F335919

General Info

Members Datasets Scaffolds Average Seq Length
223 147 446 393

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0020629|Ga0495594_0020629_348_1610
Length 354
Sequence MKRHALVASVDQGSIEDVVKAFEAANPGVKVRYTTSGADQYQQQIRTQLASGTAPDVMTVWPGNGNPGATYVLAKPGYLLDLSDQPWVAKLPAGLKGVTQFQGKTYNAVFGLNGIGAVYNQQALDQAQLKPPTTWTELLTFCRAAAGKGTPAFALGIQDNWVTQLALYALVATLVYGPDRDFDTKMQSGSATFARSPWTTAMAKYQEMNAASGKTLGIIQGNWVVALLKGKNPAASFVLKALPATDTPATFVMPAAELALKFVSYIMSPEGMKVFNGKQGSLPAIPDNGSGADPAFTELTTFLKDNRTVPFMDQLWPNAKVQQTMLSGLQEIFSGQSTPDKVLAAMDADYKAGA

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
81 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
84 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
87 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
141 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
142 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
143 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
144 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
145 2862574272 Streptomyces sp. AcE210 Isolate Nodule
146 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
147 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.41
Metatranscriptomes 0.45
Isolates 3.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0.45
Rhizoplane 0.9
Rhizosphere 83.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0020629 3300046499 Bacteria 3511
2 JGI24739J22299_10029647 3300001989 Bacteria 1901
3 JGI25406J46586_10000708 3300003203 Bacteria 15585
4 JGI25406J46586_10001752 3300003203 Bacteria 10203
5 JGI25406J46586_10010881 3300003203 Bacteria 4010
6 Ga0070658_10023574 3300005327 Bacteria 4938
7 Ga0070683_100002546 3300005329 Bacteria 14556
8 Ga0070683_100008116 3300005329 Bacteria 8916
9 Ga0068869_100003996 3300005334 Bacteria 9121
10 Ga0068868_100049458 3300005338 Bacteria 3299
11 Ga0070661_100050269 3300005344 Bacteria 3050
12 Ga0070668_100009856 3300005347 Bacteria 7077
13 Ga0070668_100040868 3300005347 Bacteria 3551
14 Ga0070675_100001647 3300005354 Bacteria 16506
15 Ga0070659_100019345 3300005366 Bacteria 5158
16 Ga0070659_100070243 3300005366 Bacteria 2782
17 Ga0070667_100025797 3300005367 Bacteria 4888
18 Ga0070714_100000844 3300005435 Bacteria 21724
19 Ga0070700_100033266 3300005441 Bacteria 3104
20 Ga0070663_100016730 3300005455 Bacteria 4772
21 Ga0070681_10002707 3300005458 Bacteria 16307
22 Ga0070679_100014584 3300005530 Bacteria 7551
23 Ga0070684_100006720 3300005535 Bacteria 8920
24 Ga0070684_100009764 3300005535 Bacteria 7576
25 Ga0070684_100023852 3300005535 Bacteria 5125
26 Ga0068853_100324763 3300005539 Bacteria 1427
27 Ga0070664_100009303 3300005564 Bacteria 7973
28 Ga0068857_100093219 3300005577 Bacteria 2697
29 Ga0070702_100076174 3300005615 Bacteria 1996
30 Ga0068870_10106629 3300005840 Bacteria 1593
31 Ga0068862_100025385 3300005844 Bacteria 4974
32 Ga0068862_100068105 3300005844 Bacteria 3070
33 Ga0081455_10005765 3300005937 Bacteria 13502
34 Ga0081455_10027057 3300005937 Bacteria 5260
35 Ga0081455_10083136 3300005937 Bacteria 2617
36 Ga0081540_1011267 3300005983 Bacteria 5988
37 Ga0081540_1077061 3300005983 Bacteria 1517
38 Ga0081539_10000137 3300005985 Bacteria 171821
39 Ga0081539_10001632 3300005985 Bacteria 36555
40 Ga0081539_10001788 3300005985 Bacteria 34101
41 Ga0081539_10003863 3300005985 Bacteria 17558
42 Ga0081539_10009358 3300005985 Bacteria 8212
43 Ga0075370_10005150 3300006353 Bacteria 6454
44 Ga0075428_100000132 3300006844 Bacteria 65638
