325_10053981 3300031241 Bacteria 2059
126 Ga0265325_10100509 3300031241 Unclassified 1416
127 Ga0265329_10001354 3300031242 Bacteria 11887
128 Ga0265329_10014285 3300031242 Bacteria 2806
129 Ga0265340_10007159 3300031247 Bacteria 6076
130 Ga0265340_10037920 3300031247 Bacteria 2386
131 Ga0265339_10003320 3300031249 Bacteria 11270
132 Ga0265339_10007751 3300031249 Bacteria 6902
133 Ga0265331_10000942 3300031250 Bacteria 23214
134 Ga0265331_10025154 3300031250 Bacteria 3007
135 Ga0265327_10002175 3300031251 Bacteria 21560
136 Ga0265327_10028630 3300031251 Bacteria 3182
137 Ga0265327_10039170 3300031251 Bacteria 2577
138 Ga0265316_10006881 3300031344 Bacteria 10789
139 Ga0265316_10046135 3300031344 Bacteria 3454
140 Ga0265316_10064045 3300031344 Bacteria 2848
141 Ga0265313_10020753 3300031595 Bacteria 3615
142 Ga0265313_10021304 3300031595 Bacteria 3548
143 Ga0265314_10017534 3300031711 Bacteria 5617
144 Ga0265314_10061114 3300031711 Bacteria 2568
145 Ga0265342_10004117 3300031712 Bacteria 11588
146 Ga0265342_10042406 3300031712 Bacteria 2749
147 Ga0373935_0371447 3300035692 Unclassified 1023
148 Ga0373933_0072794 3300035724 Bacteria 2093
149 Ga0373937_0084688 3300036401 Bacteria 2933
150 Ga0395899_0326313 3300037312 Unclassified 1032
151 Ga0395900_0359610 3300037418 Bacteria 1427
152 Ga0395898_0469154 3300037466 Unclassified 1198
153 Ga0395905_0112488 3300037471 Bacteria 2557
154 Ga0395901_0095577 3300038443 Bacteria 3114
155 Ga0395901_0222753 3300038443 Bacteria 1971
156 Ga0395901_0271025 3300038443 Bacteria 1765
157 Ga0395901_0514455 3300038443 Unclassified 1217
158 Ga0436360_1349107 3300039438 Unclassified 3217
159 Ga0453683_0378751 3300044673 Unclassified 911
160 Ga0466963_0096558 3300044694 Bacteria 2019
161 Ga0466964_0122238 3300044706 Bacteria 1175
162 Ga0466968_0051762 3300044735 Bacteria 1755
163 Ga0466957_0198898 3300044842 Unclassified 1316
164 Ga0466957_0225117 3300044842 Unclassified 1240
165 Ga0466967_0000648 3300045976 Bacteria 17473
166 Ga0466967_0077059 3300045976 Bacteria 3000
167 Ga0466967_0130134 3300045976 Bacteria 2335
168 Ga0466967_0380355 3300045976 Bacteria 1371
169 Ga0466967_0457997 3300045976 Bacteria 1247
170 Ga0495603_0207034 3300046455 Unclassified 1133
171 Ga0495651_0078928 3300046462 Bacteria 2489
172 Ga0495653_0178914 3300046463 Bacteria 1457
173 Ga0495582_0236611 3300046473 Unclassified 1046
174 Ga0495608_0011822 3300046511 Bacteria 6073
175 Ga0495628_0022690 3300046516 Bacteria 5155
176 Ga0495630_0107439 3300046517 Bacteria 2114
177 Ga0495667_0033246 3300046559 Bacteria 3452
178 Ga0495667_0040341 3300046559 Bacteria 3100
179 Ga0495634_0018558 3300046642 Bacteria 4950
180 Ga0495634_0162675 3300046642 Bacteria 1406
181 Ga0495635_0085658 3300046663 Bacteria 2156
182 Ga0495635_0127342 3300046663 Bacteria 1736
183 Ga0495657_0156711 3300046675 Bacteria 1411
