F337190

General Info

Members Datasets Scaffolds Average Seq Length
224 152 209 213

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0001178|Ga0501070_0001178_12426_13196
Length 256
Sequence MFTGIIEELGEIVDWQASSDAARLTVRAPLAVSDAAHGDSISVSGVCLTVVDRGEDWFTADVMAETIRMSTLTGPKPGDRVNIERAAKLGDRLGGHIVQGHIDGTAEVLAITEGSAWRVVRFSLASELAGLVARKGSIALDGVSLTVSAVGRDESATGIADWFEVSLIPETLAVTTLGLKSPGDLVNVETDILARHVERLVSIRGSADASPLLNRRGQTDPATSLGDVGSEVAGSVGIFGHDLRTDILETNERSKP

Samples

Sample ID Description Type Environment
1 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
2 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
3 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
4 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
5 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
6 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
7 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
8 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
9 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
10 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
11 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
12 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
13 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
14 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
103 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
106 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
143 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
144 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
145 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
146 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
149 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
152 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.45
Isolates 6.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 10.27
Nodule 0
Rhizoplane 4.91
Rhizosphere 72.32
Stem 0
Stem Tuber 0
Unclassified 12.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000044 3300005327 Bacteria 131465
2 Ga0070658_10006173 3300005327 Bacteria 9716
3 Ga0070658_10060266 3300005327 Bacteria 3090
4 Ga0070658_10296744 3300005327 Bacteria 1378
5 Ga0070683_100553815 3300005329 Bacteria 1100
6 Ga0068868_100041249 3300005338 Bacteria 3595
7 Ga0070660_100022276 3300005339 Bacteria 4682
8 Ga0070675_100893812 3300005354 Bacteria 814
9 Ga0070671_100689792 3300005355 Bacteria 885
10 Ga0070659_100000308 3300005366 Bacteria 38002
11 Ga0070659_100304875 3300005366 Bacteria 1329
12 Ga0070667_100006716 3300005367 Bacteria 9560
13 Ga0070705_100144576 3300005440 Bacteria 1570
14 Ga0070708_100075493 3300005445 Bacteria 3043
15 Ga0070681_10055322 3300005458 Bacteria 3951
16 Ga0070685_10334898 3300005466 Bacteria 1030
17 Ga0070707_100077389 3300005468 Bacteria 3210
18 Ga0070679_100343996 3300005530 Bacteria 1439
19 Ga0068853_100247839 3300005539 Bacteria 1634
20 Ga0070695_100059279 3300005545 Bacteria 2477
21 Ga0070696_100688595 3300005546 Bacteria 832
22 Ga0070704_100125954 3300005549 Bacteria 1976
23 Ga0068855_100006470 3300005563 Bacteria 14247
24 Ga0068855_100033737 3300005563 Bacteria 6106
25 Ga0068857_100000016 3300005577 Bacteria 97647
26 Ga0068857_100323998 3300005577 Bacteria 1423
27 Ga0068854_100099931 3300005578 Bacteria 2174
28 Ga0068856_100134810 3300005614 Bacteria 2475
29 Ga0068852_100069434 3300005616 Bacteria 3088
30 Ga0068852_100073012 3300005616 Bacteria 3017
