F336068

General Info

Members Datasets Scaffolds Average Seq Length
223 173 447 82

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_164528_c1|nmdc:mga06r32_164528_c1_888_1172
Length 94
Sequence MLELRPNCECCDRDLPPDAPDAMICSFECTFCRSCVEERLGGRCPNCGGGLVPRPIRPADRLVRYPASTRRVVKPEGCRHVAESARPAGAALAR

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
110 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
111 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
112 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
113 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
114 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
115 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
166 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
167 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
168 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.45
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.56
Nodule 0
Rhizoplane 1.35
Rhizosphere 81.17
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_164528_c1 3300050510 Bacteria 2201
2 JGI24742J22300_10003696 3300002244 Bacteria 2484
3 rootH1_10052156 3300003316 Bacteria 3629
4 rootH1_10040086 3300003316 Bacteria 1051
5 rootH1_10040086 3300003323 Bacteria 5857
6 Ga0065712_10452927 3300005290 Bacteria 684
7 Ga0065715_10778342 3300005293 Bacteria 619
8 Ga0070670_100181469 3300005331 Bacteria 1828
9 Ga0068869_100271564 3300005334 Bacteria 1361
10 Ga0068869_100656781 3300005334 Bacteria 891
11 Ga0068868_100718373 3300005338 Bacteria 895
12 Ga0070689_100463713 3300005340 Bacteria 1080
13 Ga0070661_101741089 3300005344 Unclassified 528
14 Ga0070668_101835997 3300005347 Bacteria 558
15 Ga0070675_101433544 3300005354 Bacteria 637
16 Ga0070674_100006418 3300005356 Bacteria 6860
17 Ga0070674_101254033 3300005356 Bacteria 660
18 Ga0070673_100193354 3300005364 Bacteria 1749
19 Ga0070688_100426440 3300005365 Bacteria 987
20 Ga0070701_10986160 3300005438 Unclassified 587
21 Ga0070700_100131328 3300005441 Bacteria 1690
22 Ga0070663_102013509 3300005455 Bacteria 520
23 Ga0070678_100002307 3300005456 Bacteria 10409
24 Ga0070681_10841873 3300005458 Bacteria 835
25 Ga0068867_100039887 3300005459 Bacteria 3424
26 Ga0068867_101109432 3300005459 Bacteria 723
27 Ga0070685_10787479 3300005466 Bacteria 700
28 Ga0070693_100562245 3300005547 Bacteria 818
29 Ga0070704_100255630 3300005549 Bacteria 1441
30 Ga0068855_100116170 3300005563 Bacteria 3067
31 Ga0068855_102252248 3300005563 Bacteria 546
32 Ga0068857_100136173 3300005577 Bacteria 2217
33 Ga0068856_101378759 3300005614 Bacteria 720
34 Ga0068852_100763851 3300005616 Bacteria 979
35 Ga0068859_100081832 3300005617 Bacteria 3271
36 Ga0068859_100371915 3300005617 Bacteria 1525
37 Ga0068864_100010077 3300005618 Bacteria 7804
38 Ga0068870_10057939 3300005840 Bacteria 2073
39 Ga0068870_10369766 3300005840 Bacteria 925
40 Ga0068858_100400358 3300005842 Bacteria 1319
41 Ga0068860_100549979 3300005843 Bacteria 1156
42 Ga0075365_10029820 3300006038 Bacteria 3489
43 Ga0075365_10038460 3300006038 Bacteria 3110
44 Ga0075365_10122863 3300006038 Bacteria 1792
45 Ga0075365_10479835 3300006038 Bacteria 878
46 Ga0075365_10511333 3300006038 Bacteria 849
47 Ga0075363_100070107 3300006048 Bacteria 1903
48 Ga0075363_100345987 3300006048 Bacteria 868
49 Ga0075364_10011465 3300006051 Bacteria 5383