184 Ga0495658_0043600 3300046683 Bacteria 2510
185 Ga0495604_0149207 3300047317 Bacteria 1663
186 Ga0495676_0109555 3300047321 Bacteria 2029
187 Ga0495680_0001115 3300047322 Bacteria 29670
188 Ga0495680_0123006 3300047322 Bacteria 1914
189 Ga0495684_0037310 3300047471 Bacteria 3727
190 Ga0496101_0165297 3300048904 Bacteria 1699
191 Ga0496101_0341870 3300048904 Unclassified 1175
192 Ga0496102_0252027 3300048905 Unclassified 1665
193 Ga0496102_0388875 3300048905 Bacteria 1312
194 Ga0496103_0072742 3300048906 Bacteria 2154
195 Ga0496104_0003064 3300048907 Bacteria 14407
196 Ga0496104_0015209 3300048907 Bacteria 6967
197 Ga0496105_0190160 3300048908 Bacteria 1679
198 Ga0496106_0003891 3300048909 Bacteria 11143
199 Ga0496107_0001297 3300048910 Bacteria 15306
200 Ga0496107_0151959 3300048910 Bacteria 1713
201 Ga0496108_0363587 3300048911 Bacteria 1263
202 Ga0496109_0002694 3300048912 Bacteria 14888
203 Ga0496110_0000937 3300048913 Bacteria 20485
204 Ga0496110_0003760 3300048913 Bacteria 11694
205 Ga0496110_0055282 3300048913 Bacteria 3492
206 Ga0496111_0001044 3300048914 Bacteria 15252
207 Ga0496111_0007396 3300048914 Bacteria 7194
208 Ga0496112_0015478 3300048915 Bacteria 7120
209 Ga0496112_0037845 3300048915 Bacteria 4711
210 Ga0496112_0064607 3300048915 Bacteria 3611
211 Ga0496112_0170666 3300048915 Bacteria 2140
212 Ga0496113_0082978 3300048916 Bacteria 2459
213 Ga0496113_0126827 3300048916 Bacteria 1999
214 Ga0496114_0053762 3300048917 Bacteria 3357
215 Ga0501034_0002607 3300049571 Bacteria 21420
216 Ga0501067_0007704 3300049583 Bacteria 5989
217 Ga0501070_0297013 3300049586 Unclassified 1316
218 Ga0501073_0040303 3300049589 Bacteria 3306
219 Ga0501074_0084297 3300049590 Bacteria 2278
220 Ga0501080_0001559 3300049742 Bacteria 19371
221 nmdc:mga0yw44_313236_c1 3300050492 Bacteria 1053
222 nmdc:mga0n895_49725_c1 3300050512 Bacteria 4109
223 Ga0495595_0035258 3300053084 Bacteria 2267
224 Ga0495595_0086633 3300053084 Bacteria 1499
225 Ga0495619_0041217 3300053085 Bacteria 3020
226 Ga0075434_100036046
227 rootH1_10189230
228 Ga0070658_10001923
229 Ga0070658_10009312
230 Ga0070658_10098703
231 Ga0070683_100003875
232 Ga0070680_100220337
233 Ga0070680_100397816
234 Ga0070682_100012139
235 Ga0070682_100174851
236 Ga0070660_100014142
237 Ga0070660_100018143
238 Ga0070660_100314901
239 Ga0070660_100358757
240 Ga0070661_100098331
241 Ga0070661_100101685
242 Ga0070661_100143781
243 Ga0070674_100137306
244 Ga0070673_100362325
245 Ga0070709_10165610
246 Ga0070714_100002694
247 Ga0070714_100026064
248 Ga0070714_100053814
249 Ga0070714_100079429
250 Ga0070714_100170856
251 Ga0070714_100250832
252 Ga0070681_10064288
253 Ga0070681_10112465
254 Ga0070681_10216014
255 Ga0070681_10537331
256 Ga0070706_100123592
257 Ga0070707_100192445
258 Ga0070698_100054564
259 Ga0070698_100095006
260 Ga0070698_100104128
261 Ga0070698_100313502
262 Ga0070679_100233054
