F336380

General Info

Members Datasets Scaffolds Average Seq Length
224 129 224 246

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100205578|Ga0070688_1002055782
Length 269
Sequence MSYLKLKISYQKEKMKNSDRNSPLGVGGMKAMIFSAGLGTRFKPWTDAHPKALAVVNGKTLLQRNIEYLQQFGITDVVVNVHHFADQLIETIIKSKEWGSKITISDEREELLETGGGLLKAKEFFTPGEKFITCNADILTDLNISKLISFHTEKKALISFGVTQRKTSRYLLFDENDRLCGWRNATTGQDKISIPKTQYKEKAYSCVVVFEYDVFKLMEGKGFLGKFSLIDVYLALAAEHLIVGFDHTGDRFVDVGKPESIVIAESVFA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
115 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
116 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 0.45
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13854271 2162886012 Bacteria 1123
2 JGI24033J26618_1022230 3300002155 Bacteria 819
3 rootH1_10316207 3300003323 Bacteria 2036
4 Ga0065704_10168670 3300005289 Bacteria 1306
5 Ga0065712_10075220 3300005290 Bacteria 3903
6 Ga0065712_10110262 3300005290 Bacteria 1799
7 Ga0065715_10106292 3300005293 Bacteria 2838
8 Ga0070676_10022250 3300005328 Bacteria 3554
9 Ga0070690_100075250 3300005330 Bacteria 2201
10 Ga0070690_100392033 3300005330 Bacteria 1018
11 Ga0070670_100030805 3300005331 Bacteria 4620
12 Ga0070670_100085783 3300005331 Bacteria 2705
13 Ga0070670_100196395 3300005331 Bacteria 1753
14 Ga0070677_10055078 3300005333 Bacteria 1622
15 Ga0068869_100034634 3300005334 Bacteria 3573
16 Ga0070666_10247347 3300005335 Bacteria 1262
17 Ga0068868_100227017 3300005338 Bacteria 1565
18 Ga0070689_100187733 3300005340 Bacteria 1682
19 Ga0070687_100040330 3300005343 Bacteria 2352
20 Ga0070668_100153434 3300005347 Bacteria 1864
21 Ga0070669_100010952 3300005353 Bacteria 6435
22 Ga0070669_100174962 3300005353 Unclassified 1676
23 Ga0070675_100013307 3300005354 Bacteria 6465
24 Ga0070675_100026932 3300005354 Bacteria 4616
25 Ga0070675_100097941 3300005354 Bacteria 2466
26 Ga0070671_100009276 3300005355 Bacteria 7903
27 Ga0070671_100120987 3300005355 Bacteria 2203
28 Ga0070674_100008537 3300005356 Bacteria 6107
29 Ga0070673_100015350 3300005364 Bacteria 5376
30 Ga0070688_100003984 3300005365 Bacteria 7656
31 Ga0070688_100024052 3300005365 Bacteria 3589
32 Ga0070688_100205578 3300005365 Bacteria 1380
33 Ga0070667_100144505 3300005367 Bacteria 2085
34 Ga0070667_100155531 3300005367 Bacteria 2011
35 Ga0070701_10045549 3300005438 Bacteria 2251
36 Ga0070701_10099273 3300005438 Bacteria 1610
37 Ga0070678_100030165 3300005456 Bacteria 3724
38 Ga0068867_100026021 3300005459 Unclassified 4198
39 Ga0070685_10005635 3300005466 Bacteria 6355
40 Ga0070685_10056754 3300005466 Bacteria 2277
41 Ga0070707_100186458 3300005468 Bacteria 2023
42 Ga0070698_100002526 3300005471 Bacteria 20152
43 Ga0070698_100040660 3300005471 Bacteria 4777
44 Ga0070672_100005533 3300005543 Bacteria 8388
45 Ga0070672_100036542 3300005543 Bacteria 3742
46 Ga0070672_100078832 3300005543 Unclassified 2636
47 Ga0070686_100008643 3300005544 Bacteria 5706
48 Ga0068855_100297132 3300005563 Bacteria 1789
49 Ga0068857_100266755 3300005577 Unclassified 1573
50 Ga0068854_100405711 3300005578 Bacteria 1129
51 Ga0068859_100100033 3300005617 Unclassified 2955
52 Ga0068859_100332035 3300005617 Bacteria 1615
53 Ga0068864_100201163 3300005618 Unclassified 1830
54 Ga0068861_100032735 3300005719 Bacteria 3830
