F336723

General Info

Members Datasets Scaffolds Average Seq Length
224 175 446 135

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10346028|Ga0157372_103460283
Length 146
Sequence MGEMTPPLAAETEVLRQAYAALNRNDIPAFVSVFDPQIERIEPADFPGAGSYHGLEAVKAHLSKARATWAEGSCQPEGFIVAGDRVIVFIHVHVRLKHETEWRQGHIVDVYTFRNGKAIQFRTFADKGEALKWAGVEASDTIGSNR

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 2.68
Rhizosphere 92.86
Stem 0
Stem Tuber 0
Unclassified 12.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10346028 3300013307 Unclassified 1732
2 rootH2_10120869 3300003320 Bacteria 2974
3 rootH1_10158461 3300003323 Bacteria 1128
4 Ga0065165_1008551 3300005262 Bacteria 4762
5 Ga0070658_10009852 3300005327 Bacteria 7677
6 Ga0070683_100851423 3300005329 Unclassified 874
7 Ga0070666_10823131 3300005335 Bacteria 684
8 Ga0070689_100185581 3300005340 Bacteria 1691
9 Ga0070687_100060867 3300005343 Unclassified 1993
10 Ga0070669_100133125 3300005353 Bacteria 1910
11 Ga0070669_101332302 3300005353 Bacteria 622
12 Ga0070675_101520369 3300005354 Bacteria 617
13 Ga0070671_100489013 3300005355 Bacteria 1058
14 Ga0070673_100472788 3300005364 Bacteria 1130
15 Ga0070688_101123048 3300005365 Unclassified 629
16 Ga0070659_100086226 3300005366 Bacteria 2512
17 Ga0070667_100849718 3300005367 Unclassified 848
18 Ga0070701_10118339 3300005438 Bacteria 1489
19 Ga0070694_101062268 3300005444 Bacteria 674
20 Ga0070708_100930341 3300005445 Bacteria 816
21 Ga0070681_11259460 3300005458 Unclassified 662
22 Ga0068867_100058301 3300005459 Bacteria 2861
23 Ga0070679_100175600 3300005530 Bacteria 2115
24 Ga0070684_100115637 3300005535 Bacteria 2409
25 Ga0070684_100308956 3300005535 Bacteria 1452
26 Ga0070672_100318421 3300005543 Bacteria 1322
27 Ga0070665_100111097 3300005548 Bacteria 2743
28 Ga0070665_100235053 3300005548 Bacteria 1833
29 Ga0070704_101417987 3300005549 Bacteria 637
30 Ga0068855_100043684 3300005563 Bacteria 5307
31 Ga0070664_100007453 3300005564 Bacteria 8835
32 Ga0068857_100018116 3300005577 Bacteria 6177
33 Ga0068854_100708380 3300005578 Bacteria 870
34 Ga0068856_100227341 3300005614 Bacteria 1881
35 Ga0068852_100264668 3300005616 Bacteria 1652
36 Ga0068859_100243436 3300005617 Bacteria 1888
37 Ga0068861_100024444 3300005719 Bacteria 4370
38 Ga0068861_101431238 3300005719 Bacteria 676
39 Ga0068858_101261143 3300005842 Bacteria 727
40 Ga0068858_102337743 3300005842 Bacteria 528
41 Ga0068860_100048030 3300005843 Unclassified 4068
42 Ga0068860_100248912 3300005843 Bacteria 1730
43 Ga0068860_100498776 3300005843 Bacteria 1215
44 Ga0068860_102670306 3300005843 Bacteria 518
45 Ga0068862_100056708 3300005844 Bacteria 3357
46 Ga0068862_100653217 3300005844 Bacteria 1015
47 Ga0070717_10000304 3300006028 Bacteria 32329
48 Ga0075362_10077354 3300006177 Unclassified 1529
49 Ga0075370_10029614 3300006353 Bacteria 3050
50 Ga0068871_100586465 3300006358 Bacteria 1013
51 Ga0097620_100243456 3300006931 Bacteria 1888
