F337217

General Info

Members Datasets Scaffolds Average Seq Length
224 151 205 268

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0006019|Ga0500646_0006019_832_1740
Length 302
Sequence MYGSPYIFFYLSFLTNNSERFNKAAQVNIRYLCCMINQDINKLFPQILYSCYVARSREGEQFVKEHVFGYQLAGTLVMNDGVKEYTINEGDFRFCKRNNLVKFIKHPPENGEYKSISIYLDQETLRNFSMEYGYKSEKRMEGDAIINLSSDPLYKSYLDSLKPYDQIKQLGNENLLALKLKEAILVLLHTRPELKDVLFDFSEPDKIDLESFMQQNYHFNVELKRFAHLTGRSLATFKRDFDKIFHTTPSRWLQQRRLQEAHYLIKEKGKTPSDVYLDVGFEDLSHFSFAFKKTFGVAPSRI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
4 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
5 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
6 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
7 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
8 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
9 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
10 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
11 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
12 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
13 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
14 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
15 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
16 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
17 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
18 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
19 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
20 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
135 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
136 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
137 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
141 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
142 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
143 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
147 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
151 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.52
Metatranscriptomes 0
Isolates 8.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.73
Nodule 0
Rhizoplane 0
Rhizosphere 68.3
Stem 0
Stem Tuber 0
Unclassified 16.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3895340 2162886007 Bacteria 17367
2 JGI24740J21852_10007329 3300001979 Unclassified 4493
3 JGI24737J22298_10052361 3300001990 Unclassified 1238
4 JGI25154J39366_1000014 3300002738 Bacteria 265287
5 rootH1_10087663 3300003316 Bacteria 2010
6 rootH2_10004991 3300003320 Bacteria 34166
7 rootH2_10027601 3300003320 Bacteria 37422
8 rootH2_10228207 3300003320 Bacteria 2975
9 rootL2_10028078 3300003322 Bacteria 16956
10 rootL2_10046004 3300003322 Bacteria 1268
11 rootH1_10066105 3300003323 Bacteria 8245
12 rootH1_10139658 3300003323 Bacteria 2704
13 rootH1_10318147 3300003323 Bacteria 1973
14 JGI25160J50197_1010894 3300003354 Bacteria 3259
15 Ga0055536_1005176 3300003781 Bacteria 6447
16 Ga0065165_1000640 3300005262 Bacteria 50689
17 Ga0065714_10002550 3300005288 Bacteria 28774
18 Ga0065714_10027738 3300005288 Bacteria 1555
19 Ga0065714_10069892 3300005288 Bacteria 4045
20 Ga0065704_10000227 3300005289 Bacteria 66518
21 Ga0065704_10149637 3300005289 Bacteria 1440
22 Ga0070658_10000011 3300005327 Bacteria 294396
23 Ga0070658_10336412 3300005327 Unclassified 1291
24 Ga0070676_10000144 3300005328 Bacteria 27905
