F336042

General Info

Members Datasets Scaffolds Average Seq Length
223 164 215 269

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0310840|Ga0501075_0310840_94_972
Length 292
Sequence MPALGAGIHVFETRRTFMLDRRLLIAAVLATGFTGAALAQDKSIVVASTTSTQDSGLFGHILPLFKQKTGIDVKVVSQGTGQALDTGRRGDADVVFVHAKAQEEKFVADGFGVKRHPVMYNDFILIGPKNDPAGVKGTKDIVAALRKIKERGVPFISRGDKSGTHSAELNLWKAAGIDIANEKGPWYKEIGQGMGAALNTASAANAYVLADRGTWLSFKNRGELVIAVEGDKRLFNQYGVILVNPQKHPNVKKELGQQFIDWLISPEGQKAIADFKIEGEQLFYPNAKDESA

Samples

Sample ID Description Type Environment
1 2643221733 Bosea sp. Root381 Isolate Unclassified
2 2643221736 Bosea sp. Root483D1 Isolate Unclassified
3 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
4 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
5 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
6 2851182111 Bosea sp. Tri-44 Isolate Nodule
7 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
8 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.41
Metatranscriptomes 0
Isolates 3.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0.45
Rhizoplane 11.21
Rhizosphere 79.82
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000134 3300003203 Bacteria 32089
2 Ga0070690_100007625 3300005330 Bacteria 6200
3 Ga0070670_100177274 3300005331 Bacteria 1850
4 Ga0068869_100381243 3300005334 Bacteria 1156
5 Ga0070689_100150869 3300005340 Bacteria 1874
6 Ga0070688_100040872 3300005365 Bacteria 2844
7 Ga0070710_10046769 3300005437 Bacteria 2411
8 Ga0070711_100340857 3300005439 Bacteria 1203
9 Ga0070700_100007929 3300005441 Bacteria 5763
10 Ga0070700_100061881 3300005441 Bacteria 2363
11 Ga0070708_100155567 3300005445 Bacteria 2128
12 Ga0070685_10023088 3300005466 Bacteria 3402
13 Ga0070706_100031827 3300005467 Bacteria 4863
14 Ga0070707_100205686 3300005468 Bacteria 1918
15 Ga0070698_100011582 3300005471 Bacteria 9359
16 Ga0070698_100113417 3300005471 Bacteria 2675
17 Ga0070698_100300478 3300005471 Bacteria 1536
18 Ga0070699_100021242 3300005518 Bacteria 5598
19 Ga0070699_100316872 3300005518 Bacteria 1401
20 Ga0070697_100006015 3300005536 Bacteria 9383
21 Ga0068856_100097208 3300005614 Bacteria 2933
22 Ga0070702_100005496 3300005615 Bacteria 5912
23 Ga0068859_100025816 3300005617 Bacteria 5894
24 Ga0068861_100431649 3300005719 Bacteria 1176
25 Ga0068863_100009395 3300005841 Bacteria 9545
26 Ga0068863_100036319 3300005841 Bacteria 4694
27 Ga0068858_100000475 3300005842 Bacteria 41717
28 Ga0068858_100025404 3300005842 Bacteria 5512
29 Ga0068860_100005739 3300005843 Bacteria 12518
30 Ga0068860_100410347 3300005843 Bacteria 1341
31 Ga0081455_10000417 3300005937 Bacteria 56051
32 Ga0081455_10003757 3300005937 Bacteria 17335
33 Ga0081455_10047171 3300005937 Bacteria 3733
34 Ga0081538_10093449 3300005981 Bacteria 1544
35 Ga0081539_10000737 3300005985 Bacteria 65468
36 Ga0070717_10006980 3300006028 Bacteria 8353
37 Ga0070717_10356686 3300006028 Bacteria 1308
38 Ga0075365_10108423 3300006038 Bacteria 1907
39 Ga0075365_10206651 3300006038 Bacteria 1376
40 Ga0075363_100106706 3300006048 Bacteria 1554
41 Ga0075362_10012919 3300006177 Bacteria 3329
42 Ga0097621_100285188 3300006237 Bacteria 1454
43 Ga0068871_100078578 3300006358 Bacteria 2728
44 Ga0075428_100004950 3300006844 Bacteria 14792
45 Ga0075428_100596474 3300006844 Bacteria 1180
46 Ga0075430_100015557 3300006846 Bacteria 6476
47 Ga0075431_100000494 3300006847 Bacteria 32786
48 Ga0075431_100075721 3300006847 Bacteria 3473
49 Ga0075431_100076574 3300006847 Bacteria 3452
50 Ga0075434_100067089 3300006871 Bacteria 3575
51 Ga0075434_100429784 3300006871 Bacteria 1342