52 Ga0105240_10126052 3300009093 Bacteria 3077
53 Ga0111539_12998359 3300009094 Bacteria 545
54 Ga0105241_10044971 3300009174 Bacteria 3348
55 Ga0105241_10392511 3300009174 Bacteria 1215
56 Ga0105242_11825625 3300009176 Unclassified 647
57 Ga0105248_11721920 3300009177 Unclassified 711
58 Ga0105238_11018654 3300009551 Unclassified 849
59 Ga0105238_12096711 3300009551 Unclassified 600
60 Ga0105249_13171022 3300009553 Bacteria 528
61 Ga0105239_10009903 3300010375 Bacteria 10704
62 Ga0157369_10244474 3300013105 Unclassified 1874
63 Ga0157374_10167352 3300013296 Bacteria 2143
64 Ga0157374_11131595 3300013296 Bacteria 803
65 Ga0163162_10076874 3300013306 Bacteria 3401
66 Ga0163162_10421499 3300013306 Bacteria 1467
67 Ga0163162_11010774 3300013306 Unclassified 940
68 Ga0157372_10046506 3300013307 Bacteria 4818
69 Ga0157372_10489907 3300013307 Unclassified 1433
70 Ga0157375_10646899 3300013308 Bacteria 1214
71 Ga0157375_11838151 3300013308 Unclassified 718
72 Ga0163163_10584535 3300014325 Bacteria 1180
73 Ga0163163_11204712 3300014325 Bacteria 820
74 Ga0157376_10663023 3300014969 Unclassified 1045
75 Ga0207705_10006978 3300025909 Bacteria 8337
76 Ga0207654_10124345 3300025911 Bacteria 1624
77 Ga0207695_10495444 3300025913 Bacteria 1104
78 Ga0207652_10113341 3300025921 Bacteria 2407
79 Ga0207681_10423600 3300025923 Bacteria 1079
80 Ga0207659_10224126 3300025926 Bacteria 1513
81 Ga0207644_10364637 3300025931 Bacteria 1176
82 Ga0207690_10026442 3300025932 Bacteria 3654
83 Ga0207670_10181421 3300025936 Bacteria 1586
84 Ga0207711_10223753 3300025941 Bacteria 1722
85 Ga0207689_10016400 3300025942 Bacteria 6272
86 Ga0207667_10196512 3300025949 Bacteria 2069
87 Ga0207703_10198418 3300026035 Bacteria 1782
88 Ga0207703_10207720 3300026035 Bacteria 1744
89 Ga0207678_11839849 3300026067 Unclassified 529
90 Ga0207708_10616574 3300026075 Bacteria 920
91 Ga0207702_10017423 3300026078 Bacteria 5943
92 Ga0207648_10130993 3300026089 Bacteria 2207
93 Ga0207674_10005230 3300026116 Bacteria 15448
94 Ga0207675_100054108 3300026118 Bacteria 3744
95 Ga0268266_10143133 3300028379 Bacteria 2147
96 Ga0268266_10250010 3300028379 Bacteria 1639
97 Ga0268265_10154380 3300028380 Bacteria 1941
98 Ga0268265_10289720 3300028380 Bacteria 1469
99 Ga0268265_11267011 3300028380 Unclassified 736
100 Ga0268264_10309869 3300028381 Unclassified 1489
101 Ga0268264_11007407 3300028381 Bacteria 840
102 Ga0268264_12009680 3300028381 Bacteria 587
103 Ga0307515_10060108 3300028794 Bacteria 5431
104 Ga0265327_10149548 3300031251 Bacteria 1085
105 Ga0307405_11168848 3300031731 Bacteria 664
106 Ga0373924_0486715 3300035410 Bacteria 554
107 Ga0373937_0221850 3300036401 Bacteria 1780
108 Ga0395899_0053520 3300037312 Bacteria 2988
109 Ga0395900_0098714 3300037418 Bacteria 3000
110 Ga0395898_0055311 3300037466 Bacteria 3870
111 Ga0395905_0000353 3300037471 Bacteria 65228
112 Ga0395905_0176721 3300037471 Bacteria 2004