25 Ga0070682_100019954 3300005337 Bacteria 3938
26 Ga0068868_100016976 3300005338 Bacteria 5417
27 Ga0070673_100013402 3300005364 Bacteria 5671
28 Ga0070678_100016346 3300005456 Bacteria 4746
29 Ga0070662_100000083 3300005457 Bacteria 51358
30 Ga0070662_100439241 3300005457 Bacteria 1082
31 Ga0068867_100002189 3300005459 Bacteria 13719
32 Ga0070672_100167207 3300005543 Bacteria 1827
33 Ga0070665_100000267 3300005548 Bacteria 85526
34 Ga0068855_100012097 3300005563 Bacteria 10424
35 Ga0068855_100031144 3300005563 Bacteria 6371
36 Ga0068855_100537619 3300005563 Bacteria 1266
37 Ga0068852_100004913 3300005616 Bacteria 9492
38 Ga0068870_10056831 3300005840 Bacteria 2090
39 Ga0068862_100243818 3300005844 Unclassified 1635
40 Ga0075366_10002561 3300006195 Bacteria 9346
41 Ga0097621_100000344 3300006237 Bacteria 31894
42 Ga0068871_100000824 3300006358 Bacteria 20776
43 Ga0068865_100000492 3300006881 Bacteria 22165
44 Ga0105240_10000078 3300009093 Bacteria 196646
45 Ga0105240_10004820 3300009093 Bacteria 20332
46 Ga0105240_10956727 3300009093 Bacteria 918
47 Ga0105245_10235439 3300009098 Unclassified 1773
48 Ga0105241_10015697 3300009174 Bacteria 5548
49 Ga0105241_10055616 3300009174 Bacteria 3032
50 Ga0105242_10152203 3300009176 Bacteria 2018
51 Ga0105237_10000168 3300009545 Bacteria 92212
52 Ga0105237_10002404 3300009545 Bacteria 23243
53 Ga0105237_10069319 3300009545 Bacteria 3522
54 Ga0105237_10150075 3300009545 Bacteria 2327
55 Ga0105237_10364863 3300009545 Bacteria 1449
56 Ga0105238_10003025 3300009551 Bacteria 16777
57 Ga0105239_10000008 3300010375 Bacteria 376925
58 Ga0105239_10000286 3300010375 Bacteria 74525
59 Ga0105239_10009587 3300010375 Bacteria 10891
60 Ga0105239_10033286 3300010375 Bacteria 5661
61 Ga0105239_10242814 3300010375 Unclassified 2022
62 Ga0105239_10313447 3300010375 Bacteria 1768
63 Ga0157373_10000002 3300013100 Bacteria 750094
64 Ga0157373_10000105 3300013100 Bacteria 65415
65 Ga0157373_10052411 3300013100 Bacteria 2904
66 Ga0157371_10003048 3300013102 Bacteria 15549
67 Ga0157371_10004489 3300013102 Bacteria 12171
68 Ga0157371_10256510 3300013102 Unclassified 1260
69 Ga0157370_10001277 3300013104 Bacteria 31514
70 Ga0157370_10001349 3300013104 Bacteria 30480
71 Ga0157370_10001441 3300013104 Bacteria 29415
72 Ga0157370_10006924 3300013104 Bacteria 12395
73 Ga0157370_10145429 3300013104 Bacteria 2208
74 Ga0157370_10293001 3300013104 Bacteria 1503
75 Ga0157370_10608332 3300013104 Bacteria 1000
76 Ga0157370_10651019 3300013104 Bacteria 963
77 Ga0157369_10008455 3300013105 Bacteria 11806
78 Ga0157369_10511315 3300013105 Unclassified 1242
79 Ga0157374_10001231 3300013296 Bacteria 21878
80 Ga0157374_10001437 3300013296 Bacteria 20134
81 Ga0157378_10036066 3300013297 Bacteria 4376
82 Ga0157378_10046844 3300013297 Bacteria 3843
83 Ga0163162_10000074 3300013306 Bacteria 91138
84 Ga0163162_10029186 3300013306 Bacteria 5457
85 Ga0163162_10132279 3300013306 Bacteria 2604
86 Ga0157372_10016546 3300013307 Bacteria 7914
87 Ga0157372_11052220 3300013307 Bacteria 942
88 Ga0157375_10324805 3300013308 Bacteria 1703
89 Ga0157375_10439816 3300013308 Bacteria 1470
90 Ga0157375_10780125 3300013308 Bacteria 1105
91 Ga0157377_10026366 3300014745 Bacteria 3110
92 Ga0182006_1002894 3300015261 Bacteria 9114
93 Ga0163161_10003317 3300017792 Bacteria 11289
94 Ga0163161_10009589 3300017792 Bacteria 6694