50 Ga0075364_10014298 3300006051 Bacteria 4902
51 Ga0075364_10593505 3300006051 Bacteria 757
52 Ga0075362_10020092 3300006177 Bacteria 2787
53 Ga0075370_10126810 3300006353 Bacteria 1488
54 Ga0075370_10280071 3300006353 Bacteria 990
55 Ga0075430_100898546 3300006846 Bacteria 730
56 Ga0068865_100785759 3300006881 Bacteria 820
57 Ga0068865_101846581 3300006881 Bacteria 547
58 Ga0097620_100081833 3300006931 Bacteria 3271
59 Ga0097620_100371917 3300006931 Bacteria 1525
60 Ga0105240_10825521 3300009093 Bacteria 1002
61 Ga0111539_11957359 3300009094 Bacteria 680
62 Ga0105245_10168508 3300009098 Bacteria 2084
63 Ga0105245_13180739 3300009098 Bacteria 509
64 Ga0105247_10026783 3300009101 Bacteria 3484
65 Ga0105243_10000082 3300009148 Bacteria 108252
66 Ga0105243_10097097 3300009148 Bacteria 2438
67 Ga0105243_10436721 3300009148 Bacteria 1225
68 Ga0105243_12436684 3300009148 Bacteria 562
69 Ga0105241_10059747 3300009174 Bacteria 2932
70 Ga0105242_12907656 3300009176 Bacteria 529
71 Ga0105248_10424706 3300009177 Bacteria 1497
72 Ga0099796_10591211 3300010159 Unclassified 500
73 Ga0105239_11594473 3300010375 Bacteria 755
74 Ga0105246_10041448 3300011119 Bacteria 3112
75 Ga0105246_10138627 3300011119 Bacteria 1826
76 Ga0157374_10546739 3300013296 Bacteria 1165
77 Ga0163162_10093402 3300013306 Bacteria 3093
78 Ga0157375_10282978 3300013308 Bacteria 1821
79 Ga0157375_11243914 3300013308 Bacteria 874
80 Ga0163163_10000055 3300014325 Bacteria 125341
81 Ga0157380_10573747 3300014326 Bacteria 1111
82 Ga0157379_10000131 3300014968 Bacteria 53172
83 Ga0157376_10467146 3300014969 Bacteria 1234
84 Ga0213874_10160232 3300021377 Bacteria 790
85 Ga0213875_10077805 3300021388 Bacteria 1548
86 Ga0207710_10023264 3300025900 Bacteria 2663
87 Ga0207645_10216305 3300025907 Bacteria 1262
88 Ga0207645_10569066 3300025907 Bacteria 769
89 Ga0207643_10395649 3300025908 Bacteria 873
90 Ga0207654_10012606 3300025911 Bacteria 4334
91 Ga0207707_10321363 3300025912 Bacteria 1336
92 Ga0207695_11435724 3300025913 Bacteria 570
93 Ga0207660_11663834 3300025917 Bacteria 514
94 Ga0207662_10542240 3300025918 Bacteria 805
95 Ga0207650_10111860 3300025925 Bacteria 2115
96 Ga0207659_11740637 3300025926 Bacteria 530
97 Ga0207709_10000083 3300025935 Bacteria 163025
98 Ga0207709_10115026 3300025935 Bacteria 1806
99 Ga0207709_11118769 3300025935 Bacteria 647
100 Ga0207670_10411052 3300025936 Bacteria 1084
101 Ga0207669_10000061 3300025937 Bacteria 54347
102 Ga0207669_11017944 3300025937 Bacteria 697
103 Ga0207704_10636669 3300025938 Bacteria 877
104 Ga0207689_10245586 3300025942 Bacteria 1480
105 Ga0207689_10451757 3300025942 Bacteria 1074
106 Ga0207689_11027232 3300025942 Bacteria 695
107 Ga0207651_10388498 3300025960 Bacteria 1184
108 Ga0207668_11895528 3300025972 Bacteria 537
109 Ga0207640_10009325 3300025981 Bacteria 5489
110 Ga0207658_10993084 3300025986 Bacteria 766
111 Ga0207677_10484857 3300026023 Bacteria 1066
112 Ga0207703_10246478 3300026035 Bacteria 1608
113 Ga0207708_11646367 3300026075 Bacteria 564
114 Ga0207641_10273840 3300026088 Bacteria 1585
115 Ga0207648_10059524 3300026089 Bacteria 3331
116 Ga0207648_11071413 3300026089 Bacteria 756
117 Ga0207676_10008313 3300026095 Bacteria 7376
118 Ga0207674_10063716 3300026116 Bacteria 3720
119 Ga0207683_10002842 3300026121 Bacteria 15119
120 Ga0207683_10585346 3300026121 Bacteria 1032
