F336021

General Info

Members Datasets Scaffolds Average Seq Length
223 174 221 107

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0025147|Ga0501034_0025147_414_776
Length 120
Sequence MSARQGFFGRQATMAKITYVEFGGKEHVLDVPTGLTVMEGARDNGVPGIEADCGGACACSTCHVYVDPAWVDRLPKKDAMEEDMLDFAFQPDPARSRLTCQLKVSDALDGLKVFMPEKQI

Samples

Sample ID Description Type Environment
1 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
2 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
101 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
102 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
103 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
150 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
154 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
155 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
158 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
159 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
160 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
161 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
166 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
171 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
172 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
173 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0.45
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.42
Nodule 0.9
Rhizoplane 3.14
Rhizosphere 65.92
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10079800 3300005327 Bacteria 2687
2 Ga0070670_100474879 3300005331 Bacteria 1110
3 Ga0068869_102088611 3300005334 Bacteria 509
4 Ga0070680_101102401 3300005336 Bacteria 686
5 Ga0070680_101934523 3300005336 Bacteria 511
6 Ga0070660_101369626 3300005339 Bacteria 601
7 Ga0070668_100009917 3300005347 Bacteria 7054
8 Ga0070671_100003754 3300005355 Bacteria 11927
9 Ga0070667_100003519 3300005367 Bacteria 13338
10 Ga0070714_102143293 3300005435 Bacteria 545
11 Ga0070663_100136231 3300005455 Bacteria 1870
12 Ga0070662_100069970 3300005457 Bacteria 2585
13 Ga0070695_100502621 3300005545 Bacteria 938
14 Ga0070665_100085602 3300005548 Bacteria 3158
15 Ga0070665_100964891 3300005548 Bacteria 865
16 Ga0068855_100115538 3300005563 Bacteria 3076
17 Ga0068855_101261670 3300005563 Bacteria 766
18 Ga0068857_100487889 3300005577 Bacteria 1155
19 Ga0068857_101959194 3300005577 Unclassified 574
20 Ga0068852_100071913 3300005616 Bacteria 3038
21 Ga0068852_101735940 3300005616 Bacteria 647
22 Ga0068859_100126452 3300005617 Bacteria 2625
23 Ga0068861_101931213 3300005719 Bacteria 588
24 Ga0068863_100052476 3300005841 Bacteria 3864
25 Ga0068863_100097012 3300005841 Bacteria 2799
26 Ga0068858_100003066 3300005842 Bacteria 16744
27 Ga0068858_100769513 3300005842 Bacteria 939
28 Ga0068860_100025301 3300005843 Bacteria 5729
29 Ga0068862_100015260 3300005844 Bacteria 6381
30 Ga0068862_102351704 3300005844 Bacteria 545
31 Ga0075368_10023860 3300006042 Bacteria 2340
32 Ga0075368_10255770 3300006042 Bacteria 749
33 Ga0075363_100173417 3300006048 Bacteria 1225
34 Ga0075363_100895243 3300006048 Bacteria 543
35 Ga0075364_10000245 3300006051 Bacteria 26164
36 Ga0075367_10000631 3300006178 Bacteria 13490
37 Ga0075369_10256880 3300006186 Bacteria 812
38 Ga0075366_10050829 3300006195 Bacteria 2462
39 Ga0075366_10486916 3300006195 Bacteria 762
40 Ga0075366_10555626 3300006195 Bacteria 711
41 Ga0075366_10882603 3300006195 Bacteria 557
42 Ga0075370_10187652 3300006353 Bacteria 1218