95 Ga0209436_100247 3300025208 Bacteria 24873
96 Ga0209437_100230 3300025233 Bacteria 95882
97 Ga0209646_1000002 3300025246 Bacteria 1425781
98 Ga0209026_1000300 3300025250 Bacteria 53962
99 Ga0209026_1001074 3300025250 Bacteria 13206
100 Ga0209676_1000921 3300025292 Bacteria 36371
101 Ga0209758_1003832 3300025297 Bacteria 13203
102 Ga0207426_1000322 3300025302 Bacteria 91914
103 Ga0207426_1000345 3300025302 Bacteria 85840
104 Ga0207426_1058390 3300025302 Bacteria 1120
105 Ga0207647_10000098 3300025904 Bacteria 67170
106 Ga0207645_10000185 3300025907 Bacteria 49988
107 Ga0207705_10000015 3300025909 Bacteria 382901
108 Ga0207654_10003819 3300025911 Bacteria 7594
109 Ga0207654_10007860 3300025911 Bacteria 5377
110 Ga0207695_10000064 3300025913 Bacteria 346010
111 Ga0207695_10054856 3300025913 Bacteria 4158
112 Ga0207671_10002532 3300025914 Bacteria 19474
113 Ga0207671_10010536 3300025914 Bacteria 7615
114 Ga0207671_10053192 3300025914 Bacteria 3001
115 Ga0207671_10163925 3300025914 Bacteria 1722
116 Ga0207694_10014370 3300025924 Bacteria 5967
117 Ga0207690_10025883 3300025932 Bacteria 3690
118 Ga0207706_10000176 3300025933 Bacteria 70917
119 Ga0207704_10000055 3300025938 Bacteria 78858
120 Ga0207691_10129523 3300025940 Bacteria 2230
121 Ga0207667_10057264 3300025949 Bacteria 4092
122 Ga0207667_10095161 3300025949 Bacteria 3075
123 Ga0207667_10448674 3300025949 Unclassified 1311
124 Ga0207677_10014863 3300026023 Bacteria 4561
125 Ga0207639_10311850 3300026041 Bacteria 1394
126 Ga0207648_10000775 3300026089 Bacteria 36025
127 Ga0207674_10525750 3300026116 Unclassified 1143
128 Ga0207683_10038319 3300026121 Bacteria 4177
129 Ga0268266_10000018 3300028379 Bacteria 569141
130 Ga0307517_10010105 3300028786 Bacteria 13262
131 Ga0307515_10000181 3300028794 Bacteria 154316
132 Ga0307515_10052269 3300028794 Bacteria 6064
133 Ga0307511_10001053 3300030521 Bacteria 29379
134 Ga0265327_10000097 3300031251 Bacteria 193156
135 Ga0307513_10209361 3300031456 Bacteria 1783
136 Ga0307508_10000636 3300031616 Bacteria 42249
137 Ga0307516_10000232 3300031730 Bacteria 71483
138 Ga0307405_10042923 3300031731 Bacteria 2755
139 Ga0307412_10000181 3300031911 Bacteria 44202
140 Ga0307414_10002141 3300032004 Bacteria 10312
141 Ga0307414_10075325 3300032004 Bacteria 2449
142 Ga0307507_10000509 3300033179 Bacteria 81904
143 Ga0495638_0000005 3300046460 Bacteria 680627
144 Ga0495650_0000277 3300046471 Bacteria 98027
145 Ga0495650_0028270 3300046471 Bacteria 2578
146 Ga0495596_0058756 3300046500 Bacteria 1499
147 Ga0495606_0015789 3300046507 Bacteria 5796
148 Ga0495606_0036474 3300046507 Bacteria 3348
149 Ga0495606_0043398 3300046507 Bacteria 2999
150 Ga0495606_0051502 3300046507 Bacteria 2685
151 Ga0495606_0238178 3300046507 Bacteria 1016
152 Ga0495610_0019355 3300046512 Bacteria 3813
153 Ga0495616_0000819 3300046513 Bacteria 22682
154 Ga0495631_0002402 3300046518 Bacteria 10576
155 Ga0495632_0084534 3300046519 Unclassified 1510
156 Ga0495648_0089091 3300046524 Bacteria 1733
157 Ga0495654_0109447 3300046530 Bacteria 1262
158 Ga0495609_0004269 3300046538 Bacteria 7887
159 Ga0495633_0000101 3300046558 Bacteria 116147
160 Ga0495633_0003779 3300046558 Bacteria 9930
161 Ga0495668_0000112 3300046616 Bacteria 128501
162 Ga0495625_0002062 3300046660 Bacteria 22520
163 Ga0495625_0003446 3300046660 Bacteria 15773
