F336308

General Info

Members Datasets Scaffolds Average Seq Length
224 147 448 235

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100055859|Ga0070683_1000558593
Length 263
Sequence MDEGSGLRAIRRGLRKHTIEKAYLHSMTTIYHPASQRGHVNFGWLDSHHSFSFGNWHDREKVQFGALRVLNDDIVKGGRGFDGHPHENMEIISIPLKGALAHKDSTGTNGIIYTGDVQLMSAGSGITHSEYNASHYDDVNFLQIWIFPRQNGGKPRHEQKSFDPALRAGRWQVIVSPRPEDGALRINQDARLALAKLSAGSTLEYRPVFEGNGVYIFVVEGEAEAGGQVLQRRDGLGISGADVVTVHAVSRADVMAIEVPMFG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
139 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
142 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
143 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
144 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
145 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
146 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
147 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.98
Metatranscriptomes 0.89
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.91
Nodule 0
Rhizoplane 2.23
Rhizosphere 85.27
Stem 0
Stem Tuber 0
Unclassified 10.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100055859 3300005329 Bacteria 3665
2 JGI24739J22299_10014006 3300001989 Bacteria 2920
3 rootH2_10006783 3300003320 Bacteria 50422
4 rootH2_10006784 3300003320 Bacteria 15108
5 rootH2_10014049 3300003320 Bacteria 28938
6 rootH2_10040325 3300003320 Bacteria 10887
7 rootH2_10263525 3300003320 Bacteria 1415
8 rootL2_10097675 3300003322 Bacteria 4013
9 rootH1_10273514 3300003323 Bacteria 4200
10 Ga0070676_10481744 3300005328 Bacteria 878
11 Ga0070690_100075413 3300005330 Bacteria 2198
12 Ga0070670_100077158 3300005331 Bacteria 2863
13 Ga0070670_100191926 3300005331 Bacteria 1774
14 Ga0070666_10130662 3300005335 Bacteria 1745
15 Ga0068868_100040232 3300005338 Bacteria 3638
16 Ga0068868_100063872 3300005338 Unclassified 2921
17 Ga0070691_10063579 3300005341 Bacteria 1779
18 Ga0070675_100016076 3300005354 Bacteria 5931
19 Ga0070671_100538287 3300005355 Bacteria 1007
20 Ga0070671_100550815 3300005355 Unclassified 994
21 Ga0070671_100797168 3300005355 Bacteria 822
22 Ga0070674_100237277 3300005356 Bacteria 1426
23 Ga0070673_100499336 3300005364 Bacteria 1100
24 Ga0070673_100508204 3300005364 Bacteria 1091
25 Ga0070667_100017901 3300005367 Bacteria 5873
26 Ga0070667_100506150 3300005367 Bacteria 1107
27 Ga0070700_100532686 3300005441 Bacteria 909
28 Ga0070678_100532156 3300005456 Bacteria 1041
29 Ga0070681_10032329 3300005458 Bacteria 5250
30 Ga0070685_10012670 3300005466 Unclassified 4435
31 Ga0070684_100024748 3300005535 Bacteria 5039
32 Ga0068853_100004903 3300005539 Bacteria 10413
33 Ga0068853_100644001 3300005539 Bacteria 1008
34 Ga0070672_100107212 3300005543 Bacteria 2273
35 Ga0070686_100009764 3300005544 Bacteria 5393
36 Ga0070665_100000002 3300005548 Bacteria 849037
37 Ga0068855_100000439 3300005563 Bacteria 51399
38 Ga0068855_100005589 3300005563 Bacteria 15343
39 Ga0070664_100048990 3300005564 Unclassified 3572
40 Ga0068857_100020428 3300005577 Bacteria 5824