45 Ga0075428_100006690 3300006844 Bacteria 12824
46 Ga0075428_100141629 3300006844 Bacteria 2614
47 Ga0075430_100009479 3300006846 Bacteria 8228
48 Ga0075431_100022479 3300006847 Bacteria 6447
49 Ga0075431_100058675 3300006847 Bacteria 3972
50 Ga0075431_100064607 3300006847 Bacteria 3779
51 Ga0075431_100068709 3300006847 Bacteria 3656
52 Ga0075429_100002146 3300006880 Bacteria 16455
53 Ga0075429_100015594 3300006880 Bacteria 6585
54 Ga0111539_10000786 3300009094 Bacteria 41312
55 Ga0105245_10000580 3300009098 Bacteria 33235
56 Ga0114129_10004535 3300009147 Bacteria 19609
57 Ga0114129_10045387 3300009147 Bacteria 6178
58 Ga0114129_10299103 3300009147 Bacteria 2145
59 Ga0105249_10036512 3300009553 Bacteria 4457
60 Ga0105239_10247987 3300010375 Bacteria 2000
61 Ga0157375_10200874 3300013308 Bacteria 2149
62 Ga0157377_10000889 3300014745 Bacteria 12469
63 Ga0206356_11286890 3300020070 Bacteria 1692
64 Ga0207688_10041516 3300025901 Bacteria 2559
65 Ga0207705_10032786 3300025909 Bacteria 3712
66 Ga0207707_10023461 3300025912 Bacteria 5397
67 Ga0207657_10075775 3300025919 Bacteria 2838
68 Ga0207649_10033978 3300025920 Bacteria 3051
69 Ga0207652_10022387 3300025921 Bacteria 5228
70 Ga0207681_10084241 3300025923 Bacteria 2253
71 Ga0207659_10023302 3300025926 Bacteria 4130
72 Ga0207687_10054353 3300025927 Bacteria 2801
73 Ga0207664_10001656 3300025929 Bacteria 14671
74 Ga0207690_10015421 3300025932 Bacteria 4631
75 Ga0207691_10311284 3300025940 Bacteria 1351
76 Ga0207661_10001129 3300025944 Bacteria 17821
77 Ga0207679_10003022 3300025945 Bacteria 10419
78 Ga0207679_10029707 3300025945 Bacteria 3808
79 Ga0207668_10009339 3300025972 Bacteria 5871
80 Ga0207668_10141787 3300025972 Bacteria 1849
81 Ga0207658_10095716 3300025986 Bacteria 2314
82 Ga0207678_10015382 3300026067 Bacteria 6728
83 Ga0207708_10049096 3300026075 Bacteria 3213
84 Ga0207674_10119219 3300026116 Bacteria 2608
85 Ga0207428_10016500 3300027907 Bacteria 6351
86 Ga0268266_10082255 3300028379 Bacteria 2809
87 Ga0268265_10021308 3300028380 Bacteria 4538
88 Ga0307517_10098611 3300028786 Bacteria 2324
89 Ga0307515_10000027 3300028794 Bacteria 371624
90 Ga0307515_10002059 3300028794 Bacteria 44330
91 Ga0307515_10160792 3300028794 Bacteria 2292
92 Ga0307512_10001052 3300030522 Bacteria 40344
93 Ga0307512_10038569 3300030522 Bacteria 4016
94 Ga0307513_10000508 3300031456 Bacteria 56049
95 Ga0307513_10011155 3300031456 Bacteria 11192
96 Ga0307509_10122933 3300031507 Bacteria 2569
97 Ga0307509_10220242 3300031507 Bacteria 1712
98 Ga0307408_100095803 3300031548 Bacteria 2250
99 Ga0307408_100278198 3300031548 Bacteria 1393
100 Ga0307508_10005017 3300031616 Bacteria 12721
101 Ga0307508_10006681 3300031616 Bacteria 10820
102 Ga0307508_10016493 3300031616 Bacteria 6726
103 Ga0307508_10095471 3300031616 Bacteria 2564
104 Ga0307508_10158530 3300031616 Bacteria 1867
105 Ga0307516_10002495 3300031730 Bacteria 24542
106 Ga0307516_10043709 3300031730 Bacteria 4437
107 Ga0307405_10017109 3300031731 Bacteria 3971
108 Ga0307413_10047521 3300031824 Bacteria 2560
109 Ga0307410_10004863 3300031852 Bacteria 7025
110 Ga0307406_10013238 3300031901 Bacteria 4722
111 Ga0307406_10243921 3300031901 Bacteria 1349
112 Ga0307407_10137466 3300031903 Bacteria 1572
113 Ga0307409_100060437 3300031995 Bacteria 2955
114 Ga0307409_100073019 3300031995 Bacteria 2735
115 Ga0307411_10223054 3300032005 Bacteria 1464
116 Ga0307415_100004547 3300032126 Bacteria 7226