55 Ga0068861_100254620 3300005719 Bacteria 1500
56 Ga0068863_100003524 3300005841 Bacteria 15444
57 Ga0068863_100134019 3300005841 Bacteria 2366
58 Ga0068858_100171878 3300005842 Bacteria 2043
59 Ga0068858_100227402 3300005842 Bacteria 1768
60 Ga0068860_100154116 3300005843 Bacteria 2214
61 Ga0068860_100367088 3300005843 Bacteria 1419
62 Ga0068860_100587580 3300005843 Bacteria 1118
63 Ga0068862_100079893 3300005844 Bacteria 2835
64 Ga0068862_100089677 3300005844 Bacteria 2676
65 Ga0068862_100544495 3300005844 Bacteria 1107
66 Ga0075366_10015994 3300006195 Bacteria 4308
67 Ga0097621_100046520 3300006237 Bacteria 3511
68 Ga0068871_100132507 3300006358 Bacteria 2114
69 Ga0075428_100019612 3300006844 Bacteria 7482
70 Ga0075428_100060605 3300006844 Unclassified 4144
71 Ga0075428_100186901 3300006844 Bacteria 2242
72 Ga0075430_100003699 3300006846 Bacteria 12849
73 Ga0075429_100003548 3300006880 Bacteria 13292
74 Ga0068865_100221801 3300006881 Bacteria 1478
75 Ga0097620_100100033 3300006931 Unclassified 2955
76 Ga0097620_100332029 3300006931 Bacteria 1615
77 Ga0105240_10035349 3300009093 Bacteria 6440
78 Ga0105240_10493594 3300009093 Bacteria 1363
79 Ga0111539_10410395 3300009094 Bacteria 1577
80 Ga0114129_10073897 3300009147 Unclassified 4749
81 Ga0105243_10348706 3300009148 Bacteria 1358
82 Ga0105243_11063640 3300009148 Unclassified 815
83 Ga0105241_10229479 3300009174 Bacteria 1564
84 Ga0105242_10001987 3300009176 Bacteria 16076
85 Ga0105242_10006071 3300009176 Bacteria 9314
86 Ga0105242_10123393 3300009176 Unclassified 2226
87 Ga0105249_10022120 3300009553 Bacteria 5695
88 Ga0105249_10025966 3300009553 Bacteria 5275
89 Ga0105249_10029320 3300009553 Bacteria 4969
90 Ga0105249_10060200 3300009553 Bacteria 3483
91 Ga0105249_10123466 3300009553 Unclassified 2463
92 Ga0105249_10664232 3300009553 Bacteria 1100
93 Ga0105239_10300111 3300010375 Unclassified 1809
94 Ga0157370_10008665 3300013104 Bacteria 10947
95 Ga0157370_10016427 3300013104 Bacteria 7494
96 Ga0157378_10004331 3300013297 Bacteria 12491
97 Ga0157378_10327151 3300013297 Unclassified 1491
98 Ga0163162_10002870 3300013306 Bacteria 16405
99 Ga0163162_10426321 3300013306 Bacteria 1459
100 Ga0163162_10477037 3300013306 Bacteria 1379
101 Ga0157372_10242917 3300013307 Bacteria 2089
102 Ga0157372_10523757 3300013307 Bacteria 1382
103 Ga0157375_10072543 3300013308 Bacteria 3460
104 Ga0157375_10089257 3300013308 Bacteria 3139
105 Ga0157375_10234575 3300013308 Bacteria 1994
106 Ga0157375_10382514 3300013308 Unclassified 1574
107 Ga0157375_10613062 3300013308 Bacteria 1247
108 Ga0163163_10278489 3300014325 Bacteria 1724
109 Ga0163163_10352328 3300014325 Bacteria 1528
110 Ga0157380_10025683 3300014326 Bacteria 4469
111 Ga0157380_10085524 3300014326 Bacteria 2588
112 Ga0157380_10707291 3300014326 Bacteria 1013
113 Ga0157377_10043685 3300014745 Bacteria 2495
114 Ga0163161_10034915 3300017792 Bacteria 3597
115 Ga0207682_10029365 3300025893 Bacteria 2198
116 Ga0207682_10080693 3300025893 Bacteria 1394
117 Ga0207642_10067859 3300025899 Bacteria 1685
118 Ga0207680_10173069 3300025903 Bacteria 1455
119 Ga0207645_10015716 3300025907 Bacteria 5020
120 Ga0207645_10100913 3300025907 Bacteria 1862
121 Ga0207645_10172876 3300025907 Bacteria 1416
122 Ga0207643_10013309 3300025908 Bacteria 4452
123 Ga0207643_10036127 3300025908 Bacteria 2770