52 Ga0097620_100025816 3300006931 Bacteria 5894
53 Ga0099795_10002392 3300007788 Bacteria 4404
54 Ga0105240_10539704 3300009093 Bacteria 1292
55 Ga0111539_10001516 3300009094 Bacteria 30988
56 Ga0111539_10014716 3300009094 Bacteria 9760
57 Ga0111539_10059186 3300009094 Bacteria 4544
58 Ga0111539_10215410 3300009094 Bacteria 2237
59 Ga0111539_10333258 3300009094 Bacteria 1766
60 Ga0114129_10017710 3300009147 Bacteria 10144
61 Ga0105243_10055055 3300009148 Bacteria 3160
62 Ga0105241_10509827 3300009174 Bacteria 1074
63 Ga0105242_10011765 3300009176 Bacteria 6733
64 Ga0105248_10015365 3300009177 Bacteria 8444
65 Ga0105248_10095928 3300009177 Bacteria 3339
66 Ga0105237_10191340 3300009545 Bacteria 2046
67 Ga0105238_10060596 3300009551 Bacteria 3788
68 Ga0105238_10091542 3300009551 Bacteria 3028
69 Ga0105249_10038315 3300009553 Bacteria 4350
70 Ga0099796_10004531 3300010159 Bacteria 3374
71 Ga0157370_10255115 3300013104 Bacteria 1622
72 Ga0163162_10085464 3300013306 Bacteria 3232
73 Ga0157375_10434177 3300013308 Bacteria 1479
74 Ga0163163_10137035 3300014325 Bacteria 2489
75 Ga0157379_10021965 3300014968 Bacteria 5655
76 Ga0157376_10056408 3300014969 Bacteria 3281
77 Ga0213876_10012262 3300021384 Bacteria 4563
78 Ga0209758_1045118 3300025297 Bacteria 1603
79 Ga0207642_10036726 3300025899 Bacteria 2105
80 Ga0207710_10008717 3300025900 Bacteria 4275
81 Ga0207688_10004896 3300025901 Bacteria 7288
82 Ga0207684_10023100 3300025910 Bacteria 5311
83 Ga0207684_10040862 3300025910 Bacteria 3932
84 Ga0207663_10298899 3300025916 Bacteria 1202
85 Ga0207660_10294985 3300025917 Bacteria 1290
86 Ga0207657_10023462 3300025919 Bacteria 5743
87 Ga0207652_10101225 3300025921 Bacteria 2545
88 Ga0207646_10055030 3300025922 Bacteria 3558
89 Ga0207646_10067582 3300025922 Bacteria 3191
90 Ga0207681_10039107 3300025923 Bacteria 3147
91 Ga0207681_10254174 3300025923 Bacteria 1373
92 Ga0207664_10701472 3300025929 Bacteria 910
93 Ga0207706_10005745 3300025933 Bacteria 11553
94 Ga0207686_10008122 3300025934 Bacteria 5662
95 Ga0207670_10143997 3300025936 Bacteria 1760
96 Ga0207668_10010335 3300025972 Bacteria 5639
97 Ga0207703_10100087 3300026035 Bacteria 2455
98 Ga0207703_10285937 3300026035 Bacteria 1499
99 Ga0207678_10014733 3300026067 Bacteria 6880
100 Ga0207708_10007808 3300026075 Bacteria 7922
101 Ga0207641_10034224 3300026088 Bacteria 4225
102 Ga0207641_10174070 3300026088 Bacteria 1967
103 Ga0207648_10004699 3300026089 Bacteria 13964
104 Ga0207683_10013941 3300026121 Bacteria 6853
105 Ga0207428_10013999 3300027907 Bacteria 6987
106 Ga0268264_10055171 3300028381 Bacteria 3320
107 Ga0265340_10038992 3300031247 Bacteria 2348
108 Ga0307410_10360593 3300031852 Bacteria 1164
109 Ga0373936_0006762 3300035113 Bacteria 4316
110 Ga0373941_0003438 3300035115 Bacteria 3586
111 Ga0373931_0118103 3300035691 Bacteria 1513
112 Ga0373935_0005011 3300035692 Bacteria 7798
113 Ga0373927_0014893 3300035695 Bacteria 5144
114 Ga0373937_0167906 3300036401 Bacteria 2058
115 Ga0373925_0164813 3300037068 Bacteria 1747
116 Ga0395898_0317336 3300037466 Bacteria 1487
117 Ga0395905_0163171 3300037471 Bacteria 2094
118 Ga0395901_0112866 3300038443 Bacteria 2854
119 Ga0439453_0018347 3300041408 Bacteria 1236
120 Ga0466965_0163397 3300044683 Bacteria 1168
121 Ga0495638_0030971 3300046460 Bacteria 3440
122 Ga0495651_0153163 3300046462 Bacteria 1659
123 Ga0495584_0086128 3300046491 Bacteria 1583
124 Ga0495606_0000903 3300046507 Bacteria 44130
125 Ga0495608_0112049 3300046511 Bacteria 1754
126 Ga0495610_0025984 3300046512 Bacteria 3133
127 Ga0495640_0042582 3300046533 Bacteria 3166
128 Ga0495667_0171084 3300046559 Bacteria 1396