31 Ga0068852_101584645 3300005616 Bacteria 677
32 Ga0068864_100152551 3300005618 Bacteria 2094
33 Ga0068851_10000001 3300005834 Bacteria 495512
34 Ga0068863_100190493 3300005841 Bacteria 1971
35 Ga0068863_100231712 3300005841 Bacteria 1782
36 Ga0068858_100000016 3300005842 Bacteria 193130
37 Ga0068862_100467865 3300005844 Bacteria 1191
38 Ga0081539_10243382 3300005985 Bacteria 804
39 Ga0075363_100024882 3300006048 Bacteria 3047
40 Ga0075363_100155670 3300006048 Bacteria 1292
41 Ga0075364_10143794 3300006051 Bacteria 1605
42 Ga0105240_10017581 3300009093 Bacteria 9634
43 Ga0105240_10640152 3300009093 Bacteria 1167
44 Ga0105245_10023956 3300009098 Bacteria 5358
45 Ga0105245_10643092 3300009098 Bacteria 1090
46 Ga0105245_10969003 3300009098 Bacteria 894
47 Ga0105241_10002009 3300009174 Bacteria 15393
48 Ga0105241_10545410 3300009174 Bacteria 1040
49 Ga0105248_10002772 3300009177 Bacteria 19481
50 Ga0105248_10719231 3300009177 Bacteria 1127
51 Ga0105237_10001088 3300009545 Bacteria 36367
52 Ga0105237_10003430 3300009545 Bacteria 18830
53 Ga0105237_10116724 3300009545 Bacteria 2663
54 Ga0105237_10311411 3300009545 Bacteria 1578
55 Ga0105238_10030302 3300009551 Bacteria 5506
56 Ga0105238_10178380 3300009551 Bacteria 2101
57 Ga0105239_10421239 3300010375 Bacteria 1513
58 Ga0157370_10016514 3300013104 Bacteria 7470
59 Ga0157369_10005120 3300013105 Bacteria 15350
60 Ga0157369_10220907 3300013105 Bacteria 1983
61 Ga0157369_10248662 3300013105 Bacteria 1856
62 Ga0157374_10062773 3300013296 Bacteria 3484
63 Ga0157378_10462442 3300013297 Unclassified 1261
64 Ga0163163_10236159 3300014325 Bacteria 1877
65 Ga0157379_10081771 3300014968 Bacteria 2894
66 Ga0157376_10223248 3300014969 Bacteria 1746
67 Ga0206355_1552862 3300020076 Bacteria 3013
68 Ga0213876_10019773 3300021384 Bacteria 3556
69 Ga0207656_10000002 3300025321 Bacteria 792178
70 Ga0207653_10065636 3300025885 Bacteria 1232
71 Ga0207647_10423793 3300025904 Bacteria 748
72 Ga0207705_10000001 3300025909 Bacteria 2061880
73 Ga0207705_10084780 3300025909 Bacteria 2314
74 Ga0207705_10109523 3300025909 Bacteria 2039
75 Ga0207705_10178653 3300025909 Bacteria 1601
76 Ga0207705_10430389 3300025909 Bacteria 1022
77 Ga0207654_10000001 3300025911 Bacteria 1816198
78 Ga0207654_10387436 3300025911 Bacteria 969
79 Ga0207707_10072476 3300025912 Bacteria 3002
80 Ga0207695_10005723 3300025913 Bacteria 16379
81 Ga0207671_10000002 3300025914 Bacteria 1144816
82 Ga0207671_10065066 3300025914 Bacteria 2711
83 Ga0207671_10155564 3300025914 Bacteria 1768
84 Ga0207660_10393756 3300025917 Bacteria 1115
85 Ga0207660_10500156 3300025917 Bacteria 986
86 Ga0207657_10007047 3300025919 Bacteria 11552
87 Ga0207649_10267209 3300025920 Bacteria 1238
88 Ga0207652_10096513 3300025921 Bacteria 2604
89 Ga0207646_10074306 3300025922 Bacteria 3036
90 Ga0207646_10584528 3300025922 Bacteria 1003
91 Ga0207694_10000022 3300025924 Bacteria 288900
92 Ga0207694_10060928 3300025924 Bacteria 2937
93 Ga0207690_10007435 3300025932 Bacteria 6502
94 Ga0207704_10983482 3300025938 Bacteria 713
95 Ga0207711_10002845 3300025941 Bacteria 15187
96 Ga0207711_10775003 3300025941 Bacteria 894
97 Ga0207667_10000571 3300025949 Bacteria 48073
98 Ga0207667_10029971 3300025949 Bacteria 5893
99 Ga0207667_10112464 3300025949 Bacteria 2808
100 Ga0207667_10338166 3300025949 Bacteria 1536
