F335809

General Info

Members Datasets Scaffolds Average Seq Length
223 108 440 283

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0018515|Ga0373925_0018515_2638_3648
Length 336
Sequence LPGAEPAAQILFGAEVFASNKGAWRVRGAQHRLDHREDTMRFRVSIGAAVLAAVMMTAIGAAAADEAKYPDLKGQWRRTGTGGLLAGGAGGLRWDESKPPKPTPSLGQEPPLTPEYQAIYEANLIDMTKGGQGIDPTYSCVSPGMPRVMIAYSALEFVVTADTTYILFERDHDHYRRVYTDGRDFPANMASEPRFLGYSIGKWLDEDGDGRYDTLTVETRGLKGPRVYDATGIPLHGDNETIVQERIYLDKANANLLHDDITTIDHALTRPWVVNKVYRRAVTDKPIWWDHSVCGEGNAHVGIGKEVYYLNGDGLLMPAMKDQPPPDLRYFKKYNR

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
9 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
50 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
51 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
52 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
53 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
54 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
55 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
56 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
57 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
58 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
59 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
74 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
75 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
76 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
77 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
78 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
86 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
102 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 5.83
Rhizosphere 87.89
Stem 0
Stem Tuber 0
Unclassified 24.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0018515 3300037068 Bacteria 5063
2 Ga0070667_100796162 3300005367 Unclassified 877
3 Ga0070709_10038844 3300005434 Bacteria 2918
4 Ga0070713_100060650 3300005436 Bacteria 3163
5 Ga0070713_100102050 3300005436 Bacteria 2486
6 Ga0070713_100178738 3300005436 Bacteria 1906
7 Ga0070713_100189475 3300005436 Bacteria 1853
8 Ga0070713_100191399 3300005436 Bacteria 1843
9 Ga0070713_100210612 3300005436 Bacteria 1759
10 Ga0070694_100537728 3300005444 Unclassified 934
11 Ga0070708_100119624 3300005445 Bacteria 2428
12 Ga0070707_100039688 3300005468 Bacteria 4501
13 Ga0070702_100190147 3300005615 Bacteria 1350
14 Ga0068863_100097355 3300005841 Unclassified 2794
15 Ga0068863_100124774 3300005841 Bacteria 2456
16 Ga0068860_100149799 3300005843 Bacteria 2246
17 Ga0068860_100405271 3300005843 Unclassified 1349
18 Ga0081455_10004763 3300005937 Bacteria 15070
19 Ga0081455_10015949 3300005937 Bacteria 7273
20 Ga0081455_10026348 3300005937 Bacteria 5349
21 Ga0081455_10028702 3300005937 Bacteria 5079
22 Ga0081455_10112082 3300005937 Bacteria 2166
23 Ga0081540_1009752 3300005983 Bacteria 6580
24 Ga0081540_1041686 3300005983 Bacteria 2377
25 Ga0081540_1057676 3300005983 Unclassified 1876
26 Ga0070717_10354779 3300006028 Unclassified 1312
27 Ga0075365_10108978 3300006038 Bacteria 1902
28 Ga0075368_10026973 3300006042 Unclassified 2212
29 Ga0070716_100377866 3300006173 Bacteria 1012