129 Ga0495634_0157463 3300046642 Bacteria 1434
130 Ga0495623_0115059 3300046679 Bacteria 1626
131 Ga0495669_0017358 3300046684 Bacteria 3088
132 Ga0495600_0203054 3300046809 Bacteria 1272
133 Ga0495600_0233958 3300046809 Bacteria 1172
134 Ga0495604_0047608 3300047317 Bacteria 3339
135 Ga0495674_0059610 3300047319 Bacteria 3333
136 Ga0496101_0021069 3300048904 Bacteria 4474
137 Ga0496101_0308997 3300048904 Bacteria 1239
138 Ga0496104_0056403 3300048907 Bacteria 3714
139 Ga0496104_0058140 3300048907 Bacteria 3660
140 Ga0496105_0007650 3300048908 Bacteria 8374
141 Ga0496105_0355957 3300048908 Bacteria 1168
142 Ga0496106_0006373 3300048909 Bacteria 8735
143 Ga0496107_0300856 3300048910 Bacteria 1194
144 Ga0496108_0005811 3300048911 Bacteria 10000
145 Ga0496108_0009471 3300048911 Bacteria 7886
146 Ga0496108_0072497 3300048911 Bacteria 2907
147 Ga0496109_0003711 3300048912 Bacteria 12759
148 Ga0496110_0001886 3300048913 Bacteria 15483
149 Ga0496110_0001894 3300048913 Bacteria 15456
150 Ga0496110_0375115 3300048913 Bacteria 1296
151 Ga0496111_0007231 3300048914 Bacteria 7261
152 Ga0496111_0175582 3300048914 Bacteria 1592
153 Ga0496112_0020351 3300048915 Bacteria 6289
154 Ga0496112_0067088 3300048915 Bacteria 3540
155 Ga0496112_0114072 3300048915 Bacteria 2673
156 Ga0496113_0010750 3300048916 Bacteria 6068
157 Ga0496114_0024989 3300048917 Bacteria 4878
158 Ga0496114_0377814 3300048917 Bacteria 1254
159 Ga0496115_0021662 3300048918 Bacteria 4967
160 Ga0496115_0216149 3300048918 Bacteria 1583
161 Ga0501031_0060478 3300049568 Bacteria 2468
162 Ga0501032_0275867 3300049569 Bacteria 1089
163 Ga0501033_0109734 3300049570 Bacteria 2009
164 Ga0501033_0387692 3300049570 Bacteria 975
165 Ga0501034_0053890 3300049571 Bacteria 4049
166 Ga0501034_0124109 3300049571 Bacteria 2568
167 Ga0501036_0045083 3300049572 Bacteria 3736
168 Ga0501036_0298149 3300049572 Bacteria 1348
169 Ga0501040_0316157 3300049576 Bacteria 1117
170 Ga0501046_0465314 3300049580 Bacteria 908
171 Ga0501047_0036168 3300049581 Bacteria 4771
172 Ga0501047_0312417 3300049581 Bacteria 1412
173 Ga0501048_0200912 3300049582 Bacteria 1413
174 Ga0501068_0287309 3300049584 Bacteria 1052
175 Ga0501070_0463844 3300049586 Bacteria 1020
176 Ga0501071_0052530 3300049587 Bacteria 2939
177 Ga0501072_0465283 3300049588 Bacteria 1001
178 Ga0501075_0201529 3300049591 Bacteria 1518
179 Ga0501075_0310840 3300049591 Bacteria 1201
180 Ga0501076_0069974 3300049592 Bacteria 2805
181 Ga0501076_0111148 3300049592 Bacteria 2215
182 Ga0501079_0432997 3300049741 Bacteria 1033
183 Ga0501081_0070283 3300049743 Bacteria 2440
184 Ga0501083_0003969 3300049744 Bacteria 10392
185 Ga0501035_0502080 3300049822 Bacteria 998
186 Ga0501044_0272922 3300049823 Bacteria 1626
187 Ga0501044_0465358 3300049823 Bacteria 1169
188 Ga0501045_0290651 3300049824 Bacteria 1216
189 nmdc:mga03683_60223_c2 3300050489 Bacteria 1221
190 nmdc:mga0yw44_13581_c1 3300050492 Bacteria 4293
191 nmdc:mga05p37_57_c1 3300050507 Bacteria 96042
192 nmdc:mga05p37_89990_c1 3300050507 Bacteria 3782
193 nmdc:mga0qj67_27360_c1 3300050509 Bacteria 4419
194 nmdc:mga0qj67_273805_c1 3300050509 Bacteria 1368
195 nmdc:mga0qj67_51461_c1 3300050509 Bacteria 3257
196 nmdc:mga0qj67_5657_c1 3300050509 Bacteria 9143
197 nmdc:mga06r32_15868_c1 3300050510 Bacteria 6852
198 nmdc:mga06r32_198076_c1 3300050510 Bacteria 1996
199 nmdc:mga06r32_545063_c1 3300050510 Bacteria 1134
200 nmdc:mga06r32_854_c1 3300050510 Bacteria 27030
201 nmdc:mga08y16_2485_c1 3300050511 Bacteria 18939
202 nmdc:mga08y16_425426_c1 3300050511 Bacteria 1357