164 Ga0495625_0015975 3300046660 Bacteria 5921
165 Ga0495625_0075299 3300046660 Bacteria 2362
166 Ga0495625_0163923 3300046660 Bacteria 1487
167 Ga0495661_0010967 3300046665 Bacteria 6155
168 Ga0495661_0080071 3300046665 Bacteria 1886
169 Ga0495660_0007575 3300046810 Bacteria 6374
170 Ga0495672_0043115 3300047320 Bacteria 2715
171 Ga0495683_0138930 3300047323 Bacteria 1140
172 Ga0495686_0000154 3300047472 Bacteria 131970
173 Ga0495686_0011013 3300047472 Bacteria 6397
174 Ga0495686_0090052 3300047472 Bacteria 1864
175 Ga0495614_0063449 3300048089 Bacteria 1588
176 Ga0496116_0000030 3300048919 Bacteria 420761
177 Ga0496118_0070734 3300048921 Bacteria 2517
178 Ga0496124_0032563 3300048927 Bacteria 4600
179 Ga0496125_0000538 3300048928 Bacteria 65285
180 Ga0496126_0054574 3300048929 Bacteria 3618
181 Ga0496126_0377117 3300048929 Bacteria 1155
182 Ga0495678_005124 3300049459 Bacteria 7358
183 Ga0495682_0030034 3300049460 Bacteria 2012
184 nmdc:mga0k408_347_c1 3300050493 Bacteria 25309
185 Ga0500578_0000054 3300053086 Bacteria 121082
186 Ga0500644_0000163 3300053088 Bacteria 42053
187 Ga0500646_0002182 3300053090 Bacteria 5106
188 Ga0500646_0006019 3300053090 Bacteria 3078
189 Ga0500583_0002602 3300053092 Bacteria 5468
190 Ga0500651_0001281 3300053093 Bacteria 12520
191 Ga0500641_0000040 3300053096 Bacteria 68174
192 Ga0500557_002601 3300053105 Bacteria 3360
193 Ga0500562_018798 3300053108 Unclassified 1785
194 Ga0500569_000081 3300053109 Bacteria 15606
195 Ga0500608_000639 3300053122 Bacteria 12919
196 Ga0500618_000238 3300053125 Bacteria 43564
197 Ga0500568_0063809 3300053139 Unclassified 1420
198 Ga0500577_0001764 3300053142 Bacteria 5525
199 Ga0500604_0002825 3300053151 Bacteria 4712
200 Ga0500616_0000003 3300053153 Bacteria 1220687
201 Ga0500616_0013670 3300053153 Bacteria 4702
202 Ga0500622_0000034 3300053156 Bacteria 187647
203 Ga0500622_0000055 3300053156 Bacteria 143073
204 Ga0500627_0142683 3300053158 Bacteria 1082
205 Ga0500633_0000132 3300053160 Bacteria 10060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053090 Ga0500646_0002182 Ga0500646_0002182_2948_3760 239
2 3300053096 Ga0500641_0000040 Ga0500641_0000040_6572_7384 239
3 3300013308 Ga0157375_10324805 Ga0157375_103248052 240
4 3300030521 Ga0307511_10001053 Ga0307511_100010536 240
5 3300046507 Ga0495606_0036474 Ga0495606_0036474_2315_3055 245
6 3300031456 Ga0307513_10209361 Ga0307513_102093612 257
7 iso_pu_bacteria 2929177148 2929180281 257
8 iso_pu_bacteria 2945977869 2945982680 257
9 iso_pu_bacteria 2946013367 2946017928 257
10 3300005327 Ga0070658_10000011 Ga0070658_10000011187 258
11 3300005563 Ga0068855_100012097 Ga0068855_10001209713 258
12 3300009545 Ga0105237_10364863 Ga0105237_103648631 258
13 3300010375 Ga0105239_10313447 Ga0105239_103134472 258
14 3300013104 Ga0157370_10001441 Ga0157370_100014412 258
15 3300013307 Ga0157372_11052220 Ga0157372_110522202 258
16 3300025909 Ga0207705_10000015 Ga0207705_10000015184 258
17 3300013104 Ga0157370_10608332 Ga0157370_106083321 259
18 iso_pu_bacteria 2929921140 2929923718 259
19 3300001979 JGI24740J21852_10007329 JGI24740J21852_100073292 260
20 3300002738 JGI25154J39366_1000014 JGI25154J39366_100001490 260
21 3300003323 rootH1_10066105 rootH1_100661051 260
22 3300003354 JGI25160J50197_1010894 JGI25160J50197_10108942 260