30 Ga0070712_100179610 3300006175 Bacteria 1648
31 Ga0097621_100219221 3300006237 Unclassified 1657
32 Ga0068871_100050954 3300006358 Unclassified 3350
33 Ga0068871_100153081 3300006358 Bacteria 1968
34 Ga0075428_100018616 3300006844 Bacteria 7675
35 Ga0075428_100235619 3300006844 Unclassified 1975
36 Ga0075428_100472101 3300006844 Bacteria 1343
37 Ga0075430_100198399 3300006846 Bacteria 1667
38 Ga0075431_100155197 3300006847 Bacteria 2355
39 Ga0075433_10016630 3300006852 Bacteria 6070
40 Ga0075433_10069599 3300006852 Bacteria 3091
41 Ga0075433_10081490 3300006852 Bacteria 2853
42 Ga0075434_100032433 3300006871 Bacteria 5151
43 Ga0075434_100048259 3300006871 Bacteria 4225
44 Ga0075434_100118374 3300006871 Bacteria 2663
45 Ga0075435_100330883 3300007076 Unclassified 1305
46 Ga0099794_10005232 3300007265 Bacteria 5186
47 Ga0099794_10008465 3300007265 Bacteria 4273
48 Ga0099795_10000918 3300007788 Bacteria 5953
49 Ga0099795_10001704 3300007788 Bacteria 4889
50 Ga0099795_10001890 3300007788 Unclassified 4749
51 Ga0099795_10003976 3300007788 Bacteria 3749
52 Ga0099795_10005508 3300007788 Bacteria 3375
53 Ga0099795_10022588 3300007788 Bacteria 2078
54 Ga0099795_10025126 3300007788 Bacteria 1994
55 Ga0099795_10045382 3300007788 Unclassified 1580
56 Ga0111539_10017103 3300009094 Bacteria 8977
57 Ga0111539_10024303 3300009094 Bacteria 7440
58 Ga0111539_10279759 3300009094 Bacteria 1941
59 Ga0111539_10574305 3300009094 Bacteria 1313
60 Ga0114129_10124951 3300009147 Unclassified 3538
61 Ga0105243_10366803 3300009148 Bacteria 1327
62 Ga0099796_10000392 3300010159 Bacteria 7179
63 Ga0099796_10001485 3300010159 Unclassified 4741
64 Ga0099796_10001840 3300010159 Bacteria 4463
65 Ga0099796_10003090 3300010159 Unclassified 3795
66 Ga0099796_10004355 3300010159 Bacteria 3415
67 Ga0099796_10006150 3300010159 Bacteria 3053
68 Ga0099796_10007139 3300010159 Bacteria 2907
69 Ga0099796_10015290 3300010159 Bacteria 2240
70 Ga0099796_10019452 3300010159 Bacteria 2059
71 Ga0099796_10039293 3300010159 Bacteria 1592
72 Ga0105246_10435234 3300011119 Unclassified 1098
73 Ga0163163_10363244 3300014325 Bacteria 1504
74 Ga0163163_10543676 3300014325 Bacteria 1224
75 Ga0163163_10648983 3300014325 Unclassified 1119
76 Ga0157380_10002986 3300014326 Bacteria 11519
77 Ga0157379_10260501 3300014968 Bacteria 1575
78 Ga0157379_10290720 3300014968 Bacteria 1488
79 Ga0157376_10118625 3300014969 Bacteria 2341
80 Ga0207699_10265977 3300025906 Archaea 1187
81 Ga0207693_10040259 3300025915 Unclassified 3680
82 Ga0207693_10515387 3300025915 Unclassified 933
83 Ga0207646_10298861 3300025922 Unclassified 1454
84 Ga0207700_10030176 3300025928 Bacteria 3836
85 Ga0207700_10217905 3300025928 Bacteria 1616
86 Ga0207700_10286181 3300025928 Bacteria 1419
87 Ga0207665_10285593 3300025939 Unclassified 1229
88 Ga0207641_10053630 3300026088 Unclassified 3419
89 Ga0207641_10101898 3300026088 Bacteria 2531
90 Ga0209179_1000352 3300027512 Bacteria 4495
91 Ga0209179_1000789 3300027512 Bacteria 3457
92 Ga0209179_1005701 3300027512 Bacteria 1966
93 Ga0209179_1012634 3300027512 Bacteria 1520
94 Ga0209179_1018280 3300027512 Bacteria 1337
95 Ga0209179_1022411 3300027512 Bacteria 1240