203 nmdc:mga08y16_48196_c1 3300050511 Bacteria 4458
204 nmdc:mga08y16_825646_c1 3300050511 Bacteria 918
205 nmdc:mga0n895_297256_c1 3300050512 Bacteria 1637
206 nmdc:mga0n895_38960_c1 3300050512 Bacteria 4608
207 nmdc:mga0rr50_371162_c1 3300050513 Bacteria 1205
208 Ga0495601_0005229 3300053077 Bacteria 7550
209 Ga0495595_0001961 3300053084 Bacteria 7990
210 Ga0495619_0000092 3300053085 Bacteria 69233
211 Ga0500562_007860 3300053108 Bacteria 2693
212 Ga0500616_0015466 3300053153 Bacteria 4361
213 Ga0500616_0051777 3300053153 Bacteria 2162
214 Ga0500616_0080389 3300053153 Bacteria 1639
215 Ga0590075_041364 3300059424 Bacteria 1178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10017710 Ga0114129_100177102 204
2 3300046684 Ga0495669_0017358 Ga0495669_0017358_1913_2590 225
3 3300031852 Ga0307410_10360593 Ga0307410_103605932 231
4 3300050509 nmdc:mga0qj67_273805_c1 nmdc:mga0qj67_273805_c1_409_1242 233
5 3300005937 Ga0081455_10047171 Ga0081455_100471714 234
6 3300006847 Ga0075431_100076574 Ga0075431_1000765743 235
7 3300009094 Ga0111539_10333258 Ga0111539_103332582 235
8 3300049576 Ga0501040_0316157 Ga0501040_0316157_52_882 235
9 3300050492 nmdc:mga0yw44_13581_c1 nmdc:mga0yw44_13581_c1_2580_3413 235
10 3300050509 nmdc:mga0qj67_51461_c1 nmdc:mga0qj67_51461_c1_611_1444 235
11 3300050510 nmdc:mga06r32_198076_c1 nmdc:mga06r32_198076_c1_758_1591 235
12 3300049572 Ga0501036_0045083 Ga0501036_0045083_3011_3724 236
13 3300010159 Ga0099796_10004531 Ga0099796_100045312 237
14 3300007788 Ga0099795_10002392 Ga0099795_100023923 242
15 3300005471 Ga0070698_100300478 Ga0070698_1003004782 243
16 3300005841 Ga0068863_100036319 Ga0068863_1000363195 243
17 3300006844 Ga0075428_100596474 Ga0075428_1005964741 243
18 3300006871 Ga0075434_100067089 Ga0075434_1000670892 243
19 3300009094 Ga0111539_10014716 Ga0111539_1001471612 243
20 3300026088 Ga0207641_10174070 Ga0207641_101740703 243
21 3300049592 Ga0501076_0111148 Ga0501076_0111148_1349_2179 243
22 3300050511 nmdc:mga08y16_48196_c1 nmdc:mga08y16_48196_c1_2791_3621 243
23 3300050512 nmdc:mga0n895_38960_c1 nmdc:mga0n895_38960_c1_2846_3676 243
24 3300005937 Ga0081455_10000417 Ga0081455_1000041713 244
25 3300006177 Ga0075362_10012919 Ga0075362_100129192 244
26 3300050489 nmdc:mga03683_60223_c2 nmdc:mga03683_60223_c2_353_1186 244
27 3300025923 Ga0207681_10254174 Ga0207681_102541742 245
28 3300006028 Ga0070717_10356686 Ga0070717_103566862 246
29 3300009553 Ga0105249_10038315 Ga0105249_100383155 246
30 3300049744 Ga0501083_0003969 Ga0501083_0003969_2986_3819 246
31 3300009094 Ga0111539_10059186 Ga0111539_100591865 247
32 3300025917 Ga0207660_10294985 Ga0207660_102949852 247
33 3300049568 Ga0501031_0060478 Ga0501031_0060478_13_846 250
34 3300049570 Ga0501033_0387692 Ga0501033_0387692_22_855 250
35 3300005441 Ga0070700_100061881 Ga0070700_1000618812 253
36 3300006844 Ga0075428_100004950 Ga0075428_10000495011 253
37 3300006847 Ga0075431_100000494 Ga0075431_1000004945 253
38 3300009094 Ga0111539_10001516 Ga0111539_100015165 253
39 3300027907 Ga0207428_10013999 Ga0207428_100139997 253
40 3300035115 Ga0373941_0003438 Ga0373941_0003438_706_1539 253
41 3300049584 Ga0501068_0287309 Ga0501068_0287309_160_990 253
42 3300050507 nmdc:mga05p37_57_c1 nmdc:mga05p37_57_c1_2232_3074 253
43 3300050509 nmdc:mga0qj67_5657_c1 nmdc:mga0qj67_5657_c1_5120_5962 253
44 3300050510 nmdc:mga06r32_854_c1 nmdc:mga06r32_854_c1_5239_6081 253
45 3300050511 nmdc:mga08y16_2485_c1 nmdc:mga08y16_2485_c1_2664_3506 253
46 3300053153 Ga0500616_0015466 Ga0500616_0015466_3119_3967 254
47 3300048907 Ga0496104_0056403 Ga0496104_0056403_2639_3466 256