41 Ga0068854_100163230 3300005578 Bacteria 1727
42 Ga0068856_100034901 3300005614 Bacteria 4928
43 Ga0070702_100019944 3300005615 Unclassified 3505
44 Ga0068852_100018048 3300005616 Bacteria 5550
45 Ga0068852_100057613 3300005616 Bacteria 3362
46 Ga0068852_100384215 3300005616 Bacteria 1378
47 Ga0068864_100135141 3300005618 Bacteria 2219
48 Ga0068864_100339454 3300005618 Bacteria 1415
49 Ga0068863_100021719 3300005841 Bacteria 6123
50 Ga0068863_100056148 3300005841 Bacteria 3728
51 Ga0068858_100573478 3300005842 Unclassified 1093
52 Ga0068858_100782898 3300005842 Bacteria 930
53 Ga0068860_100000003 3300005843 Bacteria 575741
54 Ga0068860_100010996 3300005843 Bacteria 8923
55 Ga0068860_100713150 3300005843 Bacteria 1013
56 Ga0081540_1030856 3300005983 Bacteria 2960
57 Ga0097621_100000134 3300006237 Bacteria 43683
58 Ga0097621_100191339 3300006237 Bacteria 1772
59 Ga0097621_100233583 3300006237 Unclassified 1606
60 Ga0105240_10000367 3300009093 Bacteria 84666
61 Ga0105240_10000457 3300009093 Bacteria 75275
62 Ga0105240_10000487 3300009093 Bacteria 73453
63 Ga0105240_10034144 3300009093 Bacteria 6565
64 Ga0105240_10062966 3300009093 Bacteria 4616
65 Ga0105240_10164673 3300009093 Bacteria 2631
66 Ga0105240_10172479 3300009093 Bacteria 2560
67 Ga0105241_10000213 3300009174 Bacteria 43667
68 Ga0105241_10997562 3300009174 Bacteria 783
69 Ga0105248_10002784 3300009177 Bacteria 19436
70 Ga0105237_10000729 3300009545 Bacteria 45381
71 Ga0105237_10014498 3300009545 Bacteria 8238
72 Ga0105237_10027942 3300009545 Bacteria 5749
73 Ga0105237_10273335 3300009545 Bacteria 1692
74 Ga0105237_10577221 3300009545 Bacteria 1131
75 Ga0105238_10001981 3300009551 Bacteria 20624
76 Ga0105238_10012932 3300009551 Bacteria 8423
77 Ga0105238_10194622 3300009551 Bacteria 2003
78 Ga0105249_10087513 3300009553 Unclassified 2907
79 Ga0105249_10269552 3300009553 Bacteria 1695
80 Ga0105239_10000106 3300010375 Bacteria 117256
81 Ga0105239_10000252 3300010375 Bacteria 80006
82 Ga0105239_10001438 3300010375 Bacteria 31747
83 Ga0105239_10020719 3300010375 Bacteria 7253
84 Ga0105246_10016419 3300011119 Bacteria 4689
85 Ga0105246_10563607 3300011119 Unclassified 978
86 Ga0157370_10016829 3300013104 Bacteria 7391
87 Ga0157370_10028597 3300013104 Bacteria 5481
88 Ga0157369_10028804 3300013105 Bacteria 6142
89 Ga0157369_10461773 3300013105 Bacteria 1315
90 Ga0157374_10000013 3300013296 Bacteria 461240
91 Ga0157374_10316128 3300013296 Bacteria 1547
92 Ga0157378_10007403 3300013297 Bacteria 9589
93 Ga0157378_10047334 3300013297 Bacteria 3824
94 Ga0157378_10077863 3300013297 Unclassified 2989
95 Ga0163162_10000518 3300013306 Bacteria 35823
96 Ga0163162_10000833 3300013306 Bacteria 28693
97 Ga0163162_10000952 3300013306 Bacteria 26875
98 Ga0163162_10145318 3300013306 Bacteria 2487
99 Ga0157372_10015643 3300013307 Bacteria 8135
100 Ga0157372_10021383 3300013307 Bacteria 6990
101 Ga0157372_10022927 3300013307 Bacteria 6762
102 Ga0157375_10000073 3300013308 Bacteria 105972
103 Ga0157375_10208085 3300013308 Bacteria 2113