124 Ga0207643_10450202 3300025908 Bacteria 819
125 Ga0207695_10169855 3300025913 Bacteria 2107
126 Ga0207695_10410510 3300025913 Bacteria 1238
127 Ga0207662_10032765 3300025918 Bacteria 3026
128 Ga0207649_10060086 3300025920 Bacteria 2387
129 Ga0207681_10022092 3300025923 Bacteria 4053
130 Ga0207681_10094877 3300025923 Bacteria 2139
131 Ga0207681_10127258 3300025923 Bacteria 1878
132 Ga0207681_10435230 3300025923 Bacteria 1065
133 Ga0207650_10073297 3300025925 Bacteria 2579
134 Ga0207650_10212557 3300025925 Bacteria 1554
135 Ga0207650_10329799 3300025925 Bacteria 1251
136 Ga0207659_10004858 3300025926 Bacteria 8145
137 Ga0207659_10050620 3300025926 Bacteria 2952
138 Ga0207659_10072368 3300025926 Bacteria 2520
139 Ga0207659_10273914 3300025926 Bacteria 1378
140 Ga0207644_10015821 3300025931 Bacteria 5072
141 Ga0207644_10117872 3300025931 Bacteria 2017
142 Ga0207706_10076740 3300025933 Bacteria 2939
143 Ga0207686_10000442 3300025934 Bacteria 27861
144 Ga0207670_10117457 3300025936 Bacteria 1928
145 Ga0207669_10016102 3300025937 Bacteria 3790
146 Ga0207669_10083738 3300025937 Bacteria 2052
147 Ga0207704_10036380 3300025938 Bacteria 2832
148 Ga0207691_10010867 3300025940 Bacteria 8736
149 Ga0207691_10014288 3300025940 Bacteria 7572
150 Ga0207691_10081655 3300025940 Bacteria 2905
151 Ga0207691_10092914 3300025940 Unclassified 2702
152 Ga0207691_10796210 3300025940 Unclassified 794
153 Ga0207689_10009824 3300025942 Bacteria 8246
154 Ga0207689_10068693 3300025942 Bacteria 2912
155 Ga0207689_10079311 3300025942 Bacteria 2699
156 Ga0207689_10110592 3300025942 Bacteria 2258
157 Ga0207679_10043954 3300025945 Bacteria 3220
158 Ga0207667_10676953 3300025949 Bacteria 1035
159 Ga0207651_10032694 3300025960 Bacteria 3345
160 Ga0207651_10232543 3300025960 Bacteria 1497
161 Ga0207651_10271260 3300025960 Bacteria 1397
162 Ga0207712_10006246 3300025961 Bacteria 7510
163 Ga0207712_10015248 3300025961 Bacteria 4954
164 Ga0207712_10022268 3300025961 Bacteria 4170
165 Ga0207668_10352719 3300025972 Bacteria 1231
166 Ga0207668_10359784 3300025972 Bacteria 1219
167 Ga0207668_10576951 3300025972 Bacteria 977
168 Ga0207640_10353845 3300025981 Bacteria 1181
169 Ga0207640_10356632 3300025981 Bacteria 1177
170 Ga0207658_10109511 3300025986 Unclassified 2181
171 Ga0207658_10271270 3300025986 Unclassified 1450
172 Ga0207677_10073236 3300026023 Bacteria 2425
173 Ga0207703_10039626 3300026035 Bacteria 3765
174 Ga0207708_10037682 3300026075 Bacteria 3683
175 Ga0207708_10101273 3300026075 Bacteria 2229
176 Ga0207708_10102474 3300026075 Unclassified 2216
177 Ga0207641_10000111 3300026088 Bacteria 120527
178 Ga0207641_10044831 3300026088 Bacteria 3720
179 Ga0207641_10205277 3300026088 Bacteria 1819
180 Ga0207641_10308339 3300026088 Bacteria 1497
181 Ga0207648_10029288 3300026089 Bacteria 4882
182 Ga0207648_10102340 3300026089 Bacteria 2511
183 Ga0207648_10335025 3300026089 Bacteria 1362
184 Ga0207676_10141626 3300026095 Unclassified 2059
185 Ga0207674_10033960 3300026116 Bacteria 5335
186 Ga0207674_10855082 3300026116 Unclassified 877
187 Ga0207675_100000496 3300026118 Bacteria 38204
188 Ga0207675_100193302 3300026118 Bacteria 1952
189 Ga0207683_10010937 3300026121 Bacteria 7741
190 Ga0207698_10272221 3300026142 Unclassified 1562
191 Ga0207698_10313177 3300026142 Bacteria 1466