48 3300005439 Ga0070711_100340857 Ga0070711_1003408572 257
49 3300006048 Ga0075363_100106706 Ga0075363_1001067062 257
50 3300025916 Ga0207663_10298899 Ga0207663_102988991 257
51 3300046462 Ga0495651_0153163 Ga0495651_0153163_658_1455 261
52 3300046809 Ga0495600_0203054 Ga0495600_0203054_352_1149 261
53 3300049588 Ga0501072_0465283 Ga0501072_0465283_63_860 261
54 3300014325 Ga0163163_10137035 Ga0163163_101370353 262
55 3300037471 Ga0395905_0163171 Ga0395905_0163171_239_1033 262
56 3300048904 Ga0496101_0021069 Ga0496101_0021069_2302_3129 262
57 3300048908 Ga0496105_0007650 Ga0496105_0007650_342_1169 262
58 3300048910 Ga0496107_0300856 Ga0496107_0300856_17_844 262
59 3300048911 Ga0496108_0072497 Ga0496108_0072497_2016_2843 262
60 3300048915 Ga0496112_0114072 Ga0496112_0114072_315_1142 262
61 3300048917 Ga0496114_0377814 Ga0496114_0377814_79_906 262
62 3300048918 Ga0496115_0216149 Ga0496115_0216149_235_1062 262
63 3300046512 Ga0495610_0025984 Ga0495610_0025984_960_1817 263
64 3300053153 Ga0500616_0080389 Ga0500616_0080389_336_1193 263
65 3300009174 Ga0105241_10509827 Ga0105241_105098272 264
66 3300009551 Ga0105238_10091542 Ga0105238_100915422 264
67 3300005719 Ga0068861_100431649 Ga0068861_1004316491 265
68 3300049569 Ga0501032_0275867 Ga0501032_0275867_170_1003 265
69 3300049571 Ga0501034_0053890 Ga0501034_0053890_991_1824 265
70 3300049572 Ga0501036_0298149 Ga0501036_0298149_128_961 265
71 3300049581 Ga0501047_0312417 Ga0501047_0312417_440_1273 265
72 3300049582 Ga0501048_0200912 Ga0501048_0200912_226_1059 265
73 3300049587 Ga0501071_0052530 Ga0501071_0052530_695_1528 265
74 3300035113 Ga0373936_0006762 Ga0373936_0006762_1091_1903 266
75 3300035692 Ga0373935_0005011 Ga0373935_0005011_5465_6277 266
76 3300035695 Ga0373927_0014893 Ga0373927_0014893_3229_4041 266
77 3300037068 Ga0373925_0164813 Ga0373925_0164813_809_1621 266
78 3300005468 Ga0070707_100205686 Ga0070707_1002056862 267
79 3300025922 Ga0207646_10055030 Ga0207646_100550303 267
80 3300046679 Ga0495623_0115059 Ga0495623_0115059_379_1209 267
81 3300049591 Ga0501075_0201529 Ga0501075_0201529_61_876 267
82 3300005842 Ga0068858_100000475 Ga0068858_10000047549 268
83 3300009148 Ga0105243_10055055 Ga0105243_100550553 268
84 3300009176 Ga0105242_10011765 Ga0105242_100117657 268
85 3300009177 Ga0105248_10015365 Ga0105248_1001536510 268
86 3300009551 Ga0105238_10060596 Ga0105238_100605964 268
87 3300013306 Ga0163162_10085464 Ga0163162_100854643 268
88 3300013308 Ga0157375_10434177 Ga0157375_104341771 268
89 3300025934 Ga0207686_10008122 Ga0207686_100081226 268
90 3300026035 Ga0207703_10100087 Ga0207703_101000872 268
91 3300035691 Ga0373931_0118103 Ga0373931_0118103_121_966 268
92 3300038443 Ga0395901_0112866 Ga0395901_0112866_1361_2179 268
93 3300050510 nmdc:mga06r32_545063_c1 nmdc:mga06r32_545063_c1_277_1104 268
94 iso_pu_bacteria 2824600985 2824607821 268
95 iso_pu_bacteria 2824609381 2824616919 268
96 iso_pu_bacteria 2824653114 2824658984 268
97 iso_pu_bacteria 2857509624 2857511036 268
98 iso_pu_bacteria 2888419890 2888426099 268
99 3300005445 Ga0070708_100155567 Ga0070708_1001555673 269
100 3300005471 Ga0070698_100113417 Ga0070698_1001134173 269
101 3300005843 Ga0068860_100410347 Ga0068860_1004103472 269
102 3300021384 Ga0213876_10012262 Ga0213876_100122623 269
103 3300025910 Ga0207684_10023100 Ga0207684_100231003 269
104 3300048913 Ga0496110_0375115 Ga0496110_0375115_36_869 269
105 3300050513 nmdc:mga0rr50_371162_c1 nmdc:mga0rr50_371162_c1_38_859 269
106 iso_pu_bacteria 2643221733 2644729017 269
107 3300005841 Ga0068863_100009395 Ga0068863_1000093952 270