101 Ga0207640_10092875 3300025981 Bacteria 2095
102 Ga0207658_10030457 3300025986 Bacteria 3820
103 Ga0207677_10363777 3300026023 Bacteria 1216
104 Ga0207703_10000075 3300026035 Bacteria 118422
105 Ga0207639_10056517 3300026041 Bacteria 3008
106 Ga0207639_10228011 3300026041 Bacteria 1613
107 Ga0207678_10065890 3300026067 Bacteria 3110
108 Ga0207702_10070460 3300026078 Bacteria 3007
109 Ga0207641_10021123 3300026088 Bacteria 5351
110 Ga0207674_10009115 3300026116 Bacteria 11389
111 Ga0207698_10004573 3300026142 Bacteria 8446
112 Ga0207698_10014785 3300026142 Bacteria 5202
113 Ga0207698_10278491 3300026142 Bacteria 1546
114 Ga0207698_10321079 3300026142 Bacteria 1450
115 Ga0307511_10272034 3300030521 Bacteria 792
116 Ga0307514_10029647 3300031649 Bacteria 4397
117 Ga0316576_10135774 3300031727 Bacteria 1851
118 Ga0316576_10158204 3300031727 Bacteria 1708
119 Ga0316577_10247730 3300031733 Bacteria 1008
120 Ga0307416_100317893 3300032002 Bacteria 1557
121 Ga0307416_101245577 3300032002 Bacteria 850
122 Ga0316574_0006496 3300035398 Bacteria 6323
123 Ga0316574_0040546 3300035398 Bacteria 2868
124 Ga0316574_0159902 3300035398 Bacteria 1451
125 Ga0316582_0583982 3300036647 Bacteria 769
126 Ga0316584_0000598 3300036712 Bacteria 19526
127 Ga0316584_0078786 3300036712 Unclassified 2468
128 Ga0395900_0700739 3300037418 Bacteria 946
129 Ga0395898_0604949 3300037466 Bacteria 1039
130 Ga0395898_0779811 3300037466 Bacteria 897
131 Ga0395901_0170297 3300038443 Bacteria 2285
132 Ga0436365_1534867 3300039437 Bacteria 1017
133 Ga0439447_036498 3300041407 Bacteria 1214
134 Ga0451789_0953625 3300041443 Bacteria 1646
135 Ga0451793_0203052 3300041452 Bacteria 2733
136 Ga0451793_0825779 3300041452 Bacteria 5789
137 Ga0439452_006263 3300042010 Bacteria 3738
138 Ga0439457_043289 3300042014 Bacteria 1005
139 Ga0466965_0000008 3300044683 Bacteria 131465
140 Ga0466965_0049662 3300044683 Bacteria 2080
141 Ga0466965_0068551 3300044683 Bacteria 1781
142 Ga0466963_0032230 3300044694 Bacteria 3392
143 Ga0466970_0010932 3300044765 Bacteria 4616
144 Ga0466957_0000039 3300044842 Bacteria 47226
145 Ga0466960_0133925 3300044901 Bacteria 1311
146 Ga0495650_0001841 3300046471 Bacteria 18974
147 Ga0495686_0072029 3300047472 Bacteria 2126
148 Ga0496102_0244566 3300048905 Bacteria 1692
149 Ga0496102_0510812 3300048905 Bacteria 1124
150 Ga0496104_0242110 3300048907 Bacteria 1716
151 Ga0496105_0053893 3300048908 Bacteria 3322
152 Ga0496108_0217949 3300048911 Bacteria 1658
153 Ga0496109_0311602 3300048912 Bacteria 1485
154 Ga0496110_0059627 3300048913 Bacteria 3365
155 Ga0496115_0014714 3300048918 Bacteria 5927
156 Ga0496117_0003752 3300048920 Bacteria 17397
157 Ga0496117_0006740 3300048920 Bacteria 11469
158 Ga0496118_0000243 3300048921 Bacteria 96384
159 Ga0496118_0050694 3300048921 Bacteria 3182
160 Ga0496119_0005358 3300048922 Bacteria 12328
161 Ga0496119_0012349 3300048922 Bacteria 6946
162 Ga0496119_0289115 3300048922 Bacteria 812
163 Ga0496120_0000899 3300048923 Bacteria 41719
164 Ga0496120_0017535 3300048923 Bacteria 4639
165 Ga0496120_0040659 3300048923 Bacteria 2730
166 Ga0496120_0054210 3300048923 Bacteria 2274
167 Ga0496121_0238772 3300048924 Bacteria 1268
168 Ga0496122_0002238 3300048925 Bacteria 28126
169 Ga0496122_0047629 3300048925 Bacteria 3307
170 Ga0496123_0028532 3300048926 Bacteria 4129
171 Ga0496123_0159381 3300048926 Bacteria 1205