113 Ga0395901_0853672 3300038443 Bacteria 895
114 Ga0466969_0153160 3300044656 Bacteria 1061
115 Ga0453683_0021678 3300044673 Bacteria 4099
116 Ga0466966_0023824 3300044684 Plasmid 4005
117 Ga0466966_0118901 3300044684 Bacteria 1624
118 Ga0466961_0700854 3300044693 Bacteria 606
119 Ga0466961_0976337 3300044693 Bacteria 503
120 Ga0453684_0092668 3300044712 Bacteria 3724
121 Ga0466971_0009518 3300044719 Bacteria 4242
122 Ga0466959_0002818 3300045049 Bacteria 11200
123 Ga0466958_0093977 3300045836 Bacteria 1857
124 Ga0466967_0241976 3300045976 Bacteria 1721
125 Ga0495627_000119 3300046453 Bacteria 99048
126 Ga0495590_0007961 3300046457 Bacteria 4064
127 Ga0495638_0266471 3300046460 Bacteria 937
128 Ga0495653_0405894 3300046463 Bacteria 865
129 Ga0495653_0676024 3300046463 Bacteria 629
130 Ga0495605_0000024 3300046474 Bacteria 236016
131 Ga0495639_0426053 3300046475 Bacteria 672
132 Ga0495662_0183822 3300046476 Bacteria 1030
133 Ga0495584_0133461 3300046491 Bacteria 1260
134 Ga0495585_0001629 3300046492 Bacteria 17203
135 Ga0495585_0057733 3300046492 Bacteria 2141
136 Ga0495607_0076851 3300046501 Bacteria 1845
137 Ga0495606_0211503 3300046507 Bacteria 1098
138 Ga0495616_0077179 3300046513 Bacteria 1599
139 Ga0495618_0038849 3300046514 Bacteria 2992
140 Ga0495618_0417251 3300046514 Bacteria 819
141 Ga0495630_0038837 3300046517 Bacteria 3561
142 Ga0495630_0193455 3300046517 Bacteria 1552
143 Ga0495631_0012734 3300046518 Bacteria 4099
144 Ga0495644_0027349 3300046523 Bacteria 2161
145 Ga0495648_0002589 3300046524 Bacteria 16563
146 Ga0495642_0000125 3300046528 Bacteria 43793
147 Ga0495654_0023147 3300046530 Bacteria 3219
148 Ga0495640_0285210 3300046533 Bacteria 1028
149 Ga0495586_0674117 3300046535 Bacteria 597
150 Ga0495587_0102350 3300046536 Bacteria 1649
151 Ga0495621_0484134 3300046539 Bacteria 533
152 Ga0495597_0000799 3300046542 Bacteria 24906
153 Ga0495597_0001401 3300046542 Bacteria 17422
154 Ga0495597_0030079 3300046542 Bacteria 2476
155 Ga0495667_0039195 3300046559 Bacteria 3152
156 Ga0495656_0012554 3300046615 Bacteria 3130
157 Ga0495668_0004289 3300046616 Bacteria 10222
158 Ga0495668_0298993 3300046616 Bacteria 882
159 Ga0495634_0065900 3300046642 Bacteria 2399
160 Ga0495611_0000827 3300046648 Bacteria 17082
161 Ga0495611_0066960 3300046648 Bacteria 1638
162 Ga0495625_0023722 3300046660 Bacteria 4683
163 Ga0495635_0288078 3300046663 Bacteria 1102
164 Ga0495635_0316933 3300046663 Bacteria 1044
165 Ga0495661_0058471 3300046665 Bacteria 2297
166 Ga0495661_0132218 3300046665 Bacteria 1366
167 Ga0495588_0012299 3300046674 Bacteria 4040
168 Ga0495623_0486844 3300046679 Bacteria 653
169 Ga0495669_0083926 3300046684 Bacteria 1464
170 Ga0495613_0005446 3300046689 Bacteria 9563
171 Ga0495624_0638594 3300046690 Bacteria 634
172 Ga0495670_0020385 3300046691 Bacteria 3269
173 Ga0495671_0001431 3300046692 Bacteria 16052
174 Ga0495649_0034197 3300046694 Bacteria 2797