43 Ga0075370_10273688 3300006353 Bacteria 1002
44 Ga0075430_100757363 3300006846 Bacteria 800
45 Ga0075431_100125527 3300006847 Bacteria 2648
46 Ga0097620_100126451 3300006931 Bacteria 2625
47 Ga0079104_1010617 3300006946 Bacteria 3017
48 Ga0105250_10192646 3300009092 Bacteria 858
49 Ga0105240_10203580 3300009093 Bacteria 2318
50 Ga0105240_12548724 3300009093 Bacteria 529
51 Ga0105248_10016706 3300009177 Bacteria 8079
52 Ga0105237_10508575 3300009545 Bacteria 1211
53 Ga0105249_10333819 3300009553 Bacteria 1531
54 Ga0099796_10306142 3300010159 Unclassified 675
55 Ga0157373_10014876 3300013100 Bacteria 5698
56 Ga0157374_10248987 3300013296 Bacteria 1748
57 Ga0163162_10236575 3300013306 Bacteria 1957
58 Ga0163163_10002724 3300014325 Bacteria 14914
59 Ga0157380_10012878 3300014326 Bacteria 6079
60 Ga0157379_10091695 3300014968 Bacteria 2725
61 Ga0213876_10083752 3300021384 Bacteria 1687
62 Ga0213871_10280177 3300021441 Bacteria 535
63 Ga0207647_10677094 3300025904 Bacteria 564
64 Ga0207695_11609880 3300025913 Bacteria 530
65 Ga0207681_10008997 3300025923 Bacteria 6100
66 Ga0207650_10195860 3300025925 Bacteria 1616
67 Ga0207644_10018849 3300025931 Bacteria 4675
68 Ga0207706_10079088 3300025933 Bacteria 2892
69 Ga0207711_10006351 3300025941 Bacteria 9967
70 Ga0207712_10294019 3300025961 Bacteria 1330
71 Ga0207668_10004694 3300025972 Bacteria 8040
72 Ga0207668_10156805 3300025972 Bacteria 1769
73 Ga0207658_10005584 3300025986 Bacteria 8604
74 Ga0207703_10015303 3300026035 Bacteria 5984
75 Ga0207678_10160820 3300026067 Bacteria 1918
76 Ga0207702_10227508 3300026078 Bacteria 1741
77 Ga0207641_10013668 3300026088 Bacteria 6660
78 Ga0207641_10267663 3300026088 Bacteria 1602
79 Ga0207674_10894473 3300026116 Bacteria 856
80 Ga0207675_101334928 3300026118 Bacteria 738
81 Ga0207698_10195208 3300026142 Bacteria 1807
82 Ga0209281_1045954 3300027111 Bacteria 714
83 Ga0209813_10005386 3300027866 Bacteria 3102
84 Ga0209813_10106300 3300027866 Bacteria 961
85 Ga0268265_11427806 3300028380 Bacteria 694
86 Ga0268265_12125094 3300028380 Bacteria 568
87 Ga0268264_10015104 3300028381 Bacteria 6334
88 Ga0265334_10067447 3300028573 Bacteria 1337
89 Ga0265338_10050585 3300028800 Bacteria 3754
90 Ga0265338_10079021 3300028800 Bacteria 2771
91 Ga0265325_10126537 3300031241 Bacteria 1227
92 Ga0265316_10549238 3300031344 Bacteria 822
93 Ga0307408_100037459 3300031548 Bacteria 3416
94 Ga0307508_10292176 3300031616 Bacteria 1223
95 Ga0316579_10053171 3300031691 Bacteria 1897
96 Ga0316576_10124859 3300031727 Bacteria 1933
97 Ga0316576_10524369 3300031727 Bacteria 870
98 Ga0316578_10009937 3300031728 Bacteria 4916
99 Ga0307516_10000050 3300031730 Bacteria 129848
100 Ga0316577_10063519 3300031733 Bacteria 2061
101 Ga0307416_102682918 3300032002 Bacteria 595
102 Ga0316585_10105330 3300032137 Bacteria 926
103 Ga0316580_10043818 3300032139 Bacteria 1380
104 Ga0373952_0139125 3300035092 Bacteria 673
105 Ga0316574_0048465 3300035398 Bacteria 2638
106 Ga0373935_0423626 3300035692 Bacteria 958
107 Ga0373947_0054376 3300035725 Bacteria 2416
108 Ga0373937_0067089 3300036401 Bacteria 3306
109 Ga0316582_0161829 3300036647 Bacteria 1516
110 Ga0316584_0056451 3300036712 Bacteria 2939
111 Ga0373925_0576161 3300037068 Bacteria 926
112 Ga0373925_1313035 3300037068 Bacteria 593
113 Ga0395899_0098919 3300037312 Bacteria 2108
114 Ga0395899_0112124 3300037312 Bacteria 1960