263 Ga0070679_100245746
264 Ga0070679_100256100
265 Ga0070679_100302153
266 Ga0070679_100392063
267 Ga0070679_100601849
268 Ga0070686_100438313
269 Ga0070695_100445564
270 Ga0068855_100208575
271 Ga0068854_100376367
272 Ga0068856_100514571
273 Ga0068852_100038086
274 Ga0070717_10139346
275 Ga0075365_10114489
276 Ga0070712_100032500
277 Ga0075436_100124047
278 Ga0105240_10019802
279 Ga0105240_10144946
280 Ga0105240_10171837
281 Ga0105237_10688859
282 Ga0105249_10180519
283 Ga0105239_10446388
284 Ga0157370_10011840
285 Ga0157370_10281625
286 Ga0157369_10024176
287 Ga0157369_10047050
288 Ga0182008_10051097
289 Ga0182008_10061633
290 Ga0197907_11164713
291 Ga0206356_10660088
292 Ga0206356_11265938
293 Ga0206356_11547155
294 Ga0206354_11476729
295 Ga0206353_10084500
296 Ga0206353_10100643
297 Ga0206353_12030858
298 Ga0224712_10015343
299 Ga0207699_10084465
300 Ga0207699_10125996
301 Ga0207705_10020415
302 Ga0207705_10149880
303 Ga0207705_10202833
304 Ga0207707_10008036
305 Ga0207707_10146531
306 Ga0207707_10155054
307 Ga0207693_10083222
308 Ga0207663_10046061
309 Ga0207660_10063661
310 Ga0207657_10009553
311 Ga0207657_10011660
312 Ga0207657_10052448
313 Ga0207657_10296489
314 Ga0207652_10141314
315 Ga0207652_10216096
316 Ga0207652_10260626
317 Ga0207652_10387751
318 Ga0207652_10463486
319 Ga0207646_10058728
320 Ga0207687_10218772
321 Ga0207664_10086824
322 Ga0207664_10090443
323 Ga0207664_10139764
324 Ga0207644_10309697
325 Ga0207702_10423443
326 Ga0207698_10287810
327 Ga0268266_10535800
328 Ga0265337_1015031
329 Ga0265326_10024445
330 Ga0265319_1015462
331 Ga0265334_10000531
332 Ga0265318_10000197
333 Ga0265318_10001153
334 Ga0265318_10026984
335 Ga0265323_10016588
336 Ga0265322_10011001
337 Ga0265322_10066665
338 Ga0265336_10015563
339 Ga0265338_10005668
340 Ga0265338_10013542
341 Ga0265338_10159091
342 Ga0265324_10009154
343 Ga0265330_10000626
344 Ga0265330_10014950
345 Ga0265330_10048072
346 Ga0265332_10017312
347 Ga0265332_10080334
348 Ga0265320_10026916
349 Ga0265325_10002011
350 Ga0265325_10053981
351 Ga0265325_10100509
352 Ga0265329_10001354
353 Ga0265329_10014285
354 Ga0265340_10007159
355 Ga0265340_10037920
356 Ga0265339_10003320
357 Ga0265339_10007751
358 Ga0265331_10000942
359 Ga0265331_10025154
360 Ga0265327_10002175
361 Ga0265327_10028630
362 Ga0265327_10039170
363 Ga0265316_10006881
364 Ga0265316_10046135
365 Ga0265316_10064045
366 Ga0265313_10020753
367 Ga0265313_10021304
368 Ga0265314_10017534
369 Ga0265314_10061114
370 Ga0265342_10004117
371 Ga0265342_10042406
372 Ga0373935_0371447
373 Ga0373933_0072794
374 Ga0373937_0084688
375 Ga0395899_0326313
376 Ga0395900_0359610
377 Ga0395898_0469154
378 Ga0395905_0112488
379 Ga0395901_0095577
380 Ga0395901_0222753
381 Ga0395901_0271025
382 Ga0395901_0514455
383 Ga0436360_1349107
384 Ga0453683_0378751
385 Ga0466963_0096558
386 Ga0466964_0122238