175 Ga0495589_0004510 3300046794 Bacteria 7397
176 Ga0495589_0151459 3300046794 Bacteria 1107
177 Ga0495600_0418440 3300046809 Bacteria 832
178 Ga0495581_0077210 3300047315 Bacteria 1927
179 Ga0495680_0012618 3300047322 Bacteria 7424
180 Ga0495680_0342338 3300047322 Bacteria 1043
181 Ga0495675_0509411 3300047444 Unclassified 690
182 Ga0495677_0020856 3300047445 Bacteria 2375
183 Ga0495677_0168234 3300047445 Unclassified 847
184 Ga0495681_0068131 3300047470 Unclassified 1620
185 Ga0495681_0089194 3300047470 Bacteria 1364
186 Ga0495684_0087288 3300047471 Bacteria 2364
187 Ga0495684_0467890 3300047471 Bacteria 873
188 Ga0495686_0115724 3300047472 Bacteria 1603
189 Ga0495593_0440633 3300047673 Bacteria 652
190 Ga0495614_0401207 3300048089 Bacteria 644
191 Ga0495626_0127903 3300048091 Bacteria 1087
192 Ga0496104_0330938 3300048907 Unclassified 1436
193 Ga0496104_1185481 3300048907 Unclassified 667
194 Ga0496108_0226003 3300048911 Bacteria 1627
195 Ga0496109_0665704 3300048912 Unclassified 978
196 Ga0496110_1383211 3300048913 Bacteria 613
197 Ga0496115_0655027 3300048918 Bacteria 830
198 Ga0495682_0271874 3300049460 Bacteria 598
199 Ga0501033_0355257 3300049570 Bacteria 1026
200 Ga0501036_0094609 3300049572 Bacteria 2525
201 Ga0501039_0020652 3300049575 Bacteria 5047
202 Ga0501039_0216789 3300049575 Bacteria 1505
203 Ga0501041_0074873 3300049577 Bacteria 2081
204 Ga0501046_0022432 3300049580 Bacteria 5202
205 Ga0501047_0776957 3300049581 Bacteria 773
206 Ga0501071_0063219 3300049587 Bacteria 2683
207 Ga0501071_0110561 3300049587 Bacteria 2031
208 Ga0501071_0406624 3300049587 Bacteria 1039
209 Ga0501074_0059521 3300049590 Unclassified 2752
210 Ga0501075_1089299 3300049591 Bacteria 607
211 Ga0501076_0014976 3300049592 Bacteria 5855
212 Ga0501080_0638304 3300049742 Bacteria 943
213 Ga0501080_0818981 3300049742 Unclassified 816
214 Ga0501035_0034729 3300049822 Bacteria 4580
215 Ga0501044_0088065 3300049823 Bacteria 3135
216 nmdc:mga08y16_548370_c1 3300050511 Bacteria 1170
217 nmdc:mga0rr50_380386_c1 3300050513 Unclassified 1190
218 Ga0500646_0038714 3300053090 Bacteria 1336
219 Ga0500651_0346377 3300053093 Bacteria 844
220 Ga0500651_0545289 3300053093 Bacteria 635
221 Ga0500596_068180 3300053735 Bacteria 604
222 Ga0501082_0134428 3300060353 Bacteria 2146
223 Ga0530510_0310179 3300061734 Bacteria 1182
224 Ga0157372_10346028
225 rootH2_10120869
226 rootH1_10158461
227 Ga0065165_1008551
228 Ga0070658_10009852
229 Ga0070683_100851423
230 Ga0070666_10823131
231 Ga0070689_100185581
232 Ga0070687_100060867
233 Ga0070669_100133125
234 Ga0070669_101332302
235 Ga0070675_101520369
236 Ga0070671_100489013
237 Ga0070673_100472788
238 Ga0070688_101123048
239 Ga0070659_100086226
240 Ga0070667_100849718
241 Ga0070701_10118339
242 Ga0070694_101062268
243 Ga0070708_100930341
244 Ga0070681_11259460
245 Ga0068867_100058301
246 Ga0070679_100175600
247 Ga0070684_100115637
248 Ga0070684_100308956