108 3300026088 Ga0207641_10034224 Ga0207641_100342245 270
109 3300028381 Ga0268264_10055171 Ga0268264_100551713 270
110 iso_pu_bacteria 2643221736 2644746013 270
111 iso_pu_bacteria 2851182111 2851187687 270
112 3300009094 Ga0111539_10215410 Ga0111539_102154103 271
113 3300013104 Ga0157370_10255115 Ga0157370_102551152 271
114 3300048904 Ga0496101_0308997 Ga0496101_0308997_34_861 271
115 3300048907 Ga0496104_0058140 Ga0496104_0058140_2380_3207 271
116 3300048911 Ga0496108_0005811 Ga0496108_0005811_3891_4718 271
117 3300048912 Ga0496109_0003711 Ga0496109_0003711_10115_10942 271
118 3300048913 Ga0496110_0001886 Ga0496110_0001886_5993_6820 271
119 3300048914 Ga0496111_0007231 Ga0496111_0007231_4251_5078 271
120 3300048915 Ga0496112_0020351 Ga0496112_0020351_2769_3596 271
121 3300048916 Ga0496113_0010750 Ga0496113_0010750_921_1748 271
122 3300050511 nmdc:mga08y16_425426_c1 nmdc:mga08y16_425426_c1_400_1224 271
123 3300005981 Ga0081538_10093449 Ga0081538_100934492 272
124 3300006038 Ga0075365_10108423 Ga0075365_101084233 272
125 3300006846 Ga0075430_100015557 Ga0075430_1000155576 272
126 3300006847 Ga0075431_100075721 Ga0075431_1000757214 272
127 3300006871 Ga0075434_100429784 Ga0075434_1004297842 272
128 3300025297 Ga0209758_1045118 Ga0209758_10451182 272
129 3300044683 Ga0466965_0163397 Ga0466965_0163397_226_1053 272
130 3300049570 Ga0501033_0109734 Ga0501033_0109734_71_898 272
131 3300049571 Ga0501034_0124109 Ga0501034_0124109_1574_2401 272
132 3300049580 Ga0501046_0465314 Ga0501046_0465314_31_858 272
133 3300049581 Ga0501047_0036168 Ga0501047_0036168_2675_3502 272
134 3300049586 Ga0501070_0463844 Ga0501070_0463844_28_855 272
135 3300049591 Ga0501075_0310840 Ga0501075_0310840_94_972 272
136 3300049743 Ga0501081_0070283 Ga0501081_0070283_279_1106 272
137 3300049822 Ga0501035_0502080 Ga0501035_0502080_143_970 272
138 3300049823 Ga0501044_0272922 Ga0501044_0272922_724_1551 272
139 3300049823 Ga0501044_0465358 Ga0501044_0465358_253_1080 272
140 3300049824 Ga0501045_0290651 Ga0501045_0290651_94_972 272
141 3300050509 nmdc:mga0qj67_27360_c1 nmdc:mga0qj67_27360_c1_255_1082 272
142 3300050510 nmdc:mga06r32_15868_c1 nmdc:mga06r32_15868_c1_1095_1922 272
143 3300050512 nmdc:mga0n895_297256_c1 nmdc:mga0n895_297256_c1_581_1408 272
144 3300059424 Ga0590075_041364 Ga0590075_041364_153_998 272
145 3300005330 Ga0070690_100007625 Ga0070690_1000076254 273
146 3300005331 Ga0070670_100177274 Ga0070670_1001772742 273
147 3300005334 Ga0068869_100381243 Ga0068869_1003812432 273
148 3300005340 Ga0070689_100150869 Ga0070689_1001508692 273
149 3300005365 Ga0070688_100040872 Ga0070688_1000408721 273
150 3300005437 Ga0070710_10046769 Ga0070710_100467692 273
151 3300005441 Ga0070700_100007929 Ga0070700_1000079293 273
152 3300005466 Ga0070685_10023088 Ga0070685_100230884 273
153 3300005614 Ga0068856_100097208 Ga0068856_1000972083 273
154 3300005615 Ga0070702_100005496 Ga0070702_1000054967 273
155 3300005617 Ga0068859_100025816 Ga0068859_1000258163 273
156 3300005842 Ga0068858_100025404 Ga0068858_1000254045 273
157 3300005843 Ga0068860_100005739 Ga0068860_10000573911 273
158 3300005937 Ga0081455_10003757 Ga0081455_100037575 273
159 3300006237 Ga0097621_100285188 Ga0097621_1002851882 273
160 3300006358 Ga0068871_100078578 Ga0068871_1000785783 273
161 3300006931 Ga0097620_100025816 Ga0097620_1000258163 273
162 3300009093 Ga0105240_10539704 Ga0105240_105397042 273
163 3300009177 Ga0105248_10095928 Ga0105248_100959282 273
164 3300009545 Ga0105237_10191340 Ga0105237_101913402 273
165 3300014968 Ga0157379_10021965 Ga0157379_100219654 273
166 3300014969 Ga0157376_10056408 Ga0157376_100564083 273