96 Ga0209588_1016840 3300027671 Unclassified 2260
97 Ga0209813_10056757 3300027866 Unclassified 1240
98 Ga0207428_10027640 3300027907 Bacteria 4721
99 Ga0207428_10086287 3300027907 Bacteria 2443
100 Ga0268264_10228804 3300028381 Bacteria 1716
101 Ga0307405_10074070 3300031731 Bacteria 2201
102 Ga0373929_0008599 3300035085 Unclassified 1883
103 Ga0373934_0048715 3300035086 Bacteria 1678
104 Ga0373934_0081372 3300035086 Bacteria 1301
105 Ga0373944_0056781 3300035089 Bacteria 1247
106 Ga0373941_0047933 3300035115 Bacteria 1347
107 Ga0373945_0055638 3300035116 Bacteria 1466
108 Ga0373953_0011894 3300035117 Bacteria 3067
109 Ga0373953_0090367 3300035117 Bacteria 1280
110 Ga0373954_0146009 3300035118 Unclassified 1155
111 Ga0373956_0145212 3300035119 Unclassified 1115
112 Ga0373943_0061854 3300035170 Bacteria 1873
113 Ga0373943_0091247 3300035170 Bacteria 1578
114 Ga0373955_0005692 3300035172 Bacteria 5608
115 Ga0373955_0315118 3300035172 Unclassified 945
116 Ga0373924_0050465 3300035410 Bacteria 1723
117 Ga0373931_0011581 3300035691 Plasmid 4260
118 Ga0373931_0024365 3300035691 Bacteria 3065
119 Ga0373931_0075932 3300035691 Unclassified 1844
120 Ga0373931_0144249 3300035691 Unclassified 1382
121 Ga0373935_0041315 3300035692 Bacteria 2897
122 Ga0373935_0154599 3300035692 Bacteria 1559
123 Ga0373935_0188598 3300035692 Bacteria 1419
124 Ga0373935_0190225 3300035692 Bacteria 1413
125 Ga0373927_0004915 3300035695 Bacteria 9278
126 Ga0373927_0011117 3300035695 Bacteria 5996
127 Ga0373927_0018176 3300035695 Bacteria 4622
128 Ga0373927_0049590 3300035695 Bacteria 2715
129 Ga0373927_0066463 3300035695 Bacteria 2332
130 Ga0373927_0096466 3300035695 Bacteria 1922
131 Ga0373927_0313206 3300035695 Bacteria 1033
132 Ga0373933_0110967 3300035724 Bacteria 1711
133 Ga0373933_0178195 3300035724 Unclassified 1355
134 Ga0373947_0076596 3300035725 Bacteria 2062
135 Ga0373947_0202878 3300035725 Bacteria 1298
136 Ga0373937_0003526 3300036401 Bacteria 13166
137 Ga0373937_0003565 3300036401 Bacteria 13115
138 Ga0373937_0017507 3300036401 Bacteria 6386
139 Ga0373937_0023243 3300036401 Bacteria 5580
140 Ga0373937_0040324 3300036401 Unclassified 4256
141 Ga0373937_0305787 3300036401 Bacteria 1503
142 Ga0373925_0008475 3300037068 Bacteria 7493
143 Ga0373925_0032800 3300037068 Unclassified 3824
144 Ga0373925_0052913 3300037068 Bacteria 3034
145 Ga0373925_0102908 3300037068 Bacteria 2198
146 Ga0373925_0249594 3300037068 Bacteria 1423
147 Ga0436364_0129780 3300037853 Bacteria 2067
148 Ga0436364_1541967 3300037853 Bacteria 1655
149 Ga0436365_1172975 3300039437 Bacteria 4151
150 Ga0436361_0608403 3300039447 Bacteria 11894
151 Ga0436363_0130596 3300039450 Unclassified 1728
152 Ga0436363_0440448 3300039450 Bacteria 3257
153 Ga0436363_0966048 3300039450 Bacteria 2635
154 Ga0436363_1390679 3300039450 Bacteria 4680
155 Ga0495592_0324739 3300046454 Unclassified 994
156 Ga0495629_0088410 3300046459 Bacteria 2161
157 Ga0495582_0054237 3300046473 Bacteria 2211
158 Ga0495662_0047502 3300046476 Bacteria 2072
159 Ga0495664_0212055 3300046477 Bacteria 1173
160 Ga0495664_0232626 3300046477 Unclassified 1115