117 Ga0307415_100016919 3300032126 Bacteria 4361
118 Ga0307415_100047750 3300032126 Bacteria 2883
119 Ga0307415_100053681 3300032126 Bacteria 2747
120 Ga0307415_100054479 3300032126 Bacteria 2731
121 Ga0307415_100076886 3300032126 Bacteria 2368
122 Ga0307415_100141527 3300032126 Bacteria 1838
123 Ga0307507_10000821 3300033179 Bacteria 68944
124 Ga0307507_10022872 3300033179 Bacteria 6884
125 Ga0373951_0000314 3300035091 Bacteria 15285
126 Ga0373941_0011365 3300035115 Bacteria 2299
127 Ga0373953_0031659 3300035117 Bacteria 2058
128 Ga0373942_0000897 3300035207 Bacteria 8142
129 Ga0373962_0004269 3300035242 Bacteria 3450
130 Ga0373935_0003221 3300035692 Bacteria 9426
131 Ga0451837_0371337 3300041494 Bacteria 2376
132 Ga0451839_0934801 3300041496 Bacteria 1490
133 Ga0451853_1992053 3300041512 Bacteria 3837
134 Ga0495592_0000011 3300046454 Bacteria 156647
135 Ga0495592_0021834 3300046454 Bacteria 4870
136 Ga0495592_0056343 3300046454 Bacteria 2905
137 Ga0495629_0000827 3300046459 Bacteria 25099
138 Ga0495651_0000160 3300046462 Bacteria 49411
139 Ga0495651_0003786 3300046462 Bacteria 11572
140 Ga0495651_0009022 3300046462 Bacteria 7657
141 Ga0495653_0000345 3300046463 Bacteria 37856
142 Ga0495662_0000141 3300046476 Bacteria 27833
143 Ga0495662_0009221 3300046476 Bacteria 4840
144 Ga0495664_0028553 3300046477 Bacteria 3257
145 Ga0495608_0014558 3300046511 Bacteria 5457
146 Ga0495628_0000064 3300046516 Bacteria 85991
147 Ga0495628_0019640 3300046516 Bacteria 5582
148 Ga0495630_0000035 3300046517 Bacteria 118545
149 Ga0495630_0010829 3300046517 Bacteria 6586
150 Ga0495632_0047296 3300046519 Bacteria 2134
151 Ga0495666_0000539 3300046526 Bacteria 16851
152 Ga0495652_0000169 3300046529 Bacteria 74610
153 Ga0495652_0048712 3300046529 Bacteria 3629
154 Ga0495665_0061331 3300046531 Bacteria 1986
155 Ga0495640_0002459 3300046533 Bacteria 14887
156 Ga0495587_0000064 3300046536 Bacteria 90007
157 Ga0495587_0001922 3300046536 Bacteria 13843
158 Ga0495645_0000042 3300046543 Bacteria 91093
159 Ga0495667_0000154 3300046559 Bacteria 46767
160 Ga0495634_0000148 3300046642 Bacteria 62329
161 Ga0495634_0001198 3300046642 Bacteria 23916
162 Ga0495634_0003396 3300046642 Bacteria 12784
163 Ga0495635_0000032 3300046663 Bacteria 109069
164 Ga0495635_0002578 3300046663 Bacteria 12401
165 Ga0495635_0107574 3300046663 Bacteria 1905
166 Ga0495657_0000075 3300046675 Bacteria 89389
167 Ga0495657_0002865 3300046675 Bacteria 14329
168 Ga0495657_0037791 3300046675 Bacteria 3325
169 Ga0495599_0000044 3300046678 Bacteria 89350
170 Ga0495646_0000028 3300046680 Bacteria 92735
171 Ga0495646_0003174 3300046680 Bacteria 10204
172 Ga0495613_0000586 3300046689 Bacteria 29455
173 Ga0495613_0001051 3300046689 Bacteria 21064
174 Ga0495613_0002107 3300046689 Bacteria 15108
175 Ga0495613_0054180 3300046689 Bacteria 2949
176 Ga0495670_0051806 3300046691 Bacteria 2054
177 Ga0495600_0000044 3300046809 Bacteria 71943
178 Ga0495600_0010284 3300046809 Bacteria 5802
179 Ga0495581_0002865 3300047315 Bacteria 9852
180 Ga0495604_0000162 3300047317 Bacteria 59086
181 Ga0495604_0000545 3300047317 Bacteria 33154
182 Ga0495674_0000036 3300047319 Bacteria 103830
183 Ga0495674_0058174 3300047319 Bacteria 3381
184 Ga0495676_0005498 3300047321 Bacteria 11624
185 Ga0495680_0004036 3300047322 Bacteria 14162
186 Ga0495687_018811 3300047443 Bacteria 3405
187 Ga0495675_0000126 3300047444 Bacteria 54783
188 Ga0495675_0133451 3300047444 Bacteria 1542