115 Ga0395899_0115715 3300037312 Bacteria 1924
116 Ga0395899_0886384 3300037312 Bacteria 545
117 Ga0395900_0019033 3300037418 Bacteria 7000
118 Ga0395900_0030635 3300037418 Bacteria 5525
119 Ga0395900_0167510 3300037418 Bacteria 2238
120 Ga0395900_0184580 3300037418 Bacteria 2117
121 Ga0395900_1234377 3300037418 Bacteria 662
122 Ga0395898_0028033 3300037466 Bacteria 5647
123 Ga0395905_1775104 3300037471 Bacteria 522
124 Ga0395901_0119434 3300038443 Bacteria 2770
125 Ga0395901_0259720 3300038443 Bacteria 1808
126 Ga0395901_0271812 3300038443 Bacteria 1763
127 Ga0395901_0605289 3300038443 Bacteria 1104
128 Ga0395901_0720099 3300038443 Bacteria 993
129 Ga0436365_0726367 3300039437 Bacteria 685
130 Ga0436365_1134076 3300039437 Bacteria 2604
131 Ga0436362_1000944 3300039453 Bacteria 1626
132 Ga0439465_0076651 3300041413 Bacteria 1127
133 Ga0451793_0729597 3300041452 Bacteria 649
134 Ga0451797_1483915 3300041453 Bacteria 528
135 Ga0451839_0816827 3300041496 Bacteria 625
136 Ga0439449_0254600 3300042007 Bacteria 660
137 Ga0466965_0501129 3300044683 Bacteria 681
138 Ga0466966_0776873 3300044684 Bacteria 577
139 Ga0466964_0230399 3300044706 Bacteria 904
140 Ga0466957_0381220 3300044842 Bacteria 962
141 Ga0451576_0003127 3300045051 Bacteria 23211
142 Ga0495664_0707079 3300046477 Bacteria 595
143 Ga0495606_0152909 3300046507 Bacteria 1353
144 Ga0495620_0213824 3300046515 Bacteria 739
145 Ga0495643_0119465 3300046522 Bacteria 1333
146 Ga0495642_0131520 3300046528 Bacteria 1077
147 Ga0495609_0063476 3300046538 Bacteria 1630
148 Ga0495597_0006425 3300046542 Bacteria 6082
149 Ga0495668_0205124 3300046616 Bacteria 1079
150 Ga0495625_0097382 3300046660 Bacteria 2025
151 Ga0495588_0338042 3300046674 Bacteria 792
152 Ga0495657_0880967 3300046675 Bacteria 509
153 Ga0495669_0023374 3300046684 Bacteria 2690
154 Ga0495613_0044287 3300046689 Bacteria 3293
155 Ga0495687_063277 3300047443 Bacteria 1515
156 Ga0496102_0033378 3300048905 Unclassified 4625
157 Ga0496103_0232876 3300048906 Bacteria 1185
158 Ga0496105_0489531 3300048908 Unclassified 967
159 Ga0496106_0323399 3300048909 Bacteria 1238
160 Ga0496112_1638309 3300048915 Bacteria 556
161 Ga0496117_0000024 3300048920 Bacteria 418750
162 Ga0496118_0000014 3300048921 Bacteria 561628
163 Ga0496118_0483498 3300048921 Bacteria 620
164 Ga0496119_0010472 3300048922 Bacteria 7798
165 Ga0496120_0022866 3300048923 Unclassified 3926
166 Ga0496121_0715190 3300048924 Unclassified 600
167 Ga0496124_0069601 3300048927 Bacteria 2921
168 Ga0496124_0392511 3300048927 Bacteria 966
169 Ga0496125_0108321 3300048928 Bacteria 2021
170 Ga0496126_0033675 3300048929 Unclassified 4818
171 Ga0501031_0494947 3300049568 Bacteria 789
172 Ga0501033_0655332 3300049570 Bacteria 717
173 Ga0501034_0025147 3300049571 Bacteria 6060
174 Ga0501034_0105934 3300049571 Bacteria 2804
175 Ga0501034_0107507 3300049571 Bacteria 2781
176 Ga0501034_0504515 3300049571 Bacteria 1123
177 Ga0501034_0779351 3300049571 Bacteria 850
178 Ga0501034_1160808 3300049571 Bacteria 652
179 Ga0501043_0736034 3300049579 Bacteria 718
180 Ga0501046_0441343 3300049580 Bacteria 937
181 Ga0501047_0180916 3300049581 Bacteria 1975
182 Ga0501076_1525270 3300049592 Bacteria 549
183 Ga0501035_1016214 3300049822 Bacteria 651
184 nmdc:mga03n38_32456_c1 3300050490 Bacteria 2212
185 nmdc:mga03n38_514536_c1 3300050490 Bacteria 673
186 nmdc:mga00v17_344_c1 3300050491 Bacteria 26181