161 Ga0495584_0022153 3300046491 Bacteria 3225
162 Ga0495584_0069189 3300046491 Bacteria 1774
163 Ga0495584_0106983 3300046491 Bacteria 1414
164 Ga0495665_0204606 3300046531 Bacteria 1023
165 Ga0495640_0018589 3300046533 Bacteria 5148
166 Ga0495640_0074336 3300046533 Bacteria 2273
167 Ga0495640_0113055 3300046533 Bacteria 1772
168 Ga0495640_0122638 3300046533 Bacteria 1688
169 Ga0495634_0081990 3300046642 Bacteria 2109
170 Ga0495635_0157985 3300046663 Unclassified 1543
171 Ga0495659_0039324 3300046664 Bacteria 1682
172 Ga0495658_0006621 3300046683 Bacteria 5694
173 Ga0495658_0035015 3300046683 Unclassified 2759
174 Ga0495658_0050221 3300046683 Unclassified 2359
175 Ga0495669_0183190 3300046684 Unclassified 999
176 Ga0495613_0067526 3300046689 Unclassified 2610
177 Ga0495613_0070739 3300046689 Bacteria 2544
178 Ga0495613_0160458 3300046689 Bacteria 1600
179 Ga0495680_0155819 3300047322 Bacteria 1662
180 Ga0495684_0221555 3300047471 Bacteria 1387
181 Ga0495614_0061262 3300048089 Bacteria 1617
182 Ga0496101_0296923 3300048904 Bacteria 1265
183 Ga0496104_0102198 3300048907 Bacteria 2745
184 Ga0496104_0108538 3300048907 Bacteria 2660
185 Ga0496104_0159479 3300048907 Unclassified 2164
186 Ga0496104_0234652 3300048907 Bacteria 1746
187 Ga0496105_0256122 3300048908 Unclassified 1417
188 Ga0496109_0169144 3300048912 Bacteria 2050
189 Ga0496110_0082174 3300048913 Unclassified 2873
190 Ga0496110_0447502 3300048913 Unclassified 1177
191 Ga0496113_0449848 3300048916 Unclassified 1035
192 Ga0496114_0231133 3300048917 Unclassified 1625
193 Ga0496114_0310506 3300048917 Bacteria 1393
194 Ga0496115_0190157 3300048918 Unclassified 1696
195 Ga0501039_0256558 3300049575 Bacteria 1375
196 Ga0501040_0196716 3300049576 Bacteria 1431
197 Ga0501042_0258545 3300049578 Bacteria 1257
198 Ga0501068_0298648 3300049584 Bacteria 1031
199 Ga0501071_0063043 3300049587 Bacteria 2687
200 Ga0501071_0259681 3300049587 Unclassified 1312
201 nmdc:mga0yw44_77122_c1 3300050492 Bacteria 2081
202 nmdc:mga06z11_58200_c1 3300050494 Bacteria 2004
203 nmdc:mga04h51_21409_c1 3300050495 Unclassified 1945
204 nmdc:mga04h51_96152_c1 3300050495 Bacteria 1073
205 nmdc:mga05p37_138490_c1 3300050507 Unclassified 2983
206 nmdc:mga05p37_61750_c1 3300050507 Bacteria 4612
207 nmdc:mga0qj67_15112_c1 3300050509 Bacteria 5842
208 nmdc:mga08y16_106727_c1 3300050511 Bacteria 2915
209 nmdc:mga08y16_193425_c1 3300050511 Bacteria 2109
210 nmdc:mga08y16_5689_c1 3300050511 Bacteria 13060
211 nmdc:mga0n895_48423_c1 3300050512 Bacteria 4160
212 nmdc:mga0n895_494507_c1 3300050512 Unclassified 1233
213 nmdc:mga0n895_50923_c1 3300050512 Bacteria 4062
214 nmdc:mga0n895_82144_c1 3300050512 Bacteria 3212
215 nmdc:mga0rr50_346216_c1 3300050513 Unclassified 1249
216 nmdc:mga0rr50_41191_c1 3300050513 Bacteria 1548
217 nmdc:mga0a205_108668_c1 3300050515 Bacteria 2672
218 nmdc:mga0a205_14762_c2 3300050515 Bacteria 4593
219 nmdc:mga0a205_4829_c2 3300050515 Bacteria 2307
220 nmdc:mga0a205_51661_c1 3300050515 Bacteria 3968
221 Ga0373925_0018515
222 Ga0070667_100796162
223 Ga0070709_10038844
224 Ga0070713_100060650
225 Ga0070713_100102050
226 Ga0070713_100178738