23 3300005457 Ga0070662_100439241 Ga0070662_1004392411 260
24 3300005844 Ga0068862_100243818 Ga0068862_1002438182 260
25 3300017792 Ga0163161_10009589 Ga0163161_100095897 260
26 3300025246 Ga0209646_1000002 Ga0209646_10000021037 260
27 3300025250 Ga0209026_1000300 Ga0209026_100030016 260
28 3300025297 Ga0209758_1003832 Ga0209758_100383211 260
29 3300025302 Ga0207426_1000322 Ga0207426_100032225 260
30 3300053086 Ga0500578_0000054 Ga0500578_0000054_28013_28834 260
31 3300053139 Ga0500568_0063809 Ga0500568_0063809_253_1059 260
32 3300053156 Ga0500622_0000055 Ga0500622_0000055_119836_120639 260
33 iso_pu_bacteria 2881247448 2881248793 260
34 iso_pu_bacteria 2904555929 2904558344 260
35 iso_pu_bacteria 2919437846 2919439301 260
36 iso_pu_bacteria 2929239360 2929242720 260
37 3300001990 JGI24737J22298_10052361 JGI24737J22298_100523611 261
38 3300003320 rootH2_10004991 rootH2_1000499118 261
39 3300003320 rootH2_10228207 rootH2_102282073 261
40 3300003322 rootL2_10028078 rootL2_1002807816 261
41 3300003323 rootH1_10139658 rootH1_101396584 261
42 3300003323 rootH1_10318147 rootH1_103181472 261
43 3300005288 Ga0065714_10069892 Ga0065714_100698921 261
44 3300005289 Ga0065704_10149637 Ga0065704_101496371 261
45 3300005328 Ga0070676_10000144 Ga0070676_1000014412 261
46 3300005338 Ga0068868_100016976 Ga0068868_1000169761 261
47 3300005364 Ga0070673_100013402 Ga0070673_1000134024 261
48 3300005456 Ga0070678_100016346 Ga0070678_1000163463 261
49 3300005457 Ga0070662_100000083 Ga0070662_10000008335 261
50 3300005459 Ga0068867_100002189 Ga0068867_1000021892 261
51 3300005543 Ga0070672_100167207 Ga0070672_1001672072 261
52 3300005548 Ga0070665_100000267 Ga0070665_10000026758 261
53 3300005563 Ga0068855_100031144 Ga0068855_1000311446 261
54 3300005563 Ga0068855_100537619 Ga0068855_1005376191 261
55 3300005616 Ga0068852_100004913 Ga0068852_1000049138 261
56 3300005840 Ga0068870_10056831 Ga0068870_100568313 261
57 3300006195 Ga0075366_10002561 Ga0075366_100025615 261
58 3300006237 Ga0097621_100000344 Ga0097621_10000034426 261
59 3300006358 Ga0068871_100000824 Ga0068871_1000008246 261
60 3300006881 Ga0068865_100000492 Ga0068865_1000004925 261
61 3300009093 Ga0105240_10000078 Ga0105240_1000007838 261
62 3300009093 Ga0105240_10004820 Ga0105240_1000482017 261
63 3300009098 Ga0105245_10235439 Ga0105245_102354391 261
64 3300009174 Ga0105241_10015697 Ga0105241_100156973 261
65 3300009174 Ga0105241_10055616 Ga0105241_100556162 261
66 3300009176 Ga0105242_10152203 Ga0105242_101522032 261
67 3300009545 Ga0105237_10000168 Ga0105237_1000016814 261
68 3300009545 Ga0105237_10002404 Ga0105237_1000240414 261
69 3300009545 Ga0105237_10069319 Ga0105237_100693195 261
70 3300009545 Ga0105237_10150075 Ga0105237_101500752 261
71 3300009551 Ga0105238_10003025 Ga0105238_1000302513 261
72 3300010375 Ga0105239_10000008 Ga0105239_1000000833 261
73 3300010375 Ga0105239_10000286 Ga0105239_1000028622 261
74 3300010375 Ga0105239_10009587 Ga0105239_100095879 261
75 3300010375 Ga0105239_10033286 Ga0105239_100332865 261
76 3300010375 Ga0105239_10242814 Ga0105239_102428142 261
77 3300013100 Ga0157373_10052411 Ga0157373_100524114 261
78 3300013102 Ga0157371_10256510 Ga0157371_102565102 261
79 3300013104 Ga0157370_10001277 Ga0157370_1000127718 261
80 3300013105 Ga0157369_10511315 Ga0157369_105113152 261
81 3300013296 Ga0157374_10001231 Ga0157374_100012314 261