104 Ga0157375_10945594 3300013308 Bacteria 1004
105 Ga0163163_10000129 3300014325 Bacteria 77897
106 Ga0157377_10575276 3300014745 Unclassified 800
107 Ga0157379_10052653 3300014968 Bacteria 3636
108 Ga0157376_10000392 3300014969 Bacteria 28423
109 Ga0163161_10001343 3300017792 Bacteria 18304
110 Ga0163161_10063204 3300017792 Bacteria 2698
111 Ga0209436_100411 3300025208 Bacteria 19272
112 Ga0209130_1002050 3300025284 Bacteria 10941
113 Ga0207426_1000114 3300025302 Bacteria 228273
114 Ga0207680_10034090 3300025903 Bacteria 2910
115 Ga0207680_10466393 3300025903 Bacteria 897
116 Ga0207647_10023610 3300025904 Bacteria 4066
117 Ga0207647_10057068 3300025904 Bacteria 2394
118 Ga0207645_10015568 3300025907 Bacteria 5050
119 Ga0207654_10128333 3300025911 Bacteria 1602
120 Ga0207707_10041019 3300025912 Bacteria 4042
121 Ga0207695_10000051 3300025913 Bacteria 399641
122 Ga0207695_10000056 3300025913 Bacteria 382433
123 Ga0207695_10000066 3300025913 Bacteria 334103
124 Ga0207695_10000081 3300025913 Bacteria 284797
125 Ga0207695_10000156 3300025913 Bacteria 204576
126 Ga0207695_10000550 3300025913 Bacteria 77346
127 Ga0207695_10000778 3300025913 Bacteria 60342
128 Ga0207695_10018593 3300025913 Bacteria 8028
129 Ga0207695_10028601 3300025913 Bacteria 6174
130 Ga0207671_10001002 3300025914 Bacteria 34718
131 Ga0207671_10004322 3300025914 Bacteria 13653
132 Ga0207671_10374029 3300025914 Bacteria 1131
133 Ga0207694_10008991 3300025924 Bacteria 7542
134 Ga0207694_10288160 3300025924 Bacteria 1350
135 Ga0207650_10032904 3300025925 Unclassified 3753
136 Ga0207650_10114445 3300025925 Bacteria 2092
137 Ga0207644_10732250 3300025931 Bacteria 825
138 Ga0207691_10006412 3300025940 Bacteria 11367
139 Ga0207711_10019436 3300025941 Bacteria 5656
140 Ga0207661_10039791 3300025944 Bacteria 3692
141 Ga0207667_10002276 3300025949 Bacteria 24135
142 Ga0207667_10004294 3300025949 Bacteria 17462
143 Ga0207667_10005531 3300025949 Bacteria 15419
144 Ga0207651_10051506 3300025960 Unclassified 2802
145 Ga0207651_10384284 3300025960 Bacteria 1190
146 Ga0207712_10060786 3300025961 Bacteria 2679
147 Ga0207640_10138753 3300025981 Bacteria 1769
148 Ga0207658_10615947 3300025986 Bacteria 976
149 Ga0207677_10031797 3300026023 Unclassified 3384
150 Ga0207703_10591117 3300026035 Bacteria 1049
151 Ga0207703_10732840 3300026035 Unclassified 941
152 Ga0207639_10017145 3300026041 Bacteria 5132
153 Ga0207708_10335144 3300026075 Unclassified 1238
154 Ga0207702_10152637 3300026078 Bacteria 2102
155 Ga0207641_10015293 3300026088 Bacteria 6290
156 Ga0207641_10056861 3300026088 Bacteria 3326
157 Ga0207676_10130123 3300026095 Bacteria 2139
158 Ga0207674_10029750 3300026116 Bacteria 5747
159 Ga0207698_10001444 3300026142 Bacteria 13813
160 Ga0268266_10000022 3300028379 Bacteria 508060
161 Ga0268264_10000082 3300028381 Bacteria 246913
162 Ga0268264_10015456 3300028381 Bacteria 6258
163 Ga0268264_11303632 3300028381 Bacteria 736
164 Ga0265318_10019851 3300028577 Bacteria 2720
165 Ga0307517_10005192 3300028786 Bacteria 19741