172 Ga0496124_0000040 3300048927 Bacteria 307061
173 Ga0496124_0067514 3300048927 Bacteria 2975
174 Ga0496124_0082059 3300048927 Bacteria 2647
175 Ga0496124_0252464 3300048927 Bacteria 1303
176 Ga0496126_0000565 3300048929 Bacteria 70942
177 Ga0501033_0045317 3300049570 Bacteria 3273
178 Ga0501034_0022357 3300049571 Bacteria 6445
179 Ga0501034_0030519 3300049571 Bacteria 5479
180 Ga0501034_0053524 3300049571 Bacteria 4063
181 Ga0501034_0308423 3300049571 Bacteria 1518
182 Ga0501038_0216661 3300049574 Bacteria 1529
183 Ga0501038_0277485 3300049574 Bacteria 1320
184 Ga0501043_0111506 3300049579 Bacteria 2148
185 Ga0501043_0425309 3300049579 Bacteria 1001
186 Ga0501070_0001178 3300049586 Bacteria 23346
187 Ga0501071_0000949 3300049587 Bacteria 15771
188 Ga0501072_0216492 3300049588 Bacteria 1526
189 Ga0501044_0018844 3300049823 Bacteria 7390
190 nmdc:mga03n38_63311_c1 3300050490 Bacteria 1690
191 nmdc:mga00v17_106262_c1 3300050491 Bacteria 1777
192 nmdc:mga00v17_182175_c1 3300050491 Bacteria 1355
193 nmdc:mga0yw44_22100_c1 3300050492 Bacteria 3560
194 nmdc:mga06z11_106904_c1 3300050494 Bacteria 1543
195 nmdc:mga06z11_563015_c1 3300050494 Bacteria 692
196 Ga0500635_0000004 3300053080 Bacteria 210675
197 Ga0500635_0044740 3300053080 Bacteria 1495
198 Ga0500635_0097271 3300053080 Bacteria 1078
199 Ga0500651_0001679 3300053093 Bacteria 11307
200 Ga0500650_0074129 3300053098 Bacteria 1591
201 Ga0500556_0000001 3300053104 Bacteria 1135060
202 Ga0500559_0015625 3300053136 Bacteria 3205
203 Ga0500568_0000003 3300053139 Bacteria 863587
204 Ga0500568_0011502 3300053139 Bacteria 4101
205 Ga0500577_0005114 3300053142 Bacteria 3511
206 Ga0500590_003298 3300053148 Bacteria 7408
207 Ga0500616_0000040 3300053153 Bacteria 367604
208 Ga0500616_0000109 3300053153 Bacteria 152604
209 Ga0500645_047641 3300053730 Bacteria 1256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0111506 Ga0501043_0111506_1503_2138 167
2 3300048905 Ga0496102_0510812 Ga0496102_0510812_71_646 187
3 3300050494 nmdc:mga06z11_563015_c1 nmdc:mga06z11_563015_c1_65_640 187
4 3300044765 Ga0466970_0010932 Ga0466970_0010932_2396_3037 188
5 3300048925 Ga0496122_0047629 Ga0496122_0047629_1577_2230 191
6 3300048927 Ga0496124_0067514 Ga0496124_0067514_2144_2797 191
7 3300048927 Ga0496124_0082059 Ga0496124_0082059_1807_2460 191
8 3300005354 Ga0070675_100893812 Ga0070675_1008938121 194
9 3300048920 Ga0496117_0003752 Ga0496117_0003752_1534_2163 194
10 3300048921 Ga0496118_0000243 Ga0496118_0000243_8888_9517 194
11 3300048923 Ga0496120_0054210 Ga0496120_0054210_1517_2146 194
12 3300048927 Ga0496124_0000040 Ga0496124_0000040_82171_82800 194
13 3300005546 Ga0070696_100688595 Ga0070696_1006885951 196
14 3300005616 Ga0068852_101584645 Ga0068852_1015846451 196
15 3300009098 Ga0105245_10643092 Ga0105245_106430922 196
16 3300048905 Ga0496102_0244566 Ga0496102_0244566_795_1388 196
17 3300048911 Ga0496108_0217949 Ga0496108_0217949_967_1560 196
18 3300048912 Ga0496109_0311602 Ga0496109_0311602_711_1304 196
19 3300048913 Ga0496110_0059627 Ga0496110_0059627_146_739 196
20 3300049588 Ga0501072_0216492 Ga0501072_0216492_384_1001 196
21 3300053080 Ga0500635_0000004 Ga0500635_0000004_45217_45909 196
22 3300006048 Ga0075363_100155670 Ga0075363_1001556702 197
23 3300021384 Ga0213876_10019773 Ga0213876_100197732 198
24 3300039437 Ga0436365_1534867 Ga0436365_1534867_68_682 198