167 3300025899 Ga0207642_10036726 Ga0207642_100367262 273
168 3300025900 Ga0207710_10008717 Ga0207710_100087176 273
169 3300025901 Ga0207688_10004896 Ga0207688_100048966 273
170 3300025919 Ga0207657_10023462 Ga0207657_100234624 273
171 3300025923 Ga0207681_10039107 Ga0207681_100391072 273
172 3300025929 Ga0207664_10701472 Ga0207664_107014721 273
173 3300025933 Ga0207706_10005745 Ga0207706_100057458 273
174 3300025936 Ga0207670_10143997 Ga0207670_101439972 273
175 3300025972 Ga0207668_10010335 Ga0207668_100103356 273
176 3300026035 Ga0207703_10285937 Ga0207703_102859372 273
177 3300026067 Ga0207678_10014733 Ga0207678_100147331 273
178 3300026075 Ga0207708_10007808 Ga0207708_100078086 273
179 3300026089 Ga0207648_10004699 Ga0207648_100046993 273
180 3300026121 Ga0207683_10013941 Ga0207683_100139415 273
181 3300037466 Ga0395898_0317336 Ga0395898_0317336_219_1049 273
182 3300041408 Ga0439453_0018347 Ga0439453_0018347_126_959 273
183 3300046460 Ga0495638_0030971 Ga0495638_0030971_2047_2883 273
184 3300046491 Ga0495584_0086128 Ga0495584_0086128_255_1091 273
185 3300046507 Ga0495606_0000903 Ga0495606_0000903_42142_42990 273
186 3300048908 Ga0496105_0355957 Ga0496105_0355957_34_876 273
187 3300048909 Ga0496106_0006373 Ga0496106_0006373_684_1517 273
188 3300048911 Ga0496108_0009471 Ga0496108_0009471_609_1442 273
189 3300048913 Ga0496110_0001894 Ga0496110_0001894_6672_7505 273
190 3300048914 Ga0496111_0175582 Ga0496111_0175582_430_1263 273
191 3300048915 Ga0496112_0067088 Ga0496112_0067088_2609_3442 273
192 3300048917 Ga0496114_0024989 Ga0496114_0024989_1679_2512 273
193 3300048918 Ga0496115_0021662 Ga0496115_0021662_2431_3264 273
194 3300050511 nmdc:mga08y16_825646_c1 nmdc:mga08y16_825646_c1_24_857 273
195 3300053153 Ga0500616_0051777 Ga0500616_0051777_1099_1932 273
196 3300003203 JGI25406J46586_10000134 JGI25406J46586_1000013421 274
197 3300005467 Ga0070706_100031827 Ga0070706_1000318276 274
198 3300005471 Ga0070698_100011582 Ga0070698_1000115822 274
199 3300005518 Ga0070699_100021242 Ga0070699_1000212423 274
200 3300005518 Ga0070699_100316872 Ga0070699_1003168721 274
201 3300005536 Ga0070697_100006015 Ga0070697_1000060158 274
202 3300005985 Ga0081539_10000737 Ga0081539_1000073752 274
203 3300006028 Ga0070717_10006980 Ga0070717_100069802 274
204 3300006038 Ga0075365_10206651 Ga0075365_102066512 274
205 3300025910 Ga0207684_10040862 Ga0207684_100408622 274
206 3300025921 Ga0207652_10101225 Ga0207652_101012251 274
207 3300025922 Ga0207646_10067582 Ga0207646_100675823 274
208 3300031247 Ga0265340_10038992 Ga0265340_100389923 274
209 3300036401 Ga0373937_0167906 Ga0373937_0167906_640_1473 274
210 3300046511 Ga0495608_0112049 Ga0495608_0112049_821_1654 274
211 3300046533 Ga0495640_0042582 Ga0495640_0042582_1321_2154 274
212 3300046559 Ga0495667_0171084 Ga0495667_0171084_65_898 274
213 3300046642 Ga0495634_0157463 Ga0495634_0157463_238_1071 274
214 3300046809 Ga0495600_0233958 Ga0495600_0233958_123_956 274
215 3300047317 Ga0495604_0047608 Ga0495604_0047608_101_934 274
216 3300047319 Ga0495674_0059610 Ga0495674_0059610_932_1765 274
217 3300049592 Ga0501076_0069974 Ga0501076_0069974_1801_2634 274
218 3300049741 Ga0501079_0432997 Ga0501079_0432997_115_948 274
219 3300050507 nmdc:mga05p37_89990_c1 nmdc:mga05p37_89990_c1_75_902 274
220 3300053077 Ga0495601_0005229 Ga0495601_0005229_3851_4684 274
221 3300053084 Ga0495595_0001961 Ga0495595_0001961_6040_6873 274
222 3300053085 Ga0495619_0000092 Ga0495619_0000092_63502_64335 274
223 3300053108 Ga0500562_007860 Ga0500562_007860_132_983 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