82 3300013296 Ga0157374_10001437 Ga0157374_100014374 261
83 3300013297 Ga0157378_10036066 Ga0157378_100360664 261
84 3300013297 Ga0157378_10046844 Ga0157378_100468444 261
85 3300013306 Ga0163162_10000074 Ga0163162_1000007415 261
86 3300013306 Ga0163162_10029186 Ga0163162_100291866 261
87 3300013306 Ga0163162_10132279 Ga0163162_101322792 261
88 3300013307 Ga0157372_10016546 Ga0157372_100165466 261
89 3300013308 Ga0157375_10439816 Ga0157375_104398162 261
90 3300013308 Ga0157375_10780125 Ga0157375_107801251 261
91 3300014745 Ga0157377_10026366 Ga0157377_100263663 261
92 3300017792 Ga0163161_10003317 Ga0163161_100033173 261
93 3300025208 Ga0209436_100247 Ga0209436_1002473 261
94 3300025233 Ga0209437_100230 Ga0209437_10023038 261
95 3300025250 Ga0209026_1001074 Ga0209026_100107412 261
96 3300025302 Ga0207426_1000345 Ga0207426_100034520 261
97 3300025904 Ga0207647_10000098 Ga0207647_1000009829 261
98 3300025907 Ga0207645_10000185 Ga0207645_1000018527 261
99 3300025911 Ga0207654_10003819 Ga0207654_100038195 261
100 3300025911 Ga0207654_10007860 Ga0207654_100078605 261
101 3300025913 Ga0207695_10000064 Ga0207695_10000064164 261
102 3300025913 Ga0207695_10054856 Ga0207695_100548564 261
103 3300025914 Ga0207671_10002532 Ga0207671_100025326 261
104 3300025914 Ga0207671_10010536 Ga0207671_100105363 261
105 3300025914 Ga0207671_10053192 Ga0207671_100531922 261
106 3300025914 Ga0207671_10163925 Ga0207671_101639252 261
107 3300025924 Ga0207694_10014370 Ga0207694_100143705 261
108 3300025932 Ga0207690_10025883 Ga0207690_100258835 261
109 3300025933 Ga0207706_10000176 Ga0207706_1000017633 261
110 3300025938 Ga0207704_10000055 Ga0207704_1000005516 261
111 3300025940 Ga0207691_10129523 Ga0207691_101295232 261
112 3300025949 Ga0207667_10057264 Ga0207667_100572644 261
113 3300025949 Ga0207667_10095161 Ga0207667_100951613 261
114 3300025949 Ga0207667_10448674 Ga0207667_104486742 261
115 3300026023 Ga0207677_10014863 Ga0207677_100148635 261
116 3300026041 Ga0207639_10311850 Ga0207639_103118501 261
117 3300026089 Ga0207648_10000775 Ga0207648_100007758 261
118 3300026121 Ga0207683_10038319 Ga0207683_100383195 261
119 3300028379 Ga0268266_10000018 Ga0268266_10000018463 261
120 3300028786 Ga0307517_10010105 Ga0307517_100101057 261
121 3300028794 Ga0307515_10000181 Ga0307515_100001814 261
122 3300028794 Ga0307515_10052269 Ga0307515_100522695 261
123 3300033179 Ga0307507_10000509 Ga0307507_100005099 261
124 3300046471 Ga0495650_0000277 Ga0495650_0000277_95631_96434 261
125 3300046500 Ga0495596_0058756 Ga0495596_0058756_68_871 261
126 3300046507 Ga0495606_0043398 Ga0495606_0043398_559_1362 261
127 3300046507 Ga0495606_0051502 Ga0495606_0051502_1837_2643 261
128 3300046507 Ga0495606_0238178 Ga0495606_0238178_144_950 261
129 3300046512 Ga0495610_0019355 Ga0495610_0019355_2355_3158 261
130 3300046513 Ga0495616_0000819 Ga0495616_0000819_19871_20677 261
131 3300046518 Ga0495631_0002402 Ga0495631_0002402_4735_5538 261
132 3300046519 Ga0495632_0084534 Ga0495632_0084534_57_863 261
133 3300046524 Ga0495648_0089091 Ga0495648_0089091_303_1109 261
134 3300046530 Ga0495654_0109447 Ga0495654_0109447_384_1190 261
135 3300046538 Ga0495609_0004269 Ga0495609_0004269_3660_4466 261
136 3300046558 Ga0495633_0000101 Ga0495633_0000101_41247_42107 261
137 3300046558 Ga0495633_0003779 Ga0495633_0003779_2957_3760 261