192 Ga0268266_10233207 3300028379 Bacteria 1696
193 Ga0268265_10025074 3300028380 Bacteria 4227
194 Ga0268265_10071161 3300028380 Unclassified 2708
195 Ga0268264_10044274 3300028381 Bacteria 3691
196 Ga0265323_10000365 3300028653 Bacteria 26035
197 Ga0265316_10001810 3300031344 Bacteria 22497
198 Ga0316579_10171206 3300031691 Unclassified 1050
199 Ga0265342_10074925 3300031712 Bacteria 1965
200 Ga0316576_10253671 3300031727 Bacteria 1320
201 Ga0373945_0178943 3300035116 Bacteria 872
202 Ga0373937_0193425 3300036401 Bacteria 1912
203 Ga0316582_0222965 3300036647 Bacteria 1289
204 Ga0439453_0012524 3300041408 Bacteria 1429
205 Ga0451795_0421280 3300041456 Bacteria 6919
206 Ga0451841_0256505 3300041498 Bacteria 1036
207 Ga0451577_0488442 3300042876 Bacteria 1118
208 Ga0453683_0092887 3300044673 Bacteria 1892
209 Ga0453684_0021355 3300044712 Bacteria 9679
210 Ga0453684_0068125 3300044712 Bacteria 4521
211 Ga0453684_0084444 3300044712 Bacteria 3948
212 Ga0495621_0036654 3300046539 Bacteria 1703
213 Ga0495672_0064720 3300047320 Bacteria 2092
214 Ga0495686_0004711 3300047472 Bacteria 11051
215 Ga0495686_0015843 3300047472 Bacteria 5129
216 Ga0501080_0378114 3300049742 Bacteria 1276
217 Ga0501083_0201129 3300049744 Bacteria 1299
218 nmdc:mga0k408_10989_c2 3300050493 Bacteria 2907
219 nmdc:mga0k408_143215_c1 3300050493 Unclassified 1422
220 nmdc:mga05p37_64001_c1 3300050507 Unclassified 4525
221 nmdc:mga09592_219058_c1 3300050508 Bacteria 1649
222 nmdc:mga06r32_160818_c1 3300050510 Bacteria 2228
223 nmdc:mga08y16_285172_c1 3300050511 Bacteria 1703
224 nmdc:mga08y16_35045_c1 3300050511 Bacteria 5272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100297132 Ga0068855_1002971322 230
2 3300025949 Ga0207667_10676953 Ga0207667_106769531 230
3 3300044712 Ga0453684_0068125 Ga0453684_0068125_3799_4509 233
4 3300005289 Ga0065704_10168670 Ga0065704_101686702 235
5 3300006844 Ga0075428_100019612 Ga0075428_1000196121 235
6 3300006844 Ga0075428_100060605 Ga0075428_1000606053 235
7 3300006844 Ga0075428_100186901 Ga0075428_1001869012 235
8 3300006846 Ga0075430_100003699 Ga0075430_1000036992 235
9 3300026075 Ga0207708_10101273 Ga0207708_101012731 235
10 3300041456 Ga0451795_0421280 Ga0451795_0421280_5517_6254 235
11 3300041498 Ga0451841_0256505 Ga0451841_0256505_47_763 235
12 3300028653 Ga0265323_10000365 Ga0265323_1000036513 236
13 3300031344 Ga0265316_10001810 Ga0265316_1000181011 236
14 3300031691 Ga0316579_10171206 Ga0316579_101712062 236
15 3300031712 Ga0265342_10074925 Ga0265342_100749252 236
16 3300031727 Ga0316576_10253671 Ga0316576_102536712 236
17 3300036647 Ga0316582_0222965 Ga0316582_0222965_87_809 236
18 3300044712 Ga0453684_0021355 Ga0453684_0021355_1510_2232 236
19 3300003323 rootH1_10316207 rootH1_103162072 237
20 3300025926 Ga0207659_10004858 Ga0207659_100048586 237
21 3300005290 Ga0065712_10075220 Ga0065712_100752202 238
22 3300005290 Ga0065712_10110262 Ga0065712_101102622 238
23 3300005330 Ga0070690_100075250 Ga0070690_1000752501 238
24 3300005330 Ga0070690_100392033 Ga0070690_1003920332 238
25 3300005331 Ga0070670_100030805 Ga0070670_1000308056 238
26 3300005331 Ga0070670_100085783 Ga0070670_1000857832 238
27 3300005335 Ga0070666_10247347 Ga0070666_102473472 238
28 3300005343 Ga0070687_100040330 Ga0070687_1000403302 238