187 nmdc:mga0k408_151975_c1 3300050493 Bacteria 1379
188 nmdc:mga0k408_601011_c1 3300050493 Bacteria 649
189 nmdc:mga06z11_113249_c1 3300050494 Bacteria 1505
190 nmdc:mga06z11_123010_c1 3300050494 Bacteria 1449
191 nmdc:mga06z11_546366_c1 3300050494 Bacteria 703
192 nmdc:mga04h51_16396_c1 3300050495 Bacteria 2150
193 nmdc:mga07m45_561655_c1 3300050496 Bacteria 660
194 nmdc:mga07m45_93052_c1 3300050496 Bacteria 1728
195 nmdc:mga06r32_112495_c1 3300050510 Bacteria 2196
196 nmdc:mga0sz30_112381_c1 3300050516 Bacteria 1194
197 nmdc:mga0sz30_37007_c2 3300050516 Bacteria 909
198 Ga0500635_0000252 3300053080 Bacteria 22210
199 Ga0500583_0134152 3300053092 Bacteria 1229
200 Ga0500641_0040909 3300053096 Bacteria 1874
201 Ga0500562_000852 3300053108 Bacteria 7390
202 Ga0500569_001039 3300053109 Bacteria 5045
203 Ga0500608_041993 3300053122 Bacteria 2195
204 Ga0500617_009883 3300053124 Bacteria 3925
205 Ga0500642_0067024 3300053130 Bacteria 1626
206 Ga0500652_070299 3300053131 Bacteria 1450
207 Ga0500652_084748 3300053131 Bacteria 1321
208 Ga0500658_0481906 3300053134 Bacteria 563
209 Ga0500559_0044030 3300053136 Bacteria 1951
210 Ga0500568_0125768 3300053139 Bacteria 954
211 Ga0500577_0134561 3300053142 Bacteria 1039
212 Ga0500577_0306173 3300053142 Bacteria 694
213 Ga0500603_072065 3300053150 Bacteria 986
214 Ga0500616_0026214 3300053153 Bacteria 3228
215 Ga0500624_002814 3300053157 Bacteria 2309
216 Ga0500636_0058810 3300053177 Bacteria 2246
217 Ga0500637_0074043 3300053178 Bacteria 1961
218 Ga0500645_049345 3300053730 Bacteria 1231
219 Ga0500601_016146 3300053737 Bacteria 851
220 Ga0587125_068689 3300059607 Bacteria 531
221 Ga0530510_0184282 3300061734 Bacteria 1549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010159 Ga0099796_10306142 Ga0099796_103061422 85
2 3300048922 Ga0496119_0010472 Ga0496119_0010472_4681_4974 97
3 3300048923 Ga0496120_0022866 Ga0496120_0022866_674_967 97
4 3300048924 Ga0496121_0715190 Ga0496121_0715190_27_320 97
5 3300048927 Ga0496124_0069601 Ga0496124_0069601_766_1059 97
6 3300048928 Ga0496125_0108321 Ga0496125_0108321_655_948 97
7 3300005577 Ga0068857_101959194 Ga0068857_1019591941 102
8 iso_pu_bacteria 2919679072 2919680729 102
9 iso_pu_bacteria 3000405567 3000407731 102
10 3300005327 Ga0070658_10079800 Ga0070658_100798003 106
11 3300005331 Ga0070670_100474879 Ga0070670_1004748792 106
12 3300005334 Ga0068869_102088611 Ga0068869_1020886111 106
13 3300005336 Ga0070680_101102401 Ga0070680_1011024012 106
14 3300005336 Ga0070680_101934523 Ga0070680_1019345231 106
15 3300005339 Ga0070660_101369626 Ga0070660_1013696261 106
16 3300005347 Ga0070668_100009917 Ga0070668_1000099177 106
17 3300005355 Ga0070671_100003754 Ga0070671_10000375412 106
18 3300005367 Ga0070667_100003519 Ga0070667_1000035197 106
19 3300005435 Ga0070714_102143293 Ga0070714_1021432932 106
20 3300005455 Ga0070663_100136231 Ga0070663_1001362312 106
21 3300005457 Ga0070662_100069970 Ga0070662_1000699702 106
22 3300005545 Ga0070695_100502621 Ga0070695_1005026212 106
23 3300005548 Ga0070665_100085602 Ga0070665_1000856022 106
24 3300005548 Ga0070665_100964891 Ga0070665_1009648912 106
25 3300005563 Ga0068855_100115538 Ga0068855_1001155384 106
26 3300005563 Ga0068855_101261670 Ga0068855_1012616702 106
27 3300005577 Ga0068857_100487889 Ga0068857_1004878892 106
28 3300005616 Ga0068852_100071913 Ga0068852_1000719133 106
29 3300005616 Ga0068852_101735940 Ga0068852_1017359402 106