25 3300005440 Ga0070705_100144576 Ga0070705_1001445762 199
26 3300032002 Ga0307416_100317893 Ga0307416_1003178932 199
27 3300041407 Ga0439447_036498 Ga0439447_036498_41_658 199
28 3300042010 Ga0439452_006263 Ga0439452_006263_517_1119 199
29 3300044901 Ga0466960_0133925 Ga0466960_0133925_411_1013 199
30 3300005985 Ga0081539_10243382 Ga0081539_102433822 200
31 3300009093 Ga0105240_10640152 Ga0105240_106401522 200
32 3300009545 Ga0105237_10003430 Ga0105237_100034303 200
33 3300013105 Ga0157369_10220907 Ga0157369_102209072 200
34 3300025917 Ga0207660_10393756 Ga0207660_103937562 200
35 iso_pu_bacteria 2964326757 2964327431 200
36 3300013297 Ga0157378_10462442 Ga0157378_104624422 201
37 3300025922 Ga0207646_10584528 Ga0207646_105845282 201
38 3300037466 Ga0395898_0779811 Ga0395898_0779811_72_689 201
39 iso_pu_bacteria 8057345674 8057345869 201
40 3300005844 Ga0068862_100467865 Ga0068862_1004678652 202
41 3300025917 Ga0207660_10500156 Ga0207660_105001561 202
42 3300044842 Ga0466957_0000039 Ga0466957_0000039_35948_36604 202
43 3300048922 Ga0496119_0289115 Ga0496119_0289115_88_768 202
44 3300048927 Ga0496124_0252464 Ga0496124_0252464_20_721 202
45 iso_pu_bacteria 2852643534 2852646361 202
46 iso_pu_bacteria 2862993130 2862994662 202
47 3300006048 Ga0075363_100024882 Ga0075363_1000248822 203
48 3300006051 Ga0075364_10143794 Ga0075364_101437942 203
49 3300026142 Ga0207698_10278491 Ga0207698_102784912 203
50 3300037418 Ga0395900_0700739 Ga0395900_0700739_64_684 203
51 3300037466 Ga0395898_0604949 Ga0395898_0604949_342_962 203
52 3300038443 Ga0395901_0170297 Ga0395901_0170297_71_691 203
53 3300050490 nmdc:mga03n38_63311_c1 nmdc:mga03n38_63311_c1_841_1464 203
54 3300050491 nmdc:mga00v17_106262_c1 nmdc:mga00v17_106262_c1_663_1286 203
55 3300050491 nmdc:mga00v17_182175_c1 nmdc:mga00v17_182175_c1_375_998 203
56 3300050492 nmdc:mga0yw44_22100_c1 nmdc:mga0yw44_22100_c1_2576_3199 203
57 3300050494 nmdc:mga06z11_106904_c1 nmdc:mga06z11_106904_c1_496_1119 203
58 iso_pu_bacteria 2751185788 2753302804 203
59 iso_pu_bacteria 2904501621 2904504089 203
60 iso_pu_bacteria 2908674828 2908677053 203
61 iso_pu_bacteria 2909074476 2909076768 203
62 iso_pu_bacteria 2919039151 2919039380 203
63 iso_pu_bacteria 2928104781 2928105076 203
64 iso_pu_bacteria 2928500415 2928502196 203
65 3300049571 Ga0501034_0022357 Ga0501034_0022357_2033_2647 204
66 3300049571 Ga0501034_0308423 Ga0501034_0308423_273_887 204
67 3300053153 Ga0500616_0000109 Ga0500616_0000109_58042_58656 204
68 3300005530 Ga0070679_100343996 Ga0070679_1003439963 205
69 3300009174 Ga0105241_10545410 Ga0105241_105454101 205
70 3300025921 Ga0207652_10096513 Ga0207652_100965133 205
71 3300025938 Ga0207704_10983482 Ga0207704_109834821 205
72 3300025949 Ga0207667_10338166 Ga0207667_103381662 205
73 3300041443 Ga0451789_0953625 Ga0451789_0953625_388_1023 205
74 3300041452 Ga0451793_0825779 Ga0451793_0825779_1658_2293 205
75 3300048925 Ga0496122_0002238 Ga0496122_0002238_5366_5983 205
76 3300048926 Ga0496123_0028532 Ga0496123_0028532_821_1438 205
77 3300053153 Ga0500616_0000040 Ga0500616_0000040_46802_47419 205
78 iso_pu_bacteria 2904430863 2904431570 205
79 iso_pu_bacteria 2919042368 2919042766 205
80 iso_pu_bacteria 2984551494 2984554953 205
81 3300005468 Ga0070707_100077389 Ga0070707_1000773892 206
82 3300005841 Ga0068863_100190493 Ga0068863_1001904932 206