29 3300005353 Ga0070669_100174962 Ga0070669_1001749622 238
30 3300005354 Ga0070675_100097941 Ga0070675_1000979412 238
31 3300005355 Ga0070671_100009276 Ga0070671_1000092767 238
32 3300005356 Ga0070674_100008537 Ga0070674_1000085375 238
33 3300005365 Ga0070688_100024052 Ga0070688_1000240522 238
34 3300005367 Ga0070667_100155531 Ga0070667_1001555312 238
35 3300005438 Ga0070701_10045549 Ga0070701_100455492 238
36 3300005438 Ga0070701_10099273 Ga0070701_100992732 238
37 3300005459 Ga0068867_100026021 Ga0068867_1000260211 238
38 3300005466 Ga0070685_10005635 Ga0070685_100056353 238
39 3300005466 Ga0070685_10056754 Ga0070685_100567542 238
40 3300005543 Ga0070672_100005533 Ga0070672_1000055336 238
41 3300005544 Ga0070686_100008643 Ga0070686_1000086432 238
42 3300005578 Ga0068854_100405711 Ga0068854_1004057112 238
43 3300005617 Ga0068859_100100033 Ga0068859_1001000333 238
44 3300005617 Ga0068859_100332035 Ga0068859_1003320352 238
45 3300005618 Ga0068864_100201163 Ga0068864_1002011632 238
46 3300005719 Ga0068861_100254620 Ga0068861_1002546202 238
47 3300005841 Ga0068863_100003524 Ga0068863_1000035241 238
48 3300005841 Ga0068863_100134019 Ga0068863_1001340192 238
49 3300005842 Ga0068858_100171878 Ga0068858_1001718782 238
50 3300005842 Ga0068858_100227402 Ga0068858_1002274022 238
51 3300005843 Ga0068860_100587580 Ga0068860_1005875802 238
52 3300005844 Ga0068862_100089677 Ga0068862_1000896772 238
53 3300005844 Ga0068862_100544495 Ga0068862_1005444952 238
54 3300006195 Ga0075366_10015994 Ga0075366_100159942 238
55 3300006237 Ga0097621_100046520 Ga0097621_1000465202 238
56 3300006358 Ga0068871_100132507 Ga0068871_1001325072 238
57 3300006881 Ga0068865_100221801 Ga0068865_1002218012 238
58 3300006931 Ga0097620_100100033 Ga0097620_1001000332 238
59 3300006931 Ga0097620_100332029 Ga0097620_1003320292 238
60 3300009093 Ga0105240_10035349 Ga0105240_100353495 238
61 3300009148 Ga0105243_11063640 Ga0105243_110636401 238
62 3300009176 Ga0105242_10001987 Ga0105242_100019871 238
63 3300009553 Ga0105249_10025966 Ga0105249_100259663 238
64 3300009553 Ga0105249_10029320 Ga0105249_100293202 238
65 3300009553 Ga0105249_10664232 Ga0105249_106642321 238
66 3300013104 Ga0157370_10008665 Ga0157370_1000866510 238
67 3300013104 Ga0157370_10016427 Ga0157370_100164273 238
68 3300013297 Ga0157378_10004331 Ga0157378_100043312 238
69 3300013306 Ga0163162_10002870 Ga0163162_1000287014 238
70 3300013306 Ga0163162_10426321 Ga0163162_104263212 238
71 3300013308 Ga0157375_10072543 Ga0157375_100725432 238
72 3300013308 Ga0157375_10382514 Ga0157375_103825142 238
73 3300013308 Ga0157375_10613062 Ga0157375_106130622 238
74 3300014325 Ga0163163_10278489 Ga0163163_102784892 238
75 3300014325 Ga0163163_10352328 Ga0163163_103523281 238
76 3300014326 Ga0157380_10707291 Ga0157380_107072911 238
77 3300014745 Ga0157377_10043685 Ga0157377_100436852 238
78 3300017792 Ga0163161_10034915 Ga0163161_100349152 238
79 3300025903 Ga0207680_10173069 Ga0207680_101730692 238
80 3300025907 Ga0207645_10015716 Ga0207645_100157162 238
81 3300025907 Ga0207645_10172876 Ga0207645_101728762 238
82 3300025908 Ga0207643_10036127 Ga0207643_100361272 238
83 3300025913 Ga0207695_10169855 Ga0207695_101698552 238
84 3300025918 Ga0207662_10032765 Ga0207662_100327652 238
85 3300025920 Ga0207649_10060086 Ga0207649_100600862 238