189 Ga0495684_0000474 3300047471 Bacteria 32805
190 Ga0495593_0002178 3300047673 Bacteria 11724
191 Ga0495602_0000078 3300048088 Bacteria 94384
192 Ga0495602_0147799 3300048088 Bacteria 1851
193 Ga0495614_0000643 3300048089 Bacteria 14601
194 Ga0496108_0000066 3300048911 Bacteria 116839
195 Ga0496112_0034356 3300048915 Bacteria 4935
196 nmdc:mga03n38_68994_c1 3300050490 Bacteria 1631
197 nmdc:mga07m45_7981_c1 3300050496 Bacteria 5423
198 nmdc:mga05p37_151888_c1 3300050507 Bacteria 2832
199 nmdc:mga05p37_1609_c1 3300050507 Bacteria 26157
200 nmdc:mga05p37_33575_c1 3300050507 Bacteria 6285
201 nmdc:mga09592_3071_c1 3300050508 Bacteria 13539
202 nmdc:mga09592_51701_c1 3300050508 Bacteria 3467
203 nmdc:mga0qj67_2315_c1 3300050509 Bacteria 13539
204 nmdc:mga06r32_169293_c1 3300050510 Bacteria 2168
205 nmdc:mga06r32_59430_c1 3300050510 Bacteria 3676
206 nmdc:mga06r32_76434_c1 3300050510 Bacteria 3252
207 nmdc:mga06r32_7933_c1 3300050510 Bacteria 9546
208 nmdc:mga08y16_66735_c1 3300050511 Bacteria 3755
209 Ga0495601_0001449 3300053077 Bacteria 13074
210 Ga0495601_0020812 3300053077 Bacteria 4010
211 Ga0500641_0009282 3300053096 Bacteria 3535
212 Ga0500594_0005726 3300053118 Bacteria 2764
213 Ga0500568_0045011 3300053139 Bacteria 1758
214 Ga0500577_0001607 3300053142 Bacteria 5778
215 Ga0500616_0004455 3300053153 Bacteria 9972
216 Ga0500624_005401 3300053157 Bacteria 1698
217 2585306508 2582581313 Bacteria 10042643
218 2616701077 2616644814 Bacteria 11555299
219 2676486613 2675903059 Bacteria 8644972
220 2857293099 2857288857 Bacteria 7189066
221 2862575779 2862574272 Bacteria 10567477
222 2867305953 2867302475 Bacteria 7087181
223 2929222637 2929219909 Bacteria 6984360
224 Ga0495594_0020629
225 JGI24739J22299_10029647
226 JGI25406J46586_10000708
227 JGI25406J46586_10001752
228 JGI25406J46586_10010881
229 Ga0070658_10023574
230 Ga0070683_100002546
231 Ga0070683_100008116
232 Ga0068869_100003996
233 Ga0068868_100049458
234 Ga0070661_100050269
235 Ga0070668_100009856
236 Ga0070668_100040868
237 Ga0070675_100001647
238 Ga0070659_100019345
239 Ga0070659_100070243
240 Ga0070667_100025797
241 Ga0070714_100000844
242 Ga0070700_100033266
243 Ga0070663_100016730
244 Ga0070681_10002707
245 Ga0070679_100014584
246 Ga0070684_100006720
247 Ga0070684_100009764
248 Ga0070684_100023852
249 Ga0068853_100324763
250 Ga0070664_100009303
251 Ga0068857_100093219
252 Ga0070702_100076174
253 Ga0068870_10106629
254 Ga0068862_100025385
255 Ga0068862_100068105
256 Ga0081455_10005765
257 Ga0081455_10027057
258 Ga0081455_10083136
259 Ga0081540_1011267
260 Ga0081540_1077061
261 Ga0081539_10000137
262 Ga0081539_10001632
263 Ga0081539_10001788
264 Ga0081539_10003863
265 Ga0081539_10009358
266 Ga0075370_10005150
267 Ga0075428_100000132
268 Ga0075428_100006690
269 Ga0075428_100141629
270 Ga0075430_100009479
271 Ga0075431_100022479
272 Ga0075431_100058675
273 Ga0075431_100064607
274 Ga0075431_100068709
275 Ga0075429_100002146
276 Ga0075429_100015594
277 Ga0111539_10000786
278 Ga0105245_10000580
279 Ga0114129_10004535
280 Ga0114129_10045387
281 Ga0114129_10299103
282 Ga0105249_10036512
283 Ga0105239_10247987
284 Ga0157375_10200874
285 Ga0157377_10000889
286 Ga0206356_11286890
287 Ga0207688_10041516
288 Ga0207705_10032786
289 Ga0207707_10023461
290 Ga0207657_10075775
291 Ga0207649_10033978
292 Ga0207652_10022387
293 Ga0207681_10084241
294 Ga0207659_10023302
295 Ga0207687_10054353
296 Ga0207664_10001656