121 Ga0209971_1186641 3300027682 Bacteria 511
122 Ga0268266_10000002 3300028379 Bacteria 3059047
123 Ga0268265_10643779 3300028380 Bacteria 1018
124 Ga0307517_10040447 3300028786 Bacteria 5075
125 Ga0265338_10154826 3300028800 Bacteria 1777
126 Ga0265338_10301042 3300028800 Bacteria 1166
127 Ga0265771_1018281 3300031010 Bacteria 587
128 Ga0265327_10094935 3300031251 Bacteria 1448
129 Ga0316575_10381250 3300031665 Bacteria 603
130 Ga0307410_10771051 3300031852 Bacteria 816
131 Ga0307409_100306499 3300031995 Bacteria 1480
132 Ga0307416_101322465 3300032002 Bacteria 827
133 Ga0307415_100297688 3300032126 Bacteria 1335
134 Ga0395905_1003997 3300037471 Bacteria 738
135 Ga0436364_1427512 3300037853 Bacteria 2234
136 Ga0395901_0098713 3300038443 Bacteria 3062
137 Ga0395901_0436645 3300038443 Bacteria 1341
138 Ga0436365_1890776 3300039437 Bacteria 990
139 Ga0436363_0827562 3300039450 Bacteria 997
140 Ga0451791_1830892 3300041451 Bacteria 810
141 Ga0451853_3280058 3300041512 Bacteria 958
142 Ga0439454_039392 3300042011 Bacteria 768
143 Ga0439456_127761 3300042013 Bacteria 585
144 Ga0439463_045239 3300042016 Bacteria 1121
145 Ga0450914_017306 3300042118 Bacteria 772
146 Ga0450902_010532 3300042137 Bacteria 1463
147 Ga0450905_042592 3300042142 Bacteria 724
148 Ga0439444_0080559 3300042437 Bacteria 712
149 Ga0439459_0026566 3300042438 Bacteria 1151
150 Ga0439460_0025890 3300042461 Bacteria 1637
151 Ga0466963_0890539 3300044694 Bacteria 627
152 Ga0466967_0303722 3300045976 Bacteria 1536
153 Ga0495638_0002872 3300046460 Bacteria 13794
154 Ga0495638_0076461 3300046460 Bacteria 2040
155 Ga0495584_0008746 3300046491 Bacteria 5236
156 Ga0495585_0542370 3300046492 Bacteria 550
157 Ga0495616_0178170 3300046513 Bacteria 946
158 Ga0495656_0212521 3300046615 Bacteria 964
159 Ga0495668_0407875 3300046616 Bacteria 747
160 Ga0495611_0163362 3300046648 Bacteria 1041
161 Ga0495670_0432227 3300046691 Bacteria 712
162 Ga0495671_0451770 3300046692 Bacteria 614
163 Ga0495686_0085015 3300047472 Bacteria 1927
164 Ga0495686_0120831 3300047472 Bacteria 1561
165 Ga0495686_0186610 3300047472 Bacteria 1198
166 Ga0496110_0431793 3300048913 Bacteria 1201
167 Ga0496112_0837134 3300048915 Bacteria 844
168 Ga0496122_0024831 3300048925 Bacteria 5233
169 Ga0496123_0032870 3300048926 Bacteria 3745
170 Ga0501034_0503744 3300049571 Bacteria 1124
171 Ga0501037_1122893 3300049573 Bacteria 508
172 Ga0501038_0018627 3300049574 Bacteria 6271
173 Ga0501038_0878987 3300049574 Bacteria 662
174 Ga0501040_0028578 3300049576 Bacteria 3760
175 Ga0501041_0026781 3300049577 Bacteria 3471
176 Ga0501042_0005299 3300049578 Bacteria 8292
177 Ga0501043_0103111 3300049579 Bacteria 2242
178 Ga0501043_0470969 3300049579 Bacteria 941
179 Ga0501046_0007374 3300049580 Bacteria 9673
180 Ga0501047_0001727 3300049581 Bacteria 21217
181 Ga0501048_0006371 3300049582 Bacteria 8970
182 Ga0501067_0080422 3300049583 Bacteria 1806
183 Ga0501070_0756252 3300049586 Bacteria 765
184 Ga0501072_0000549 3300049588 Bacteria 26969
185 Ga0501073_0029135 3300049589 Bacteria 3945
186 Ga0501073_0293582 3300049589 Bacteria 1121
187 Ga0501074_1310172 3300049590 Bacteria 507
188 Ga0501075_0000014 3300049591 Bacteria 77078
189 Ga0501075_0311921 3300049591 Bacteria 1199
190 Ga0501076_0000072 3300049592 Bacteria 50636
191 Ga0501077_0027384 3300049593 Bacteria 3620
192 Ga0501080_0011358 3300049742 Bacteria 8155