86 3300025923 Ga0207681_10094877 Ga0207681_100948772 238
87 3300025923 Ga0207681_10127258 Ga0207681_101272582 238
88 3300025923 Ga0207681_10435230 Ga0207681_104352302 238
89 3300025925 Ga0207650_10073297 Ga0207650_100732972 238
90 3300025925 Ga0207650_10212557 Ga0207650_102125572 238
91 3300025926 Ga0207659_10273914 Ga0207659_102739142 238
92 3300025931 Ga0207644_10015821 Ga0207644_100158214 238
93 3300025934 Ga0207686_10000442 Ga0207686_1000044215 238
94 3300025937 Ga0207669_10016102 Ga0207669_100161025 238
95 3300025937 Ga0207669_10083738 Ga0207669_100837382 238
96 3300025938 Ga0207704_10036380 Ga0207704_100363802 238
97 3300025940 Ga0207691_10014288 Ga0207691_100142885 238
98 3300025940 Ga0207691_10081655 Ga0207691_100816552 238
99 3300025940 Ga0207691_10796210 Ga0207691_107962101 238
100 3300025942 Ga0207689_10068693 Ga0207689_100686932 238
101 3300025942 Ga0207689_10079311 Ga0207689_100793112 238
102 3300025945 Ga0207679_10043954 Ga0207679_100439542 238
103 3300025960 Ga0207651_10232543 Ga0207651_102325432 238
104 3300025960 Ga0207651_10271260 Ga0207651_102712602 238
105 3300025961 Ga0207712_10006246 Ga0207712_100062463 238
106 3300025961 Ga0207712_10022268 Ga0207712_100222683 238
107 3300025972 Ga0207668_10352719 Ga0207668_103527192 238
108 3300025981 Ga0207640_10353845 Ga0207640_103538452 238
109 3300025981 Ga0207640_10356632 Ga0207640_103566322 238
110 3300025986 Ga0207658_10109511 Ga0207658_101095112 238
111 3300026023 Ga0207677_10073236 Ga0207677_100732361 238
112 3300026035 Ga0207703_10039626 Ga0207703_100396263 238
113 3300026075 Ga0207708_10102474 Ga0207708_101024742 238
114 3300026088 Ga0207641_10000111 Ga0207641_1000011195 238
115 3300026088 Ga0207641_10044831 Ga0207641_100448311 238
116 3300026088 Ga0207641_10205277 Ga0207641_102052772 238
117 3300026088 Ga0207641_10308339 Ga0207641_103083392 238
118 3300026089 Ga0207648_10029288 Ga0207648_100292882 238
119 3300026089 Ga0207648_10335025 Ga0207648_103350251 238
120 3300026095 Ga0207676_10141626 Ga0207676_101416262 238
121 3300026116 Ga0207674_10855082 Ga0207674_108550821 238
122 3300026118 Ga0207675_100193302 Ga0207675_1001933022 238
123 3300026142 Ga0207698_10272221 Ga0207698_102722212 238
124 3300026142 Ga0207698_10313177 Ga0207698_103131771 238
125 3300035116 Ga0373945_0178943 Ga0373945_0178943_111_836 238
126 3300036401 Ga0373937_0193425 Ga0373937_0193425_907_1683 238
127 3300044712 Ga0453684_0084444 Ga0453684_0084444_828_1595 238
128 3300046539 Ga0495621_0036654 Ga0495621_0036654_604_1329 238
129 3300047320 Ga0495672_0064720 Ga0495672_0064720_676_1392 238
130 3300047472 Ga0495686_0004711 Ga0495686_0004711_2673_3389 238
131 3300047472 Ga0495686_0015843 Ga0495686_0015843_3478_4194 238
132 3300049742 Ga0501080_0378114 Ga0501080_0378114_198_914 238
133 3300050493 nmdc:mga0k408_10989_c2 nmdc:mga0k408_10989_c2_689_1405 238
134 3300050493 nmdc:mga0k408_143215_c1 nmdc:mga0k408_143215_c1_669_1385 238
135 3300050510 nmdc:mga06r32_160818_c1 nmdc:mga06r32_160818_c1_1439_2179 238
136 3300002155 JGI24033J26618_1022230 JGI24033J26618_10222302 239
137 3300005331 Ga0070670_100196395 Ga0070670_1001963952 239
138 3300005333 Ga0070677_10055078 Ga0070677_100550782 239
139 3300005338 Ga0068868_100227017 Ga0068868_1002270171 239
140 3300005456 Ga0070678_100030165 Ga0070678_1000301652 239