227 Ga0070713_100189475
228 Ga0070713_100191399
229 Ga0070713_100210612
230 Ga0070694_100537728
231 Ga0070708_100119624
232 Ga0070707_100039688
233 Ga0070702_100190147
234 Ga0068863_100097355
235 Ga0068863_100124774
236 Ga0068860_100149799
237 Ga0068860_100405271
238 Ga0081455_10004763
239 Ga0081455_10015949
240 Ga0081455_10026348
241 Ga0081455_10028702
242 Ga0081455_10112082
243 Ga0081540_1009752
244 Ga0081540_1041686
245 Ga0081540_1057676
246 Ga0070717_10354779
247 Ga0075365_10108978
248 Ga0075368_10026973
249 Ga0070716_100377866
250 Ga0070712_100179610
251 Ga0097621_100219221
252 Ga0068871_100050954
253 Ga0068871_100153081
254 Ga0075428_100018616
255 Ga0075428_100235619
256 Ga0075428_100472101
257 Ga0075430_100198399
258 Ga0075431_100155197
259 Ga0075433_10016630
260 Ga0075433_10069599
261 Ga0075433_10081490
262 Ga0075434_100032433
263 Ga0075434_100048259
264 Ga0075434_100118374
265 Ga0075435_100330883
266 Ga0099794_10005232
267 Ga0099794_10008465
268 Ga0099795_10000918
269 Ga0099795_10001704
270 Ga0099795_10001890
271 Ga0099795_10003976
272 Ga0099795_10005508
273 Ga0099795_10022588
274 Ga0099795_10025126
275 Ga0099795_10045382
276 Ga0111539_10017103
277 Ga0111539_10024303
278 Ga0111539_10279759
279 Ga0111539_10574305
280 Ga0114129_10124951
281 Ga0105243_10366803
282 Ga0099796_10000392
283 Ga0099796_10001485
284 Ga0099796_10001840
285 Ga0099796_10003090
286 Ga0099796_10004355
287 Ga0099796_10006150
288 Ga0099796_10007139
289 Ga0099796_10015290
290 Ga0099796_10019452
291 Ga0099796_10039293
292 Ga0105246_10435234
293 Ga0163163_10363244
294 Ga0163163_10543676
295 Ga0163163_10648983
296 Ga0157380_10002986
297 Ga0157379_10260501
298 Ga0157379_10290720
299 Ga0157376_10118625
300 Ga0207699_10265977
301 Ga0207693_10040259
302 Ga0207693_10515387
303 Ga0207646_10298861
304 Ga0207700_10030176
305 Ga0207700_10217905
306 Ga0207700_10286181
307 Ga0207665_10285593
308 Ga0207641_10053630
309 Ga0207641_10101898
310 Ga0209179_1000352
311 Ga0209179_1000789
312 Ga0209179_1005701
313 Ga0209179_1012634
314 Ga0209179_1018280
315 Ga0209179_1022411
316 Ga0209588_1016840
317 Ga0209813_10056757
318 Ga0207428_10027640
319 Ga0207428_10086287
320 Ga0268264_10228804
321 Ga0307405_10074070
322 Ga0373929_0008599
323 Ga0373934_0048715
324 Ga0373934_0081372
325 Ga0373944_0056781
326 Ga0373941_0047933
327 Ga0373945_0055638
328 Ga0373953_0011894
329 Ga0373953_0090367
330 Ga0373954_0146009
331 Ga0373956_0145212
332 Ga0373943_0061854
333 Ga0373943_0091247
334 Ga0373955_0005692
335 Ga0373955_0315118
336 Ga0373924_0050465
337 Ga0373931_0011581
338 Ga0373931_0024365
339 Ga0373931_0075932
340 Ga0373931_0144249
341 Ga0373935_0041315
342 Ga0373935_0154599
343 Ga0373935_0188598
344 Ga0373935_0190225
345 Ga0373927_0004915
346 Ga0373927_0011117
347 Ga0373927_0018176
348 Ga0373927_0049590
349 Ga0373927_0066463
350 Ga0373927_0096466
351 Ga0373927_0313206
352 Ga0373933_0110967
353 Ga0373933_0178195
354 Ga0373947_0076596
355 Ga0373947_0202878
356 Ga0373937_0003526
357 Ga0373937_0003565
358 Ga0373937_0017507
359 Ga0373937_0023243
360 Ga0373937_0040324
361 Ga0373937_0305787
362 Ga0373925_0008475
363 Ga0373925_0032800