166 Ga0307511_10000027 3300030521 Bacteria 109500
167 Ga0265320_10011465 3300031240 Bacteria 5215
168 Ga0265329_10031533 3300031242 Bacteria 1721
169 Ga0265339_10054184 3300031249 Bacteria 2179
170 Ga0265331_10008697 3300031250 Bacteria 5754
171 Ga0265327_10011416 3300031251 Bacteria 6116
172 Ga0265316_10019847 3300031344 Bacteria 5738
173 Ga0307516_10000869 3300031730 Bacteria 41512
174 Ga0307516_10032058 3300031730 Bacteria 5293
175 Ga0307414_10013088 3300032004 Bacteria 4929
176 Ga0307510_10007386 3300033180 Bacteria 13103
177 Ga0316586_1011628 3300033527 Bacteria 1352
178 Ga0316582_0555444 3300036647 Bacteria 791
179 Ga0316584_0167039 3300036712 Bacteria 1634
180 Ga0395905_0000023 3300037471 Bacteria 319640
181 Ga0466972_0003322 3300044658 Bacteria 7976
182 Ga0453683_0419324 3300044673 Bacteria 864
183 Ga0466961_0009124 3300044693 Bacteria 6317
184 Ga0466964_0237805 3300044706 Unclassified 892
185 Ga0453684_0024915 3300044712 Bacteria 8711
186 Ga0466971_0006825 3300044719 Bacteria 4967
187 Ga0466970_0197309 3300044765 Bacteria 1119
188 Ga0466959_0000446 3300045049 Bacteria 24054
189 Ga0451576_0489826 3300045051 Bacteria 1291
190 Ga0495638_0105281 3300046460 Unclassified 1681
191 Ga0495638_0220212 3300046460 Bacteria 1061
192 Ga0495664_0274627 3300046477 Unclassified 1018
193 Ga0495606_0012416 3300046507 Bacteria 6832
194 Ga0495648_0000879 3300046524 Bacteria 31662
195 Ga0495611_0000315 3300046648 Bacteria 32408
196 Ga0495625_0237686 3300046660 Unclassified 1187
197 Ga0495687_000179 3300047443 Bacteria 92387
198 Ga0495686_0000010 3300047472 Bacteria 573229
199 Ga0495686_0003145 3300047472 Bacteria 14569
200 Ga0496101_0015543 3300048904 Bacteria 5133
201 Ga0496105_0491472 3300048908 Bacteria 964
202 Ga0496114_0167333 3300048917 Bacteria 1914
203 Ga0496115_0217692 3300048918 Unclassified 1576
204 Ga0501312_005118 3300049528 Bacteria 1579
205 Ga0501034_0047800 3300049571 Bacteria 4319
206 Ga0501047_0357907 3300049581 Bacteria 1296
207 Ga0501071_0161451 3300049587 Bacteria 1675
208 Ga0501075_0418898 3300049591 Bacteria 1021
209 Ga0501044_0043520 3300049823 Bacteria 4664
210 Ga0500646_0008610 3300053090 Bacteria 2612
211 Ga0500583_0006000 3300053092 Bacteria 4133
212 Ga0500562_010977 3300053108 Bacteria 2299
213 Ga0500642_0174122 3300053130 Bacteria 1007
214 Ga0500568_0027128 3300053139 Unclassified 2397
215 Ga0500568_0041506 3300053139 Bacteria 1848
216 Ga0500588_0085878 3300053146 Unclassified 1061
217 Ga0500622_0002778 3300053156 Bacteria 12307
218 2599480813 2599185184 Bacteria 6430550
219 2819681465 2818991460 Bacteria 7595395
220 2884795309 2884791551 Bacteria 8511252
221 2919511902 2919509842 Bacteria 4104664
222 2928081709 2928078545 Bacteria 6534839
223 2928150262 2928147474 Bacteria 6512076
224 8036737340 8036736890 Bacteria 2944828
225 Ga0070683_100055859
226 JGI24739J22299_10014006
227 rootH2_10006783
228 rootH2_10006784
229 rootH2_10014049
230 rootH2_10040325
231 rootH2_10263525
232 rootL2_10097675
233 rootH1_10273514
234 Ga0070676_10481744
235 Ga0070690_100075413