83 3300009177 Ga0105248_10002772 Ga0105248_100027728 206
84 3300025922 Ga0207646_10074306 Ga0207646_100743062 206
85 3300031727 Ga0316576_10158204 Ga0316576_101582041 206
86 3300035398 Ga0316574_0159902 Ga0316574_0159902_86_736 206
87 3300036712 Ga0316584_0000598 Ga0316584_0000598_9210_9860 206
88 3300041452 Ga0451793_0203052 Ga0451793_0203052_1371_2030 206
89 3300042014 Ga0439457_043289 Ga0439457_043289_103_738 206
90 3300044694 Ga0466963_0032230 Ga0466963_0032230_1829_2449 206
91 3300048926 Ga0496123_0159381 Ga0496123_0159381_319_939 206
92 3300053098 Ga0500650_0074129 Ga0500650_0074129_654_1274 206
93 3300053142 Ga0500577_0005114 Ga0500577_0005114_486_1106 206
94 3300005329 Ga0070683_100553815 Ga0070683_1005538152 207
95 3300005445 Ga0070708_100075493 Ga0070708_1000754932 207
96 3300005458 Ga0070681_10055322 Ga0070681_100553225 207
97 3300005545 Ga0070695_100059279 Ga0070695_1000592792 207
98 3300005549 Ga0070704_100125954 Ga0070704_1001259542 207
99 3300009545 Ga0105237_10116724 Ga0105237_101167242 207
100 3300013105 Ga0157369_10248662 Ga0157369_102486622 207
101 3300013296 Ga0157374_10062773 Ga0157374_100627734 207
102 3300025885 Ga0207653_10065636 Ga0207653_100656362 207
103 3300025912 Ga0207707_10072476 Ga0207707_100724762 207
104 3300025914 Ga0207671_10065066 Ga0207671_100650663 207
105 3300025941 Ga0207711_10002845 Ga0207711_100028452 207
106 3300026088 Ga0207641_10021123 Ga0207641_100211232 207
107 3300031727 Ga0316576_10135774 Ga0316576_101357742 207
108 3300031733 Ga0316577_10247730 Ga0316577_102477302 207
109 3300032002 Ga0307416_101245577 Ga0307416_1012455772 207
110 3300035398 Ga0316574_0006496 Ga0316574_0006496_316_951 207
111 3300035398 Ga0316574_0040546 Ga0316574_0040546_1801_2436 207
112 3300036647 Ga0316582_0583982 Ga0316582_0583982_14_649 207
113 3300036712 Ga0316584_0078786 Ga0316584_0078786_754_1389 207
114 3300047472 Ga0495686_0072029 Ga0495686_0072029_715_1344 207
115 3300048907 Ga0496104_0242110 Ga0496104_0242110_193_885 207
116 3300048922 Ga0496119_0012349 Ga0496119_0012349_283_954 207
117 3300048923 Ga0496120_0040659 Ga0496120_0040659_216_887 207
118 3300049574 Ga0501038_0216661 Ga0501038_0216661_174_797 207
119 3300053080 Ga0500635_0097271 Ga0500635_0097271_158_823 207
120 3300053104 Ga0500556_0000001 Ga0500556_0000001_1099905_1100534 207
121 3300053136 Ga0500559_0015625 Ga0500559_0015625_1153_1809 207
122 3300053139 Ga0500568_0000003 Ga0500568_0000003_525438_526067 207
123 3300053139 Ga0500568_0011502 Ga0500568_0011502_3008_3640 207
124 iso_pu_bacteria 2966924647 2966925489 207
125 3300048908 Ga0496105_0053893 Ga0496105_0053893_818_1471 208
126 3300048918 Ga0496115_0014714 Ga0496115_0014714_1534_2187 208
127 3300048924 Ga0496121_0238772 Ga0496121_0238772_555_1217 209
128 3300048929 Ga0496126_0000565 Ga0496126_0000565_35245_35898 210
129 3300013105 Ga0157369_10005120 Ga0157369_100051206 211
130 3300044683 Ga0466965_0049662 Ga0466965_0049662_963_1667 211
131 3300005327 Ga0070658_10000044 Ga0070658_1000004449 212
132 3300005327 Ga0070658_10006173 Ga0070658_100061739 212
133 3300005327 Ga0070658_10060266 Ga0070658_100602662 212
134 3300005327 Ga0070658_10296744 Ga0070658_102967442 212
135 3300005338 Ga0068868_100041249 Ga0068868_1000412493 212
136 3300005339 Ga0070660_100022276 Ga0070660_1000222766 212
137 3300005355 Ga0070671_100689792 Ga0070671_1006897922 212