193 Ga0501080_0025137 3300049742 Bacteria 5528
194 Ga0501081_0002189 3300049743 Bacteria 12287
195 Ga0501081_0087687 3300049743 Bacteria 2186
196 Ga0501083_0022685 3300049744 Bacteria 4355
197 Ga0501083_1065541 3300049744 Bacteria 526
198 Ga0501035_0564778 3300049822 Bacteria 931
199 Ga0501044_0118649 3300049823 Bacteria 2648
200 Ga0501044_0862857 3300049823 Bacteria 781
201 nmdc:mga03683_13926_c1 3300050489 Bacteria 2967
202 nmdc:mga03n38_166031_c1 3300050490 Bacteria 1121
203 nmdc:mga03n38_369829_c1 3300050490 Bacteria 783
204 nmdc:mga00v17_170979_c1 3300050491 Bacteria 1401
205 nmdc:mga0yw44_273936_c1 3300050492 Bacteria 1127
206 nmdc:mga0yw44_296715_c1 3300050492 Bacteria 1082
207 nmdc:mga0yw44_33350_c1 3300050492 Bacteria 3008
208 nmdc:mga0yw44_37476_c1 3300050492 Bacteria 2863
209 nmdc:mga06z11_200738_c1 3300050494 Bacteria 1158
210 nmdc:mga07m45_122057_c1 3300050496 Bacteria 1505
211 nmdc:mga0qj67_854762_c1 3300050509 Bacteria 718
212 nmdc:mga06r32_1190784_c1 3300050510 Bacteria 708
213 Ga0500566_0398453 3300053094 Bacteria 617
214 Ga0500553_163835 3300053101 Bacteria 831
215 Ga0500554_004045 3300053102 Bacteria 3066
216 Ga0500614_029308 3300053123 Bacteria 1335
217 Ga0500627_0075738 3300053158 Bacteria 1495
218 Ga0501084_0000930 3300054114 Bacteria 22664
219 Ga0501084_0092028 3300054114 Bacteria 2546
220 Ga0501082_0000748 3300060353 Bacteria 28578
221 Ga0466962_0141972 3300061719 Bacteria 1163
222 Ga0530510_0000215 3300061734 Bacteria 35909
223 Ga0530510_0615494 3300061734 Bacteria 826
224 3007872169 3007872151 Bacteria 5268868
225 nmdc:mga06r32_164528_c1
226 JGI24742J22300_10003696
227 rootH1_10052156
228 rootH1_10040086
229 Ga0065712_10452927
230 Ga0065715_10778342
231 Ga0070670_100181469
232 Ga0068869_100271564
233 Ga0068869_100656781
234 Ga0068868_100718373
235 Ga0070689_100463713
236 Ga0070661_101741089
237 Ga0070668_101835997
238 Ga0070675_101433544
239 Ga0070674_100006418
240 Ga0070674_101254033
241 Ga0070673_100193354
242 Ga0070688_100426440
243 Ga0070701_10986160
244 Ga0070700_100131328
245 Ga0070663_102013509
246 Ga0070678_100002307
247 Ga0070681_10841873
248 Ga0068867_100039887
249 Ga0068867_101109432
250 Ga0070685_10787479
251 Ga0070693_100562245
252 Ga0070704_100255630
253 Ga0068855_100116170
254 Ga0068855_102252248
255 Ga0068857_100136173
256 Ga0068856_101378759
257 Ga0068852_100763851
258 Ga0068859_100081832
259 Ga0068859_100371915
260 Ga0068864_100010077
261 Ga0068870_10057939
262 Ga0068870_10369766
263 Ga0068858_100400358
264 Ga0068860_100549979
265 Ga0075365_10029820
266 Ga0075365_10038460
267 Ga0075365_10122863
268 Ga0075365_10479835
269 Ga0075365_10511333
270 Ga0075363_100070107
271 Ga0075363_100345987
272 Ga0075364_10011465
273 Ga0075364_10014298
274 Ga0075364_10593505
275 Ga0075362_10020092
276 Ga0075370_10126810
277 Ga0075370_10280071
278 Ga0075430_100898546
279 Ga0068865_100785759
280 Ga0068865_101846581
281 Ga0097620_100081833
282 Ga0097620_100371917
283 Ga0105240_10825521
284 Ga0111539_11957359
285 Ga0105245_10168508
286 Ga0105245_13180739
287 Ga0105247_10026783
288 Ga0105243_10000082
289 Ga0105243_10097097
290 Ga0105243_10436721
291 Ga0105243_12436684
292 Ga0105241_10059747
293 Ga0105242_12907656
294 Ga0105248_10424706
295 Ga0099796_10591211
296 Ga0105239_11594473
297 Ga0105246_10041448
298 Ga0105246_10138627
299 Ga0157374_10546739
300 Ga0163162_10093402