30 3300005617 Ga0068859_100126452 Ga0068859_1001264521 106
31 3300005719 Ga0068861_101931213 Ga0068861_1019312131 106
32 3300005841 Ga0068863_100052476 Ga0068863_1000524762 106
33 3300005841 Ga0068863_100097012 Ga0068863_1000970122 106
34 3300005842 Ga0068858_100003066 Ga0068858_1000030662 106
35 3300005842 Ga0068858_100769513 Ga0068858_1007695132 106
36 3300005843 Ga0068860_100025301 Ga0068860_1000253012 106
37 3300005844 Ga0068862_100015260 Ga0068862_1000152608 106
38 3300005844 Ga0068862_102351704 Ga0068862_1023517042 106
39 3300006042 Ga0075368_10023860 Ga0075368_100238603 106
40 3300006042 Ga0075368_10255770 Ga0075368_102557701 106
41 3300006048 Ga0075363_100173417 Ga0075363_1001734172 106
42 3300006048 Ga0075363_100895243 Ga0075363_1008952431 106
43 3300006051 Ga0075364_10000245 Ga0075364_1000024516 106
44 3300006178 Ga0075367_10000631 Ga0075367_100006314 106
45 3300006186 Ga0075369_10256880 Ga0075369_102568802 106
46 3300006195 Ga0075366_10050829 Ga0075366_100508292 106
47 3300006195 Ga0075366_10486916 Ga0075366_104869162 106
48 3300006195 Ga0075366_10555626 Ga0075366_105556262 106
49 3300006195 Ga0075366_10882603 Ga0075366_108826031 106
50 3300006353 Ga0075370_10187652 Ga0075370_101876522 106
51 3300006353 Ga0075370_10273688 Ga0075370_102736882 106
52 3300006846 Ga0075430_100757363 Ga0075430_1007573632 106
53 3300006847 Ga0075431_100125527 Ga0075431_1001255273 106
54 3300006931 Ga0097620_100126451 Ga0097620_1001264511 106
55 3300006946 Ga0079104_1010617 Ga0079104_10106173 106
56 3300009092 Ga0105250_10192646 Ga0105250_101926461 106
57 3300009093 Ga0105240_10203580 Ga0105240_102035802 106
58 3300009093 Ga0105240_12548724 Ga0105240_125487241 106
59 3300009177 Ga0105248_10016706 Ga0105248_100167064 106
60 3300009545 Ga0105237_10508575 Ga0105237_105085752 106
61 3300009553 Ga0105249_10333819 Ga0105249_103338193 106
62 3300013100 Ga0157373_10014876 Ga0157373_100148762 106
63 3300013296 Ga0157374_10248987 Ga0157374_102489872 106
64 3300013306 Ga0163162_10236575 Ga0163162_102365752 106
65 3300014325 Ga0163163_10002724 Ga0163163_100027243 106
66 3300014326 Ga0157380_10012878 Ga0157380_100128784 106
67 3300014968 Ga0157379_10091695 Ga0157379_100916953 106
68 3300021384 Ga0213876_10083752 Ga0213876_100837522 106
69 3300021441 Ga0213871_10280177 Ga0213871_102801771 106
70 3300025904 Ga0207647_10677094 Ga0207647_106770942 106
71 3300025913 Ga0207695_11609880 Ga0207695_116098801 106
72 3300025923 Ga0207681_10008997 Ga0207681_100089974 106
73 3300025925 Ga0207650_10195860 Ga0207650_101958602 106
74 3300025931 Ga0207644_10018849 Ga0207644_100188492 106
75 3300025933 Ga0207706_10079088 Ga0207706_100790882 106
76 3300025941 Ga0207711_10006351 Ga0207711_100063515 106
77 3300025961 Ga0207712_10294019 Ga0207712_102940192 106
78 3300025972 Ga0207668_10004694 Ga0207668_100046944 106
79 3300025972 Ga0207668_10156805 Ga0207668_101568051 106
80 3300025986 Ga0207658_10005584 Ga0207658_100055844 106
81 3300026035 Ga0207703_10015303 Ga0207703_100153032 106
82 3300026067 Ga0207678_10160820 Ga0207678_101608202 106
83 3300026078 Ga0207702_10227508 Ga0207702_102275082 106
84 3300026088 Ga0207641_10013668 Ga0207641_100136683 106
85 3300026088 Ga0207641_10267663 Ga0207641_102676632 106
86 3300026116 Ga0207674_10894473 Ga0207674_108944732 106
87 3300026118 Ga0207675_101334928 Ga0207675_1013349281 106
88 3300026142 Ga0207698_10195208 Ga0207698_101952082 106