138 3300005366 Ga0070659_100000308 Ga0070659_10000030828 212
139 3300005366 Ga0070659_100304875 Ga0070659_1003048751 212
140 3300005367 Ga0070667_100006716 Ga0070667_1000067168 212
141 3300005466 Ga0070685_10334898 Ga0070685_103348982 212
142 3300005539 Ga0068853_100247839 Ga0068853_1002478392 212
143 3300005563 Ga0068855_100006470 Ga0068855_1000064708 212
144 3300005563 Ga0068855_100033737 Ga0068855_1000337375 212
145 3300005577 Ga0068857_100000016 Ga0068857_10000001686 212
146 3300005577 Ga0068857_100323998 Ga0068857_1003239982 212
147 3300005578 Ga0068854_100099931 Ga0068854_1000999312 212
148 3300005614 Ga0068856_100134810 Ga0068856_1001348103 212
149 3300005616 Ga0068852_100069434 Ga0068852_1000694343 212
150 3300005616 Ga0068852_100073012 Ga0068852_1000730122 212
151 3300005618 Ga0068864_100152551 Ga0068864_1001525512 212
152 3300005834 Ga0068851_10000001 Ga0068851_10000001182 212
153 3300005841 Ga0068863_100231712 Ga0068863_1002317121 212
154 3300005842 Ga0068858_100000016 Ga0068858_100000016151 212
155 3300009093 Ga0105240_10017581 Ga0105240_100175819 212
156 3300009098 Ga0105245_10023956 Ga0105245_100239566 212
157 3300009098 Ga0105245_10969003 Ga0105245_109690032 212
158 3300009174 Ga0105241_10002009 Ga0105241_1000200918 212
159 3300009177 Ga0105248_10719231 Ga0105248_107192312 212
160 3300009545 Ga0105237_10001088 Ga0105237_1000108820 212
161 3300009545 Ga0105237_10311411 Ga0105237_103114112 212
162 3300009551 Ga0105238_10030302 Ga0105238_100303022 212
163 3300009551 Ga0105238_10178380 Ga0105238_101783802 212
164 3300010375 Ga0105239_10421239 Ga0105239_104212392 212
165 3300013104 Ga0157370_10016514 Ga0157370_100165145 212
166 3300014325 Ga0163163_10236159 Ga0163163_102361592 212
167 3300014968 Ga0157379_10081771 Ga0157379_100817713 212
168 3300014969 Ga0157376_10223248 Ga0157376_102232482 212
169 3300020076 Ga0206355_1552862 Ga0206355_15528622 212
170 3300025321 Ga0207656_10000002 Ga0207656_10000002745 212
171 3300025904 Ga0207647_10423793 Ga0207647_104237931 212
172 3300025909 Ga0207705_10000001 Ga0207705_100000011500 212
173 3300025909 Ga0207705_10084780 Ga0207705_100847802 212
174 3300025909 Ga0207705_10109523 Ga0207705_101095232 212
175 3300025909 Ga0207705_10178653 Ga0207705_101786532 212
176 3300025909 Ga0207705_10430389 Ga0207705_104303892 212
177 3300025911 Ga0207654_10000001 Ga0207654_100000011131 212
178 3300025911 Ga0207654_10387436 Ga0207654_103874362 212
179 3300025913 Ga0207695_10005723 Ga0207695_1000572310 212
180 3300025914 Ga0207671_10000002 Ga0207671_100000021039 212
181 3300025914 Ga0207671_10155564 Ga0207671_101555642 212
182 3300025919 Ga0207657_10007047 Ga0207657_1000704711 212
183 3300025920 Ga0207649_10267209 Ga0207649_102672092 212
184 3300025924 Ga0207694_10000022 Ga0207694_10000022135 212
185 3300025924 Ga0207694_10060928 Ga0207694_100609282 212
186 3300025932 Ga0207690_10007435 Ga0207690_100074355 212
187 3300025941 Ga0207711_10775003 Ga0207711_107750031 212
188 3300025949 Ga0207667_10000571 Ga0207667_1000057116 212
189 3300025949 Ga0207667_10029971 Ga0207667_100299716 212
190 3300025949 Ga0207667_10112464 Ga0207667_101124642 212
191 3300025981 Ga0207640_10092875 Ga0207640_100928752 212
192 3300025986 Ga0207658_10030457 Ga0207658_100304572 212
193 3300026023 Ga0207677_10363777 Ga0207677_103637771 212
194 3300026035 Ga0207703_10000075 Ga0207703_1000007587 212