297 Ga0207690_10015421
298 Ga0207691_10311284
299 Ga0207661_10001129
300 Ga0207679_10003022
301 Ga0207679_10029707
302 Ga0207668_10009339
303 Ga0207668_10141787
304 Ga0207658_10095716
305 Ga0207678_10015382
306 Ga0207708_10049096
307 Ga0207674_10119219
308 Ga0207428_10016500
309 Ga0268266_10082255
310 Ga0268265_10021308
311 Ga0307517_10098611
312 Ga0307515_10000027
313 Ga0307515_10002059
314 Ga0307515_10160792
315 Ga0307512_10001052
316 Ga0307512_10038569
317 Ga0307513_10000508
318 Ga0307513_10011155
319 Ga0307509_10122933
320 Ga0307509_10220242
321 Ga0307408_100095803
322 Ga0307408_100278198
323 Ga0307508_10005017
324 Ga0307508_10006681
325 Ga0307508_10016493
326 Ga0307508_10095471
327 Ga0307508_10158530
328 Ga0307516_10002495
329 Ga0307516_10043709
330 Ga0307405_10017109
331 Ga0307413_10047521
332 Ga0307410_10004863
333 Ga0307406_10013238
334 Ga0307406_10243921
335 Ga0307407_10137466
336 Ga0307409_100060437
337 Ga0307409_100073019
338 Ga0307411_10223054
339 Ga0307415_100004547
340 Ga0307415_100016919
341 Ga0307415_100047750
342 Ga0307415_100053681
343 Ga0307415_100054479
344 Ga0307415_100076886
345 Ga0307415_100141527
346 Ga0307507_10000821
347 Ga0307507_10022872
348 Ga0373951_0000314
349 Ga0373941_0011365
350 Ga0373953_0031659
351 Ga0373942_0000897
352 Ga0373962_0004269
353 Ga0373935_0003221
354 Ga0451837_0371337
355 Ga0451839_0934801
356 Ga0451853_1992053
357 Ga0495592_0000011
358 Ga0495592_0021834
359 Ga0495592_0056343
360 Ga0495629_0000827
361 Ga0495651_0000160
362 Ga0495651_0003786
363 Ga0495651_0009022
364 Ga0495653_0000345
365 Ga0495662_0000141
366 Ga0495662_0009221
367 Ga0495664_0028553
368 Ga0495608_0014558
369 Ga0495628_0000064
370 Ga0495628_0019640
371 Ga0495630_0000035
372 Ga0495630_0010829
373 Ga0495632_0047296
374 Ga0495666_0000539
375 Ga0495652_0000169
376 Ga0495652_0048712
377 Ga0495665_0061331
378 Ga0495640_0002459
379 Ga0495587_0000064
380 Ga0495587_0001922
381 Ga0495645_0000042
382 Ga0495667_0000154
383 Ga0495634_0000148
384 Ga0495634_0001198
385 Ga0495634_0003396
386 Ga0495635_0000032
387 Ga0495635_0002578
388 Ga0495635_0107574
389 Ga0495657_0000075
390 Ga0495657_0002865
391 Ga0495657_0037791
392 Ga0495599_0000044
393 Ga0495646_0000028
394 Ga0495646_0003174
395 Ga0495613_0000586
396 Ga0495613_0001051
397 Ga0495613_0002107
398 Ga0495613_0054180
399 Ga0495670_0051806
400 Ga0495600_0000044
401 Ga0495600_0010284
402 Ga0495581_0002865
403 Ga0495604_0000162
404 Ga0495604_0000545
405 Ga0495674_0000036
406 Ga0495674_0058174
407 Ga0495676_0005498
408 Ga0495680_0004036
409 Ga0495687_018811
410 Ga0495675_0000126
411 Ga0495675_0133451
412 Ga0495684_0000474
413 Ga0495593_0002178
414 Ga0495602_0000078
415 Ga0495602_0147799
416 Ga0495614_0000643
417 Ga0496108_0000066
418 Ga0496112_0034356
419 nmdc:mga03n38_68994_c1
420 nmdc:mga07m45_7981_c1
421 nmdc:mga05p37_151888_c1
422 nmdc:mga05p37_1609_c1
423 nmdc:mga05p37_33575_c1
424 nmdc:mga09592_3071_c1
425 nmdc:mga09592_51701_c1
426 nmdc:mga0qj67_2315_c1
427 nmdc:mga06r32_169293_c1
428 nmdc:mga06r32_59430_c1
429 nmdc:mga06r32_76434_c1
430 nmdc:mga06r32_7933_c1
431 nmdc:mga08y16_66735_c1
432 Ga0495601_0001449
433 Ga0495601_0020812
434 Ga0500641_0009282
435 Ga0500594_0005726
436 Ga0500568_0045011
437 Ga0500577_0001607
438 Ga0500616_0004455
439 Ga0500624_005401
440 2585306508
441 2616701077
442 2676486613
443 2857293099
444 2862575779
445 2867305953
446 2929222637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