89 3300027111 Ga0209281_1045954 Ga0209281_10459541 106
90 3300027866 Ga0209813_10005386 Ga0209813_100053863 106
91 3300027866 Ga0209813_10106300 Ga0209813_101063002 106
92 3300028380 Ga0268265_11427806 Ga0268265_114278062 106
93 3300028380 Ga0268265_12125094 Ga0268265_121250941 106
94 3300028381 Ga0268264_10015104 Ga0268264_100151045 106
95 3300028573 Ga0265334_10067447 Ga0265334_100674472 106
96 3300028800 Ga0265338_10050585 Ga0265338_100505853 106
97 3300028800 Ga0265338_10079021 Ga0265338_100790213 106
98 3300031241 Ga0265325_10126537 Ga0265325_101265372 106
99 3300031344 Ga0265316_10549238 Ga0265316_105492382 106
100 3300031548 Ga0307408_100037459 Ga0307408_1000374595 106
101 3300031616 Ga0307508_10292176 Ga0307508_102921762 106
102 3300031691 Ga0316579_10053171 Ga0316579_100531712 106
103 3300031727 Ga0316576_10124859 Ga0316576_101248592 106
104 3300031727 Ga0316576_10524369 Ga0316576_105243692 106
105 3300031728 Ga0316578_10009937 Ga0316578_100099373 106
106 3300031730 Ga0307516_10000050 Ga0307516_10000050125 106
107 3300031733 Ga0316577_10063519 Ga0316577_100635192 106
108 3300032002 Ga0307416_102682918 Ga0307416_1026829182 106
109 3300032137 Ga0316585_10105330 Ga0316585_101053301 106
110 3300032139 Ga0316580_10043818 Ga0316580_100438182 106
111 3300035092 Ga0373952_0139125 Ga0373952_0139125_317_637 106
112 3300035398 Ga0316574_0048465 Ga0316574_0048465_1734_2054 106
113 3300035692 Ga0373935_0423626 Ga0373935_0423626_201_521 106
114 3300035725 Ga0373947_0054376 Ga0373947_0054376_751_1071 106
115 3300036401 Ga0373937_0067089 Ga0373937_0067089_1072_1392 106
116 3300036647 Ga0316582_0161829 Ga0316582_0161829_653_973 106
117 3300036712 Ga0316584_0056451 Ga0316584_0056451_1569_1889 106
118 3300037068 Ga0373925_0576161 Ga0373925_0576161_420_740 106
119 3300037068 Ga0373925_1313035 Ga0373925_1313035_24_344 106
120 3300037312 Ga0395899_0098919 Ga0395899_0098919_223_543 106
121 3300037312 Ga0395899_0112124 Ga0395899_0112124_992_1312 106
122 3300037312 Ga0395899_0115715 Ga0395899_0115715_856_1176 106
123 3300037312 Ga0395899_0886384 Ga0395899_0886384_17_337 106
124 3300037418 Ga0395900_0019033 Ga0395900_0019033_6257_6577 106
125 3300037418 Ga0395900_0030635 Ga0395900_0030635_4662_4982 106
126 3300037418 Ga0395900_0167510 Ga0395900_0167510_530_850 106
127 3300037418 Ga0395900_0184580 Ga0395900_0184580_1530_1850 106
128 3300037418 Ga0395900_1234377 Ga0395900_1234377_246_566 106
129 3300037466 Ga0395898_0028033 Ga0395898_0028033_4898_5218 106
130 3300037471 Ga0395905_1775104 Ga0395905_1775104_31_351 106
131 3300038443 Ga0395901_0119434 Ga0395901_0119434_357_677 106
132 3300038443 Ga0395901_0259720 Ga0395901_0259720_1060_1380 106
133 3300038443 Ga0395901_0271812 Ga0395901_0271812_1207_1527 106
134 3300038443 Ga0395901_0605289 Ga0395901_0605289_383_703 106
135 3300038443 Ga0395901_0720099 Ga0395901_0720099_504_824 106
136 3300039437 Ga0436365_0726367 Ga0436365_0726367_330_650 106
137 3300039437 Ga0436365_1134076 Ga0436365_1134076_1332_1652 106
138 3300039453 Ga0436362_1000944 Ga0436362_1000944_95_415 106
139 3300041413 Ga0439465_0076651 Ga0439465_0076651_548_868 106
140 3300041452 Ga0451793_0729597 Ga0451793_0729597_36_356 106
141 3300041453 Ga0451797_1483915 Ga0451797_1483915_65_388 106
142 3300041496 Ga0451839_0816827 Ga0451839_0816827_47_373 106
143 3300042007 Ga0439449_0254600 Ga0439449_0254600_267_587 106
144 3300044683 Ga0466965_0501129 Ga0466965_0501129_347_667 106