195 3300026041 Ga0207639_10056517 Ga0207639_100565172 212
196 3300026041 Ga0207639_10228011 Ga0207639_102280112 212
197 3300026067 Ga0207678_10065890 Ga0207678_100658904 212
198 3300026078 Ga0207702_10070460 Ga0207702_100704602 212
199 3300026116 Ga0207674_10009115 Ga0207674_100091152 212
200 3300026142 Ga0207698_10004573 Ga0207698_100045738 212
201 3300026142 Ga0207698_10014785 Ga0207698_100147853 212
202 3300026142 Ga0207698_10321079 Ga0207698_103210792 212
203 3300030521 Ga0307511_10272034 Ga0307511_102720342 212
204 3300031649 Ga0307514_10029647 Ga0307514_100296474 212
205 3300044683 Ga0466965_0000008 Ga0466965_0000008_114812_115492 212
206 3300044683 Ga0466965_0068551 Ga0466965_0068551_803_1468 212
207 3300046471 Ga0495650_0001841 Ga0495650_0001841_2070_2717 212
208 3300048920 Ga0496117_0006740 Ga0496117_0006740_845_1501 212
209 3300048921 Ga0496118_0050694 Ga0496118_0050694_1401_2057 212
210 3300048922 Ga0496119_0005358 Ga0496119_0005358_11650_12303 212
211 3300048923 Ga0496120_0000899 Ga0496120_0000899_34963_35616 212
212 3300048923 Ga0496120_0017535 Ga0496120_0017535_824_1477 212
213 3300049570 Ga0501033_0045317 Ga0501033_0045317_214_864 212
214 3300049571 Ga0501034_0030519 Ga0501034_0030519_713_1483 212
215 3300049571 Ga0501034_0053524 Ga0501034_0053524_3033_3683 212
216 3300049574 Ga0501038_0277485 Ga0501038_0277485_146_796 212
217 3300049579 Ga0501043_0425309 Ga0501043_0425309_248_898 212
218 3300049586 Ga0501070_0001178 Ga0501070_0001178_12426_13196 212
219 3300049587 Ga0501071_0000949 Ga0501071_0000949_3644_4414 212
220 3300049823 Ga0501044_0018844 Ga0501044_0018844_3370_4020 212
221 3300053080 Ga0500635_0044740 Ga0500635_0044740_756_1403 212
222 3300053093 Ga0500651_0001679 Ga0500651_0001679_1064_1711 212
223 3300053148 Ga0500590_003298 Ga0500590_003298_4572_5228 212
224 3300053730 Ga0500645_047641 Ga0500645_047641_429_1088 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

3

86

0.95

PF00677

Lum_binding

Lumazine binding domain

99

191

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9672 1 199
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9646 1 200
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9574 1 199
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.955 1 200
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9525 1 86
ID Description Score Start End Superfamily
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9811 1 88 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9746 1 87 2.40.30.20
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9703 1 88 2.40.30.20
af_P9WK35_102_200_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9689 101 200 2.40.30.20
af_P0AFU8_1_89_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9616 1 88 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A517YJA9-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9856 2 200 GO:0004746
GO:0009231
AF-A0A852SU08-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9839 1 200 GO:0004746
GO:0009231
AF-A0A5C6AW56-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9836 1 199 GO:0004746
GO:0009231
AF-F9EGA6-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9831 1 200 GO:0004746
GO:0009231
AF-A0A1L7CY51-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.983 1 198 GO:0004746
GO:0009231

Feature Viewer

pLDDT pTM Quality
91.83 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map