249 Ga0070672_100318421
250 Ga0070665_100111097
251 Ga0070665_100235053
252 Ga0070704_101417987
253 Ga0068855_100043684
254 Ga0070664_100007453
255 Ga0068857_100018116
256 Ga0068854_100708380
257 Ga0068856_100227341
258 Ga0068852_100264668
259 Ga0068859_100243436
260 Ga0068861_100024444
261 Ga0068861_101431238
262 Ga0068858_101261143
263 Ga0068858_102337743
264 Ga0068860_100048030
265 Ga0068860_100248912
266 Ga0068860_100498776
267 Ga0068860_102670306
268 Ga0068862_100056708
269 Ga0068862_100653217
270 Ga0070717_10000304
271 Ga0075362_10077354
272 Ga0075370_10029614
273 Ga0068871_100586465
274 Ga0097620_100243456
275 Ga0105240_10126052
276 Ga0111539_12998359
277 Ga0105241_10044971
278 Ga0105241_10392511
279 Ga0105242_11825625
280 Ga0105248_11721920
281 Ga0105238_11018654
282 Ga0105238_12096711
283 Ga0105249_13171022
284 Ga0105239_10009903
285 Ga0157369_10244474
286 Ga0157374_10167352
287 Ga0157374_11131595
288 Ga0163162_10076874
289 Ga0163162_10421499
290 Ga0163162_11010774
291 Ga0157372_10046506
292 Ga0157372_10489907
293 Ga0157375_10646899
294 Ga0157375_11838151
295 Ga0163163_10584535
296 Ga0163163_11204712
297 Ga0157376_10663023
298 Ga0207705_10006978
299 Ga0207654_10124345
300 Ga0207695_10495444
301 Ga0207652_10113341
302 Ga0207681_10423600
303 Ga0207659_10224126
304 Ga0207644_10364637
305 Ga0207690_10026442
306 Ga0207670_10181421
307 Ga0207711_10223753
308 Ga0207689_10016400
309 Ga0207667_10196512
310 Ga0207703_10198418
311 Ga0207703_10207720
312 Ga0207678_11839849
313 Ga0207708_10616574
314 Ga0207702_10017423
315 Ga0207648_10130993
316 Ga0207674_10005230
317 Ga0207675_100054108
318 Ga0268266_10143133
319 Ga0268266_10250010
320 Ga0268265_10154380
321 Ga0268265_10289720
322 Ga0268265_11267011
323 Ga0268264_10309869
324 Ga0268264_11007407
325 Ga0268264_12009680
326 Ga0307515_10060108
327 Ga0265327_10149548
328 Ga0307405_11168848
329 Ga0373924_0486715
330 Ga0373937_0221850
331 Ga0395899_0053520
332 Ga0395900_0098714
333 Ga0395898_0055311
334 Ga0395905_0000353
335 Ga0395905_0176721
336 Ga0395901_0853672
337 Ga0466969_0153160
338 Ga0453683_0021678
339 Ga0466966_0023824
340 Ga0466966_0118901
341 Ga0466961_0700854
342 Ga0466961_0976337
343 Ga0453684_0092668
344 Ga0466971_0009518
345 Ga0466959_0002818
346 Ga0466958_0093977
347 Ga0466967_0241976
348 Ga0495627_000119
349 Ga0495590_0007961
350 Ga0495638_0266471
351 Ga0495653_0405894
352 Ga0495653_0676024
353 Ga0495605_0000024
354 Ga0495639_0426053
355 Ga0495662_0183822
356 Ga0495584_0133461
357 Ga0495585_0001629
358 Ga0495585_0057733
359 Ga0495607_0076851
360 Ga0495606_0211503
361 Ga0495616_0077179
362 Ga0495618_0038849
363 Ga0495618_0417251
364 Ga0495630_0038837
365 Ga0495630_0193455
366 Ga0495631_0012734
367 Ga0495644_0027349
368 Ga0495648_0002589
369 Ga0495642_0000125
370 Ga0495654_0023147
371 Ga0495640_0285210
372 Ga0495586_0674117
373 Ga0495587_0102350
374 Ga0495621_0484134
375 Ga0495597_0000799
376 Ga0495597_0001401