138 3300046616 Ga0495668_0000112 Ga0495668_0000112_89890_90696 261
139 3300046660 Ga0495625_0002062 Ga0495625_0002062_2239_3048 261
140 3300046660 Ga0495625_0003446 Ga0495625_0003446_11710_12516 261
141 3300046660 Ga0495625_0015975 Ga0495625_0015975_1075_1881 261
142 3300046660 Ga0495625_0075299 Ga0495625_0075299_543_1352 261
143 3300046660 Ga0495625_0163923 Ga0495625_0163923_142_948 261
144 3300046665 Ga0495661_0080071 Ga0495661_0080071_179_985 261
145 3300046810 Ga0495660_0007575 Ga0495660_0007575_1940_2743 261
146 3300047320 Ga0495672_0043115 Ga0495672_0043115_1785_2591 261
147 3300047323 Ga0495683_0138930 Ga0495683_0138930_210_1013 261
148 3300047472 Ga0495686_0000154 Ga0495686_0000154_119467_120273 261
149 3300047472 Ga0495686_0011013 Ga0495686_0011013_958_1764 261
150 3300048089 Ga0495614_0063449 Ga0495614_0063449_348_1154 261
151 3300049459 Ga0495678_005124 Ga0495678_005124_2638_3444 261
152 3300049460 Ga0495682_0030034 Ga0495682_0030034_237_1043 261
153 3300050493 nmdc:mga0k408_347_c1 nmdc:mga0k408_347_c1_18401_19210 261
154 3300053088 Ga0500644_0000163 Ga0500644_0000163_10129_10929 261
155 3300053090 Ga0500646_0006019 Ga0500646_0006019_832_1740 261
156 3300053092 Ga0500583_0002602 Ga0500583_0002602_2913_3719 261
157 3300053108 Ga0500562_018798 Ga0500562_018798_243_1052 261
158 3300053109 Ga0500569_000081 Ga0500569_000081_8618_9526 261
159 3300053122 Ga0500608_000639 Ga0500608_000639_2106_2909 261
160 3300053125 Ga0500618_000238 Ga0500618_000238_40485_41291 261
161 3300053142 Ga0500577_0001764 Ga0500577_0001764_1368_2174 261
162 3300053151 Ga0500604_0002825 Ga0500604_0002825_223_1029 261
163 3300053153 Ga0500616_0013670 Ga0500616_0013670_1035_1943 261
164 3300053156 Ga0500622_0000034 Ga0500622_0000034_154702_155508 261
165 3300053158 Ga0500627_0142683 Ga0500627_0142683_175_981 261
166 3300053160 Ga0500633_0000132 Ga0500633_0000132_8791_9591 261
167 iso_pu_bacteria 2857613821 2857615322 261
168 iso_pu_bacteria 2884791551 2884795894 261
169 iso_pu_bacteria 2904419702 2904423997 261
170 3300003320 rootH2_10027601 rootH2_1002760116 262
171 3300005327 Ga0070658_10336412 Ga0070658_103364122 262
172 3300009093 Ga0105240_10956727 Ga0105240_109567271 262
173 3300013104 Ga0157370_10145429 Ga0157370_101454293 262
174 3300013104 Ga0157370_10651019 Ga0157370_106510191 262
175 3300026116 Ga0207674_10525750 Ga0207674_105257502 262
176 3300031251 Ga0265327_10000097 Ga0265327_10000097135 262
177 3300031616 Ga0307508_10000636 Ga0307508_1000063610 262
178 3300031730 Ga0307516_10000232 Ga0307516_1000023244 262
179 3300032004 Ga0307414_10075325 Ga0307414_100753251 262
180 3300046460 Ga0495638_0000005 Ga0495638_0000005_198798_199646 262
181 3300046471 Ga0495650_0028270 Ga0495650_0028270_1350_2159 262
182 3300046507 Ga0495606_0015789 Ga0495606_0015789_4835_5644 262
183 3300047472 Ga0495686_0090052 Ga0495686_0090052_708_1517 262
184 3300053105 Ga0500557_002601 Ga0500557_002601_874_1722 262
185 3300053153 Ga0500616_0000003 Ga0500616_0000003_735784_736641 262
186 iso_pu_bacteria 2643221600 2644008476 262
187 iso_pu_bacteria 2643221667 2644373219 262
188 iso_pu_bacteria 2643221716 2644642867 262
189 iso_pu_bacteria 2919191525 2919195574 262
190 iso_pu_bacteria 2929150217 2929153857 262
191 3300005288 Ga0065714_10027738 Ga0065714_100277382 263
192 3300005337 Ga0070682_100019954 Ga0070682_1000199542 263