236 Ga0070670_100077158
237 Ga0070670_100191926
238 Ga0070666_10130662
239 Ga0068868_100040232
240 Ga0068868_100063872
241 Ga0070691_10063579
242 Ga0070675_100016076
243 Ga0070671_100538287
244 Ga0070671_100550815
245 Ga0070671_100797168
246 Ga0070674_100237277
247 Ga0070673_100499336
248 Ga0070673_100508204
249 Ga0070667_100017901
250 Ga0070667_100506150
251 Ga0070700_100532686
252 Ga0070678_100532156
253 Ga0070681_10032329
254 Ga0070685_10012670
255 Ga0070684_100024748
256 Ga0068853_100004903
257 Ga0068853_100644001
258 Ga0070672_100107212
259 Ga0070686_100009764
260 Ga0070665_100000002
261 Ga0068855_100000439
262 Ga0068855_100005589
263 Ga0070664_100048990
264 Ga0068857_100020428
265 Ga0068854_100163230
266 Ga0068856_100034901
267 Ga0070702_100019944
268 Ga0068852_100018048
269 Ga0068852_100057613
270 Ga0068852_100384215
271 Ga0068864_100135141
272 Ga0068864_100339454
273 Ga0068863_100021719
274 Ga0068863_100056148
275 Ga0068858_100573478
276 Ga0068858_100782898
277 Ga0068860_100000003
278 Ga0068860_100010996
279 Ga0068860_100713150
280 Ga0081540_1030856
281 Ga0097621_100000134
282 Ga0097621_100191339
283 Ga0097621_100233583
284 Ga0105240_10000367
285 Ga0105240_10000457
286 Ga0105240_10000487
287 Ga0105240_10034144
288 Ga0105240_10062966
289 Ga0105240_10164673
290 Ga0105240_10172479
291 Ga0105241_10000213
292 Ga0105241_10997562
293 Ga0105248_10002784
294 Ga0105237_10000729
295 Ga0105237_10014498
296 Ga0105237_10027942
297 Ga0105237_10273335
298 Ga0105237_10577221
299 Ga0105238_10001981
300 Ga0105238_10012932
301 Ga0105238_10194622
302 Ga0105249_10087513
303 Ga0105249_10269552
304 Ga0105239_10000106
305 Ga0105239_10000252
306 Ga0105239_10001438
307 Ga0105239_10020719
308 Ga0105246_10016419
309 Ga0105246_10563607
310 Ga0157370_10016829
311 Ga0157370_10028597
312 Ga0157369_10028804
313 Ga0157369_10461773
314 Ga0157374_10000013
315 Ga0157374_10316128
316 Ga0157378_10007403
317 Ga0157378_10047334
318 Ga0157378_10077863
319 Ga0163162_10000518
320 Ga0163162_10000833
321 Ga0163162_10000952
322 Ga0163162_10145318
323 Ga0157372_10015643
324 Ga0157372_10021383
325 Ga0157372_10022927
326 Ga0157375_10000073
327 Ga0157375_10208085
328 Ga0157375_10945594
329 Ga0163163_10000129
330 Ga0157377_10575276
331 Ga0157379_10052653
332 Ga0157376_10000392
333 Ga0163161_10001343
334 Ga0163161_10063204
335 Ga0209436_100411
336 Ga0209130_1002050
337 Ga0207426_1000114
338 Ga0207680_10034090
339 Ga0207680_10466393
340 Ga0207647_10023610
341 Ga0207647_10057068
342 Ga0207645_10015568
343 Ga0207654_10128333
344 Ga0207707_10041019
345 Ga0207695_10000051
346 Ga0207695_10000056
347 Ga0207695_10000066
348 Ga0207695_10000081
349 Ga0207695_10000156
350 Ga0207695_10000550
351 Ga0207695_10000778
352 Ga0207695_10018593
353 Ga0207695_10028601
354 Ga0207671_10001002
355 Ga0207671_10004322
356 Ga0207671_10374029
357 Ga0207694_10008991
358 Ga0207694_10288160
359 Ga0207650_10032904
360 Ga0207650_10114445
361 Ga0207644_10732250
362 Ga0207691_10006412
363 Ga0207711_10019436
364 Ga0207661_10039791
365 Ga0207667_10002276