301 Ga0157375_10282978
302 Ga0157375_11243914
303 Ga0163163_10000055
304 Ga0157380_10573747
305 Ga0157379_10000131
306 Ga0157376_10467146
307 Ga0213874_10160232
308 Ga0213875_10077805
309 Ga0207710_10023264
310 Ga0207645_10216305
311 Ga0207645_10569066
312 Ga0207643_10395649
313 Ga0207654_10012606
314 Ga0207707_10321363
315 Ga0207695_11435724
316 Ga0207660_11663834
317 Ga0207662_10542240
318 Ga0207650_10111860
319 Ga0207659_11740637
320 Ga0207709_10000083
321 Ga0207709_10115026
322 Ga0207709_11118769
323 Ga0207670_10411052
324 Ga0207669_10000061
325 Ga0207669_11017944
326 Ga0207704_10636669
327 Ga0207689_10245586
328 Ga0207689_10451757
329 Ga0207689_11027232
330 Ga0207651_10388498
331 Ga0207668_11895528
332 Ga0207640_10009325
333 Ga0207658_10993084
334 Ga0207677_10484857
335 Ga0207703_10246478
336 Ga0207708_11646367
337 Ga0207641_10273840
338 Ga0207648_10059524
339 Ga0207648_11071413
340 Ga0207676_10008313
341 Ga0207674_10063716
342 Ga0207683_10002842
343 Ga0207683_10585346
344 Ga0209971_1186641
345 Ga0268266_10000002
346 Ga0268265_10643779
347 Ga0307517_10040447
348 Ga0265338_10154826
349 Ga0265338_10301042
350 Ga0265771_1018281
351 Ga0265327_10094935
352 Ga0316575_10381250
353 Ga0307410_10771051
354 Ga0307409_100306499
355 Ga0307416_101322465
356 Ga0307415_100297688
357 Ga0395905_1003997
358 Ga0436364_1427512
359 Ga0395901_0098713
360 Ga0395901_0436645
361 Ga0436365_1890776
362 Ga0436363_0827562
363 Ga0451791_1830892
364 Ga0451853_3280058
365 Ga0439454_039392
366 Ga0439456_127761
367 Ga0439463_045239
368 Ga0450914_017306
369 Ga0450902_010532
370 Ga0450905_042592
371 Ga0439444_0080559
372 Ga0439459_0026566
373 Ga0439460_0025890
374 Ga0466963_0890539
375 Ga0466967_0303722
376 Ga0495638_0002872
377 Ga0495638_0076461
378 Ga0495584_0008746
379 Ga0495585_0542370
380 Ga0495616_0178170
381 Ga0495656_0212521
382 Ga0495668_0407875
383 Ga0495611_0163362
384 Ga0495670_0432227
385 Ga0495671_0451770
386 Ga0495686_0085015
387 Ga0495686_0120831
388 Ga0495686_0186610
389 Ga0496110_0431793
390 Ga0496112_0837134
391 Ga0496122_0024831
392 Ga0496123_0032870
393 Ga0501034_0503744
394 Ga0501037_1122893
395 Ga0501038_0018627
396 Ga0501038_0878987
397 Ga0501040_0028578
398 Ga0501041_0026781
399 Ga0501042_0005299
400 Ga0501043_0103111
401 Ga0501043_0470969
402 Ga0501046_0007374
403 Ga0501047_0001727
404 Ga0501048_0006371
405 Ga0501067_0080422
406 Ga0501070_0756252
407 Ga0501072_0000549
408 Ga0501073_0029135
409 Ga0501073_0293582
410 Ga0501074_1310172
411 Ga0501075_0000014
412 Ga0501075_0311921
413 Ga0501076_0000072
414 Ga0501077_0027384
415 Ga0501080_0011358
416 Ga0501080_0025137
417 Ga0501081_0002189
418 Ga0501081_0087687
419 Ga0501083_0022685
420 Ga0501083_1065541
421 Ga0501035_0564778
422 Ga0501044_0118649
423 Ga0501044_0862857
424 nmdc:mga03683_13926_c1
425 nmdc:mga03n38_166031_c1
426 nmdc:mga03n38_369829_c1
427 nmdc:mga00v17_170979_c1
428 nmdc:mga0yw44_273936_c1
429 nmdc:mga0yw44_296715_c1
430 nmdc:mga0yw44_33350_c1
431 nmdc:mga0yw44_37476_c1
432 nmdc:mga06z11_200738_c1
433 nmdc:mga07m45_122057_c1
434 nmdc:mga0qj67_854762_c1
435 nmdc:mga06r32_1190784_c1
436 Ga0500566_0398453
437 Ga0500553_163835
438 Ga0500554_004045
439 Ga0500614_029308
440 Ga0500627_0075738
441 Ga0501084_0000930
442 Ga0501084_0092028
443 Ga0501082_0000748
444 Ga0466962_0141972
445 Ga0530510_0000215
446 Ga0530510_0615494
447 3007872169