145 3300044684 Ga0466966_0776873 Ga0466966_0776873_243_566 106
146 3300044706 Ga0466964_0230399 Ga0466964_0230399_404_724 106
147 3300044842 Ga0466957_0381220 Ga0466957_0381220_282_602 106
148 3300045051 Ga0451576_0003127 Ga0451576_0003127_9365_9688 106
149 3300046477 Ga0495664_0707079 Ga0495664_0707079_83_403 106
150 3300046507 Ga0495606_0152909 Ga0495606_0152909_875_1195 106
151 3300046515 Ga0495620_0213824 Ga0495620_0213824_342_662 106
152 3300046522 Ga0495643_0119465 Ga0495643_0119465_898_1218 106
153 3300046528 Ga0495642_0131520 Ga0495642_0131520_494_814 106
154 3300046538 Ga0495609_0063476 Ga0495609_0063476_63_383 106
155 3300046542 Ga0495597_0006425 Ga0495597_0006425_4588_4908 106
156 3300046616 Ga0495668_0205124 Ga0495668_0205124_334_654 106
157 3300046660 Ga0495625_0097382 Ga0495625_0097382_1575_1895 106
158 3300046674 Ga0495588_0338042 Ga0495588_0338042_185_505 106
159 3300046675 Ga0495657_0880967 Ga0495657_0880967_91_411 106
160 3300046684 Ga0495669_0023374 Ga0495669_0023374_868_1188 106
161 3300046689 Ga0495613_0044287 Ga0495613_0044287_126_446 106
162 3300047443 Ga0495687_063277 Ga0495687_063277_590_910 106
163 3300048905 Ga0496102_0033378 Ga0496102_0033378_1209_1529 106
164 3300048906 Ga0496103_0232876 Ga0496103_0232876_28_348 106
165 3300048908 Ga0496105_0489531 Ga0496105_0489531_578_898 106
166 3300048909 Ga0496106_0323399 Ga0496106_0323399_595_915 106
167 3300048915 Ga0496112_1638309 Ga0496112_1638309_192_512 106
168 3300048920 Ga0496117_0000024 Ga0496117_0000024_192783_193103 106
169 3300048921 Ga0496118_0000014 Ga0496118_0000014_225959_226279 106
170 3300048921 Ga0496118_0483498 Ga0496118_0483498_210_530 106
171 3300048927 Ga0496124_0392511 Ga0496124_0392511_460_783 106
172 3300048929 Ga0496126_0033675 Ga0496126_0033675_4334_4654 106
173 3300049568 Ga0501031_0494947 Ga0501031_0494947_32_355 106
174 3300049570 Ga0501033_0655332 Ga0501033_0655332_335_658 106
175 3300049571 Ga0501034_0025147 Ga0501034_0025147_414_776 106
176 3300049571 Ga0501034_0105934 Ga0501034_0105934_1627_1980 106
177 3300049571 Ga0501034_0107507 Ga0501034_0107507_2076_2471 106
178 3300049571 Ga0501034_0504515 Ga0501034_0504515_476_796 106
179 3300049571 Ga0501034_0779351 Ga0501034_0779351_452_772 106
180 3300049571 Ga0501034_1160808 Ga0501034_1160808_256_576 106
181 3300049579 Ga0501043_0736034 Ga0501043_0736034_265_585 106
182 3300049580 Ga0501046_0441343 Ga0501046_0441343_145_468 106
183 3300049581 Ga0501047_0180916 Ga0501047_0180916_23_343 106
184 3300049592 Ga0501076_1525270 Ga0501076_1525270_51_374 106
185 3300049822 Ga0501035_1016214 Ga0501035_1016214_138_458 106
186 3300050490 nmdc:mga03n38_32456_c1 nmdc:mga03n38_32456_c1_447_767 106
187 3300050490 nmdc:mga03n38_514536_c1 nmdc:mga03n38_514536_c1_314_634 106
188 3300050491 nmdc:mga00v17_344_c1 nmdc:mga00v17_344_c1_12758_13078 106
189 3300050493 nmdc:mga0k408_151975_c1 nmdc:mga0k408_151975_c1_432_752 106
190 3300050493 nmdc:mga0k408_601011_c1 nmdc:mga0k408_601011_c1_277_597 106
191 3300050494 nmdc:mga06z11_113249_c1 nmdc:mga06z11_113249_c1_1170_1490 106
192 3300050494 nmdc:mga06z11_123010_c1 nmdc:mga06z11_123010_c1_562_882 106
193 3300050494 nmdc:mga06z11_546366_c1 nmdc:mga06z11_546366_c1_107_427 106
194 3300050495 nmdc:mga04h51_16396_c1 nmdc:mga04h51_16396_c1_1432_1752 106
195 3300050496 nmdc:mga07m45_561655_c1 nmdc:mga07m45_561655_c1_302_622 106