141 3300025893 Ga0207682_10029365 Ga0207682_100293652 239
142 3300025908 Ga0207643_10450202 Ga0207643_104502021 239
143 3300025925 Ga0207650_10329799 Ga0207650_103297992 239
144 3300025940 Ga0207691_10092914 Ga0207691_100929141 239
145 3300026121 Ga0207683_10010937 Ga0207683_100109378 239
146 3300013306 Ga0163162_10477037 Ga0163162_104770371 240
147 3300005355 Ga0070671_100120987 Ga0070671_1001209872 241
148 3300025893 Ga0207682_10080693 Ga0207682_100806932 241
149 3300025931 Ga0207644_10117872 Ga0207644_101178722 241
150 3300042876 Ga0451577_0488442 Ga0451577_0488442_272_1009 241
151 3300044673 Ga0453683_0092887 Ga0453683_0092887_220_957 241
152 3300005354 Ga0070675_100026932 Ga0070675_1000269323 243
153 3300025926 Ga0207659_10072368 Ga0207659_100723682 243
154 3300025940 Ga0207691_10010867 Ga0207691_100108678 243
155 3300025972 Ga0207668_10576951 Ga0207668_105769511 243
156 3300005334 Ga0068869_100034634 Ga0068869_1000346342 245
157 3300005347 Ga0070668_100153434 Ga0070668_1001534342 245
158 3300005843 Ga0068860_100154116 Ga0068860_1001541162 245
159 3300009174 Ga0105241_10229479 Ga0105241_102294792 245
160 3300009176 Ga0105242_10006071 Ga0105242_100060716 245
161 3300009553 Ga0105249_10123466 Ga0105249_101234662 245
162 3300013308 Ga0157375_10234575 Ga0157375_102345751 245
163 3300025942 Ga0207689_10009824 Ga0207689_100098246 245
164 3300025972 Ga0207668_10359784 Ga0207668_103597842 245
165 3300026089 Ga0207648_10102340 Ga0207648_101023402 245
166 3300028380 Ga0268265_10071161 Ga0268265_100711611 245
167 3300028381 Ga0268264_10044274 Ga0268264_100442742 245
168 3300013307 Ga0157372_10242917 Ga0157372_102429172 246
169 3300028379 Ga0268266_10233207 Ga0268266_102332072 248
170 3300049744 Ga0501083_0201129 Ga0501083_0201129_450_1196 248
171 3300005543 Ga0070672_100036542 Ga0070672_1000365423 249
172 3300009148 Ga0105243_10348706 Ga0105243_103487062 249
173 3300009553 Ga0105249_10022120 Ga0105249_100221204 249
174 3300010375 Ga0105239_10300111 Ga0105239_103001111 249
175 3300013297 Ga0157378_10327151 Ga0157378_103271512 249
176 3300013307 Ga0157372_10523757 Ga0157372_105237572 249
177 3300025899 Ga0207642_10067859 Ga0207642_100678592 249
178 3300025961 Ga0207712_10015248 Ga0207712_100152482 249
179 2162886012 MBSR1b_contig_13854271 MBSR1b_0326.00003780 250
180 3300005293 Ga0065715_10106292 Ga0065715_101062922 250
181 3300005328 Ga0070676_10022250 Ga0070676_100222502 250
182 3300005340 Ga0070689_100187733 Ga0070689_1001877332 250
183 3300005353 Ga0070669_100010952 Ga0070669_1000109522 250
184 3300005354 Ga0070675_100013307 Ga0070675_1000133073 250
185 3300005364 Ga0070673_100015350 Ga0070673_1000153502 250
186 3300005365 Ga0070688_100003984 Ga0070688_1000039844 250
187 3300005365 Ga0070688_100205578 Ga0070688_1002055782 250
188 3300005367 Ga0070667_100144505 Ga0070667_1001445052 250
189 3300005468 Ga0070707_100186458 Ga0070707_1001864581 250
190 3300005471 Ga0070698_100002526 Ga0070698_1000025267 250
191 3300005471 Ga0070698_100040660 Ga0070698_1000406602 250
192 3300005543 Ga0070672_100078832 Ga0070672_1000788322 250
193 3300005577 Ga0068857_100266755 Ga0068857_1002667553 250
194 3300005719 Ga0068861_100032735 Ga0068861_1000327353 250
195 3300005843 Ga0068860_100367088 Ga0068860_1003670882 250