377 Ga0495597_0030079
378 Ga0495667_0039195
379 Ga0495656_0012554
380 Ga0495668_0004289
381 Ga0495668_0298993
382 Ga0495634_0065900
383 Ga0495611_0000827
384 Ga0495611_0066960
385 Ga0495625_0023722
386 Ga0495635_0288078
387 Ga0495635_0316933
388 Ga0495661_0058471
389 Ga0495661_0132218
390 Ga0495588_0012299
391 Ga0495623_0486844
392 Ga0495669_0083926
393 Ga0495613_0005446
394 Ga0495624_0638594
395 Ga0495670_0020385
396 Ga0495671_0001431
397 Ga0495649_0034197
398 Ga0495589_0004510
399 Ga0495589_0151459
400 Ga0495600_0418440
401 Ga0495581_0077210
402 Ga0495680_0012618
403 Ga0495680_0342338
404 Ga0495675_0509411
405 Ga0495677_0020856
406 Ga0495677_0168234
407 Ga0495681_0068131
408 Ga0495681_0089194
409 Ga0495684_0087288
410 Ga0495684_0467890
411 Ga0495686_0115724
412 Ga0495593_0440633
413 Ga0495614_0401207
414 Ga0495626_0127903
415 Ga0496104_0330938
416 Ga0496104_1185481
417 Ga0496108_0226003
418 Ga0496109_0665704
419 Ga0496110_1383211
420 Ga0496115_0655027
421 Ga0495682_0271874
422 Ga0501033_0355257
423 Ga0501036_0094609
424 Ga0501039_0020652
425 Ga0501039_0216789
426 Ga0501041_0074873
427 Ga0501046_0022432
428 Ga0501047_0776957
429 Ga0501071_0063219
430 Ga0501071_0110561
431 Ga0501071_0406624
432 Ga0501074_0059521
433 Ga0501075_1089299
434 Ga0501076_0014976
435 Ga0501080_0638304
436 Ga0501080_0818981
437 Ga0501035_0034729
438 Ga0501044_0088065
439 nmdc:mga08y16_548370_c1
440 nmdc:mga0rr50_380386_c1
441 Ga0500646_0038714
442 Ga0500651_0346377
443 Ga0500651_0545289
444 Ga0500596_068180
445 Ga0501082_0134428
446 Ga0530510_0310179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

15

121

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.9075 3 117
3ov4-assembly1.cif.gz_B crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.907 3 117
3ov4-assembly2.cif.gz_C crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.9063 3 117
3mki-assembly2.cif.gz_C crystal structure of ketosteroid isomerase d38ed99n from pseudomonas testosteroni (tksi) 0.8977 3 116
8cho-assembly1.cif.gz_A-2 crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni 0.8908 3 116
ID Description Score Start End Superfamily
5jppA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8893 1 117 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8852 6 117 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8824 6 116 3.10.450.50
af_O06820_1_123_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8738 1 117 3.10.450.50
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8736 3 120 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A6M4GQU1-F1-model_v4 SnoaL-like domain-containing protein 1 3 131
AF-A0A2V8SGG1-F1-model_v4 SnoaL-like domain-containing protein 0.9786 1 131
AF-A0A6M4GQU1-F1-model_v4 SnoaL-like domain-containing protein 0.9774 3 131
AF-A0A6N9HP78-F1-model_v4 SnoaL-like domain-containing protein 0.9723 1 128
AF-A0A2V8SGG1-F1-model_v4 SnoaL-like domain-containing protein 0.9713 1 131

Map