387 Ga0466968_0051762
388 Ga0466957_0198898
389 Ga0466957_0225117
390 Ga0466967_0000648
391 Ga0466967_0077059
392 Ga0466967_0130134
393 Ga0466967_0380355
394 Ga0466967_0457997
395 Ga0495603_0207034
396 Ga0495651_0078928
397 Ga0495653_0178914
398 Ga0495582_0236611
399 Ga0495608_0011822
400 Ga0495628_0022690
401 Ga0495630_0107439
402 Ga0495667_0033246
403 Ga0495667_0040341
404 Ga0495634_0018558
405 Ga0495634_0162675
406 Ga0495635_0085658
407 Ga0495635_0127342
408 Ga0495657_0156711
409 Ga0495658_0043600
410 Ga0495604_0149207
411 Ga0495676_0109555
412 Ga0495680_0001115
413 Ga0495680_0123006
414 Ga0495684_0037310
415 Ga0496101_0165297
416 Ga0496101_0341870
417 Ga0496102_0252027
418 Ga0496102_0388875
419 Ga0496103_0072742
420 Ga0496104_0003064
421 Ga0496104_0015209
422 Ga0496105_0190160
423 Ga0496106_0003891
424 Ga0496107_0001297
425 Ga0496107_0151959
426 Ga0496108_0363587
427 Ga0496109_0002694
428 Ga0496110_0000937
429 Ga0496110_0003760
430 Ga0496110_0055282
431 Ga0496111_0001044
432 Ga0496111_0007396
433 Ga0496112_0015478
434 Ga0496112_0037845
435 Ga0496112_0064607
436 Ga0496112_0170666
437 Ga0496113_0082978
438 Ga0496113_0126827
439 Ga0496114_0053762
440 Ga0501034_0002607
441 Ga0501067_0007704
442 Ga0501070_0297013
443 Ga0501073_0040303
444 Ga0501074_0084297
445 Ga0501080_0001559
446 nmdc:mga0yw44_313236_c1
447 nmdc:mga0n895_49725_c1
448 Ga0495595_0035258
449 Ga0495595_0086633
450 Ga0495619_0041217

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq8-assembly2.cif.gz_F-2 crystal structure of protein rv1636 from mycobacterium tuberculosis h37rv 0.79 9 106
2iel-assembly1.cif.gz_B crystal structure of tt0030 from thermus thermophilus 0.7838 11 142
2iel-assembly1.cif.gz_A crystal structure of tt0030 from thermus thermophilus 0.7794 151 274
2iel-assembly1.cif.gz_B crystal structure of tt0030 from thermus thermophilus 0.7726 11 142
3qtb-assembly1.cif.gz_A structure of the universal stress protein from archaeoglobus fulgidus in complex with damp 0.7586 8 138
ID Description Score Start End Superfamily
af_Q54TR0_1_116_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8028 152 272 3.40.50.620
af_Q54TR0_1_116_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7904 152 272 3.40.50.620
2ielB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7838 11 142 3.40.50.620
2ielB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7726 11 142 3.40.50.620
af_Q94II5_28_177_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7603 1 140 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A411YAM8-F1-model_v4 DUF190 domain-containing protein 0.9542 151 274
AF-A0A411YEU2-F1-model_v4 Universal stress protein 0.9435 151 279
AF-A0A537ZZ39-F1-model_v4 Universal stress protein 0.9401 10 282
AF-A0A537ZZ39-F1-model_v4 Universal stress protein 0.9334 10 282
AF-A0A512DBN7-F1-model_v4 UspA domain-containing protein 0.9331 151 274

Map