196 3300005844 Ga0068862_100079893 Ga0068862_1000798932 250
197 3300006880 Ga0075429_100003548 Ga0075429_1000035484 250
198 3300009093 Ga0105240_10493594 Ga0105240_104935942 250
199 3300009094 Ga0111539_10410395 Ga0111539_104103952 250
200 3300009147 Ga0114129_10073897 Ga0114129_100738974 250
201 3300009176 Ga0105242_10123393 Ga0105242_101233933 250
202 3300009553 Ga0105249_10060200 Ga0105249_100602002 250
203 3300013308 Ga0157375_10089257 Ga0157375_100892572 250
204 3300014326 Ga0157380_10025683 Ga0157380_100256832 250
205 3300014326 Ga0157380_10085524 Ga0157380_100855242 250
206 3300025907 Ga0207645_10100913 Ga0207645_101009132 250
207 3300025908 Ga0207643_10013309 Ga0207643_100133092 250
208 3300025913 Ga0207695_10410510 Ga0207695_104105101 250
209 3300025923 Ga0207681_10022092 Ga0207681_100220923 250
210 3300025926 Ga0207659_10050620 Ga0207659_100506202 250
211 3300025933 Ga0207706_10076740 Ga0207706_100767402 250
212 3300025936 Ga0207670_10117457 Ga0207670_101174572 250
213 3300025942 Ga0207689_10110592 Ga0207689_101105922 250
214 3300025960 Ga0207651_10032694 Ga0207651_100326942 250
215 3300025986 Ga0207658_10271270 Ga0207658_102712702 250
216 3300026075 Ga0207708_10037682 Ga0207708_100376822 250
217 3300026116 Ga0207674_10033960 Ga0207674_100339603 250
218 3300026118 Ga0207675_100000496 Ga0207675_1000004968 250
219 3300028380 Ga0268265_10025074 Ga0268265_100250742 250
220 3300041408 Ga0439453_0012524 Ga0439453_0012524_570_1337 250
221 3300050507 nmdc:mga05p37_64001_c1 nmdc:mga05p37_64001_c1_3139_3906 250
222 3300050508 nmdc:mga09592_219058_c1 nmdc:mga09592_219058_c1_489_1280 250
223 3300050511 nmdc:mga08y16_285172_c1 nmdc:mga08y16_285172_c1_88_882 250
224 3300050511 nmdc:mga08y16_35045_c1 nmdc:mga08y16_35045_c1_499_1251 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

30

180

0.88

PF12804

NTP_transf_3

MobA-like NTP transferase domain

31

193

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hhd-assembly1.cif.gz_B crystal structure of pamuru 0.8877 14 250
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8818 14 248
8hhd-assembly1.cif.gz_B crystal structure of pamuru 0.8765 14 250
7d74-assembly1.cif.gz_G cryo-em structure of gmppa/gmppb complex bound to gtp (state ii) 0.8731 14 249
7d72-assembly1.cif.gz_F cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose 0.8707 14 249
ID Description Score Start End Superfamily
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8869 14 249 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8702 14 247 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8691 14 248 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8502 14 248 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8463 14 236 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A537I183-F1-model_v4 Nucleotidyltransferase family protein 0.9987 14 250 GO:0009058
GO:0016779
AF-A0A7C4U713-F1-model_v4 Nucleotidyltransferase family protein 0.9984 14 108 GO:0009058
GO:0016779
AF-A0A4Q3RYF2-F1-model_v4 Nucleotidyltransferase family protein 0.9952 14 131 GO:0005525
GO:0009058
GO:0016740
AF-A0A4Q3BLY6-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9941 14 141 GO:0009058
GO:0016779
AF-A0A4Q5W1W7-F1-model_v4 deleted 0.9908 14 220

Feature Viewer

pLDDT pTM Quality
93.87 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map