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06906

DUF1272

Protein of unknown function (DUF1272)

1

57

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qbh-assembly2.cif.gz_B crystal structure of a stable adenylate kinase variant aklse5 0.6878 20 53
1zip-assembly1.cif.gz_A bacillus stearothermophilus adenylate kinase 0.6829 20 53
4qbi-assembly2.cif.gz_B crystal structure of a stable adenylate kinase variant aklse6 0.6798 21 53
2oo7-assembly1.cif.gz_A crystal structure of a thermostable mutant of bacillus subtilis adenylate kinase (t179i/q199r) 0.6791 20 53
4mkf-assembly2.cif.gz_B crystal structure of a stable adenylate kinase variant akv3 0.6786 20 53
ID Description Score Start End Superfamily
af_Q09476_347_411_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.7593 7 40 2.10.110.10
af_Q5M852_327_386_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.7346 7 40 2.10.110.10
af_Q54FB2_9_111_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6676 6 49 3.30.40.10
af_Q4W4Z4_1_71_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6605 6 49 3.30.40.10
af_A0A0B4K780_32_100_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6582 7 53 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A536YXV2-F1-model_v4 DUF1272 domain-containing protein 0.9977 1 58
AF-A0A3A3HA89-F1-model_v4 DUF1272 domain-containing protein 0.9945 1 77 GO:0016020
AF-A0A800AZ91-F1-model_v4 DUF1272 domain-containing protein 0.9918 1 62
AF-A0A3S0EFY4-F1-model_v4 DUF1272 domain-containing protein 0.9913 1 73
AF-A0A7Y3MCW7-F1-model_v4 DUF1272 domain-containing protein 0.9893 1 67

Map