366 Ga0207667_10004294
367 Ga0207667_10005531
368 Ga0207651_10051506
369 Ga0207651_10384284
370 Ga0207712_10060786
371 Ga0207640_10138753
372 Ga0207658_10615947
373 Ga0207677_10031797
374 Ga0207703_10591117
375 Ga0207703_10732840
376 Ga0207639_10017145
377 Ga0207708_10335144
378 Ga0207702_10152637
379 Ga0207641_10015293
380 Ga0207641_10056861
381 Ga0207676_10130123
382 Ga0207674_10029750
383 Ga0207698_10001444
384 Ga0268266_10000022
385 Ga0268264_10000082
386 Ga0268264_10015456
387 Ga0268264_11303632
388 Ga0265318_10019851
389 Ga0307517_10005192
390 Ga0307511_10000027
391 Ga0265320_10011465
392 Ga0265329_10031533
393 Ga0265339_10054184
394 Ga0265331_10008697
395 Ga0265327_10011416
396 Ga0265316_10019847
397 Ga0307516_10000869
398 Ga0307516_10032058
399 Ga0307414_10013088
400 Ga0307510_10007386
401 Ga0316586_1011628
402 Ga0316582_0555444
403 Ga0316584_0167039
404 Ga0395905_0000023
405 Ga0466972_0003322
406 Ga0453683_0419324
407 Ga0466961_0009124
408 Ga0466964_0237805
409 Ga0453684_0024915
410 Ga0466971_0006825
411 Ga0466970_0197309
412 Ga0466959_0000446
413 Ga0451576_0489826
414 Ga0495638_0105281
415 Ga0495638_0220212
416 Ga0495664_0274627
417 Ga0495606_0012416
418 Ga0495648_0000879
419 Ga0495611_0000315
420 Ga0495625_0237686
421 Ga0495687_000179
422 Ga0495686_0000010
423 Ga0495686_0003145
424 Ga0496101_0015543
425 Ga0496105_0491472
426 Ga0496114_0167333
427 Ga0496115_0217692
428 Ga0501312_005118
429 Ga0501034_0047800
430 Ga0501047_0357907
431 Ga0501071_0161451
432 Ga0501075_0418898
433 Ga0501044_0043520
434 Ga0500646_0008610
435 Ga0500583_0006000
436 Ga0500562_010977
437 Ga0500642_0174122
438 Ga0500568_0027128
439 Ga0500568_0041506
440 Ga0500588_0085878
441 Ga0500622_0002778
442 2599480813
443 2819681465
444 2884795309
445 2919511902
446 2928081709
447 2928150262
448 8036737340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

173

259

0.98

PF02678

Pirin

Pirin

31

146

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9651 2 236
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9602 2 236
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9562 2 236
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9491 2 236
4oi1-assembly1.cif.gz_A clp1 bound to ssrna dinucleotide gc, adp, alf4-, and mg2+(transition state, data set ii) 0.841 166 230
ID Description Score Start End Superfamily
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9896 14 132 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9853 12 136 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9773 12 136 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9733 14 132 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9592 41 123 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A519N3J2-F1-model_v4 Pirin family protein 0.9972 1 113
AF-A0A354XYT3-F1-model_v4 Pirin N-terminal domain-containing protein 0.9954 1 135
AF-A0A554SEH3-F1-model_v4 deleted 0.9953 1 236
AF-A0A4P1AUL0-F1-model_v4 deleted 0.9949 6 136
AF-A0A2D0J2C0-F1-model_v4 Quercetin 2,3-dioxygenase 0.9945 6 121 GO:0051213

Map