193 3300013102 Ga0157371_10004489 Ga0157371_100044893 263
194 3300013104 Ga0157370_10006924 Ga0157370_100069243 263
195 3300013105 Ga0157369_10008455 Ga0157369_100084558 263
196 3300048919 Ga0496116_0000030 Ga0496116_0000030_64484_65296 263
197 3300048921 Ga0496118_0070734 Ga0496118_0070734_1464_2276 263
198 3300048927 Ga0496124_0032563 Ga0496124_0032563_3670_4482 263
199 3300048928 Ga0496125_0000538 Ga0496125_0000538_16486_17298 263
200 3300048929 Ga0496126_0054574 Ga0496126_0054574_1658_2470 263
201 3300048929 Ga0496126_0377117 Ga0496126_0377117_283_1095 263
202 iso_pu_bacteria 2522125168 2522552201 263
203 iso_pu_bacteria 2643221725 2644684979 263
204 iso_pu_bacteria 2802428842 2802653901 263
205 2162886007 SwRhRL2b_contig_3895340 SwRhRL2b_0721.00004730 264
206 3300003316 rootH1_10087663 rootH1_100876632 264
207 3300003322 rootL2_10046004 rootL2_100460041 264
208 3300003781 Ga0055536_1005176 Ga0055536_10051763 264
209 3300005262 Ga0065165_1000640 Ga0065165_100064037 264
210 3300005288 Ga0065714_10002550 Ga0065714_1000255034 264
211 3300005289 Ga0065704_10000227 Ga0065704_1000022753 264
212 3300013100 Ga0157373_10000002 Ga0157373_10000002320 264
213 3300013100 Ga0157373_10000105 Ga0157373_1000010511 264
214 3300013102 Ga0157371_10003048 Ga0157371_100030482 264
215 3300013104 Ga0157370_10001349 Ga0157370_100013494 264
216 3300013104 Ga0157370_10293001 Ga0157370_102930012 264
217 3300015261 Ga0182006_1002894 Ga0182006_10028945 264
218 3300025292 Ga0209676_1000921 Ga0209676_10009215 264
219 3300025302 Ga0207426_1058390 Ga0207426_10583902 264
220 3300031731 Ga0307405_10042923 Ga0307405_100429233 264
221 3300031911 Ga0307412_10000181 Ga0307412_1000018119 264
222 3300032004 Ga0307414_10002141 Ga0307414_100021418 264
223 3300046665 Ga0495661_0010967 Ga0495661_0010967_3221_4033 264
224 3300053093 Ga0500651_0001281 Ga0500651_0001281_385_1179 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

226

302

0.96

PF22200

ExsA_N

ExsA N-terminal regulatory domain

66

197

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.913 170 256
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9103 170 262
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9071 170 258
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8995 170 263
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.8994 170 263
ID Description Score Start End Superfamily
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9232 216 263 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9152 217 263 1.10.10.60
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9103 170 262 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9068 215 262 1.10.10.60
1xs9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9018 221 263 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1H4A265-F1-model_v4 AraC-type DNA-binding protein 0.9567 2 263 GO:0003700
GO:0043565
AF-A0A2T7BD47-F1-model_v4 AraC family transcriptional regulator 0.9545 20 263 GO:0003700
GO:0043565
AF-A0A562MB17-F1-model_v4 AraC-like DNA-binding protein 0.9472 5 263 GO:0003700
GO:0043565
AF-A0A5B8W524-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9454 2 262 GO:0003700
GO:0043565
AF-A0A511XXL7-F1-model_v4 deleted 0.9432 1 263

Feature Viewer

pLDDT pTM Quality
90.62 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map