17

302

0.79

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

8

278

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zze-assembly1.cif.gz_A raffinose and panose binding protein from bifidobacterium animalis subsp. lactis bl-04, bound with panose 0.8649 8 386
4zze-assembly2.cif.gz_B raffinose and panose binding protein from bifidobacterium animalis subsp. lactis bl-04, bound with panose 0.8601 8 386
4zza-assembly1.cif.gz_A raffinose and panose binding protein from bifidobacterium animalis subsp. lactis bl-04, bound with raffinose, selenomethionine derivative 0.8585 8 385
4zs9-assembly1.cif.gz_A raffinose and panose binding protein from bifidobacterium animalis subsp. lactis bl-04, bound with raffinose 0.8584 8 386
4zs9-assembly2.cif.gz_B raffinose and panose binding protein from bifidobacterium animalis subsp. lactis bl-04, bound with raffinose 0.8581 8 386
ID Description Score Start End Superfamily
4zzaB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.861 121 384 3.40.190.10
4zzaB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8494 121 384 3.40.190.10
5ci5B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8315 8 116 3.40.190.10
3qufA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.822 8 112 3.40.190.10
2ghaA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8216 8 117 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A557ZDY5-F1-model_v4 deleted 0.9259 9 387
AF-A0A1G9HLN2-F1-model_v4 Probable sugar-binding periplasmic protein 0.9185 8 385 GO:0030313
AF-A0A3N1D3F9-F1-model_v4 Raffinose/stachyose/melibiose transport system substrate-binding protein 0.9126 7 385
AF-A0A6I1YYK8-F1-model_v4 Multiple sugar-binding protein 0.9058 7 385
AF-A0A6A9UZZ7-F1-model_v4 Extracellular solute-binding protein 0.904 6 385

Map