196 3300050496 nmdc:mga07m45_93052_c1 nmdc:mga07m45_93052_c1_768_1088 106
197 3300050510 nmdc:mga06r32_112495_c1 nmdc:mga06r32_112495_c1_439_759 106
198 3300050516 nmdc:mga0sz30_112381_c1 nmdc:mga0sz30_112381_c1_492_812 106
199 3300050516 nmdc:mga0sz30_37007_c2 nmdc:mga0sz30_37007_c2_155_475 106
200 3300053080 Ga0500635_0000252 Ga0500635_0000252_20320_20640 106
201 3300053092 Ga0500583_0134152 Ga0500583_0134152_37_357 106
202 3300053096 Ga0500641_0040909 Ga0500641_0040909_934_1254 106
203 3300053108 Ga0500562_000852 Ga0500562_000852_5339_5659 106
204 3300053109 Ga0500569_001039 Ga0500569_001039_3843_4163 106
205 3300053122 Ga0500608_041993 Ga0500608_041993_845_1225 106
206 3300053124 Ga0500617_009883 Ga0500617_009883_2505_2825 106
207 3300053130 Ga0500642_0067024 Ga0500642_0067024_843_1163 106
208 3300053131 Ga0500652_070299 Ga0500652_070299_926_1246 106
209 3300053131 Ga0500652_084748 Ga0500652_084748_972_1292 106
210 3300053134 Ga0500658_0481906 Ga0500658_0481906_193_513 106
211 3300053136 Ga0500559_0044030 Ga0500559_0044030_1437_1757 106
212 3300053139 Ga0500568_0125768 Ga0500568_0125768_45_365 106
213 3300053142 Ga0500577_0134561 Ga0500577_0134561_34_354 106
214 3300053142 Ga0500577_0306173 Ga0500577_0306173_61_381 106
215 3300053150 Ga0500603_072065 Ga0500603_072065_196_516 106
216 3300053153 Ga0500616_0026214 Ga0500616_0026214_2133_2453 106
217 3300053157 Ga0500624_002814 Ga0500624_002814_485_805 106
218 3300053177 Ga0500636_0058810 Ga0500636_0058810_171_491 106
219 3300053178 Ga0500637_0074043 Ga0500637_0074043_392_712 106
220 3300053730 Ga0500645_049345 Ga0500645_049345_587_907 106
221 3300053737 Ga0500601_016146 Ga0500601_016146_436_756 106
222 3300059607 Ga0587125_068689 Ga0587125_068689_145_465 106
223 3300061734 Ga0530510_0184282 Ga0530510_0184282_547_870 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

20

105

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb8-assembly1.cif.gz_C crystal structure of the covalent putidaredoxin reductase-putidaredoxin complex 0.9743 2 102
3hui-assembly1.cif.gz_A crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris 0.9728 1 106
1r7s-assembly3.cif.gz_C putidaredoxin (fe2s2 ferredoxin), c73g mutant 0.9709 2 106
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.9708 1 106
1xlq-assembly4.cif.gz_A crystal structure of reduced c73s putidaredoxin from pseudomonas putida 0.9704 2 106
ID Description Score Start End Superfamily
1uwmA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9648 2 106 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9633 2 102 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9612 2 106 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9589 3 106 3.10.20.30
af_A4I756_34_144_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9551 2 103 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A539DA80-F1-model_v4 Ferredoxin, 2Fe-2S 0.9959 1 101 GO:0005829
GO:0009055
GO:0051537
GO:0140647
AF-A0A258IIY8-F1-model_v4 2Fe-2S ferredoxin 0.9923 1 106 GO:0005829
GO:0009055
GO:0051537
GO:0140647
AF-B4RD25-F1-model_v4 Ferredoxin, 2Fe-2S 0.9912 1 106 GO:0009055
GO:0051537
GO:0140647
AF-A0A258CUS5-F1-model_v4 2Fe-2S ferredoxin 0.9905 1 106 GO:0005829
GO:0009055
GO:0051537
GO:0140647
AF-P37098-F1-model_v4 2Fe-2S ferredoxin (FdII) 0.99 1 106 GO:0005829
GO:0009055
GO:0046872
GO:0051537
GO:0140647

Feature Viewer

pLDDT pTM Quality
96.1 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map