34

267

0.92

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

44

275

0.85

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

49

270

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5my5-assembly1.cif.gz_A tungstate binding protein - tupa - from desulfovibrio alaskensis g20 0.9567 24 269
5my5-assembly1.cif.gz_A tungstate binding protein - tupa - from desulfovibrio alaskensis g20 0.938 24 269
3cvg-assembly5.cif.gz_C crystal structure of a periplasmic putative metal binding protein 0.8656 80 267
3cvg-assembly1.cif.gz_A crystal structure of a periplasmic putative metal binding protein 0.8384 24 267
3lr1-assembly1.cif.gz_A the crystal structure of the tungstate abc transporter from geobacter sulfurreducens 0.813 25 257
ID Description Score Start End Superfamily
5my5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9737 24 269 3.40.190.10
5my5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9529 24 269 3.40.190.10
3kn3C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9482 25 258 3.40.190.10
3kn3C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9322 25 258 3.40.190.10
3lr1A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9253 27 257 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A3B8SWU7-F1-model_v4 Sulfate transporter 0.9814 38 268
AF-A0A1Y5EAF9-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9783 26 271
AF-A0A1Y5EAF9-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9744 26 271
AF-A0A3B0RCL9-F1-model_v4 Tungstate ABC transporter, substrate-binding protein 0.9728 15 243
AF-A0A2D7SJZ4-F1-model_v4 Sulfate transporter 0.9706 21 269

Feature Viewer

pLDDT pTM Quality
89.45 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map