364 Ga0373925_0052913
365 Ga0373925_0102908
366 Ga0373925_0249594
367 Ga0436364_0129780
368 Ga0436364_1541967
369 Ga0436365_1172975
370 Ga0436361_0608403
371 Ga0436363_0130596
372 Ga0436363_0440448
373 Ga0436363_0966048
374 Ga0436363_1390679
375 Ga0495592_0324739
376 Ga0495629_0088410
377 Ga0495582_0054237
378 Ga0495662_0047502
379 Ga0495664_0212055
380 Ga0495664_0232626
381 Ga0495584_0022153
382 Ga0495584_0069189
383 Ga0495584_0106983
384 Ga0495665_0204606
385 Ga0495640_0018589
386 Ga0495640_0074336
387 Ga0495640_0113055
388 Ga0495640_0122638
389 Ga0495634_0081990
390 Ga0495635_0157985
391 Ga0495659_0039324
392 Ga0495658_0006621
393 Ga0495658_0035015
394 Ga0495658_0050221
395 Ga0495669_0183190
396 Ga0495613_0067526
397 Ga0495613_0070739
398 Ga0495613_0160458
399 Ga0495680_0155819
400 Ga0495684_0221555
401 Ga0495614_0061262
402 Ga0496101_0296923
403 Ga0496104_0102198
404 Ga0496104_0108538
405 Ga0496104_0159479
406 Ga0496104_0234652
407 Ga0496105_0256122
408 Ga0496109_0169144
409 Ga0496110_0082174
410 Ga0496110_0447502
411 Ga0496113_0449848
412 Ga0496114_0231133
413 Ga0496114_0310506
414 Ga0496115_0190157
415 Ga0501039_0256558
416 Ga0501040_0196716
417 Ga0501042_0258545
418 Ga0501068_0298648
419 Ga0501071_0063043
420 Ga0501071_0259681
421 nmdc:mga0yw44_77122_c1
422 nmdc:mga06z11_58200_c1
423 nmdc:mga04h51_21409_c1
424 nmdc:mga04h51_96152_c1
425 nmdc:mga05p37_138490_c1
426 nmdc:mga05p37_61750_c1
427 nmdc:mga0qj67_15112_c1
428 nmdc:mga08y16_106727_c1
429 nmdc:mga08y16_193425_c1
430 nmdc:mga08y16_5689_c1
431 nmdc:mga0n895_48423_c1
432 nmdc:mga0n895_494507_c1
433 nmdc:mga0n895_50923_c1
434 nmdc:mga0n895_82144_c1
435 nmdc:mga0rr50_346216_c1
436 nmdc:mga0rr50_41191_c1
437 nmdc:mga0a205_108668_c1
438 nmdc:mga0a205_14762_c2
439 nmdc:mga0a205_4829_c2
440 nmdc:mga0a205_51661_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gyw-assembly1.cif.gz_A gamma-adaptin appendage domain from clathrin adaptor ap1 a753d mutant 0.8059 186 225
1gyv-assembly1.cif.gz_A gamma-adaptin appendage domain from clathrin adaptor ap1, l762e mutant 0.7662 181 225
1gyu-assembly1.cif.gz_A gamma-adaptin appendage domain from clathrin adaptor ap1 0.7646 181 225
2ia7-assembly1.cif.gz_A crystal structure of putative tail lysozyme (np_952040.1) from geobacter sulfurreducens at 1.44 a resolution 0.7587 190 229
4bcx-assembly1.cif.gz_A gamma 2 adaptin ear domain crystal structure 0.7366 186 225
ID Description Score Start End Superfamily
3zhfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.7863 186 225 2.60.40.1230
af_Q9ZUI6_735_860_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.7716 186 228 2.60.40.1230
2ia7A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7587 190 229 3.10.450.40
af_F1R6A1_237_360_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.7241 188 228 3.30.160.40
af_O34090_221_303_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.697 188 222 3.30.160.40
ID Description Score Start End GO Terms
AF-A0A317HW04-F1-model_v4 deleted 0.966 25 214
AF-A0A537UUM3-F1-model_v4 Uncharacterized protein 0.9422 36 234
AF-A0A2V8K557-F1-model_v4 Uncharacterized protein 0.9121 61 234
AF-A0A2V9D6W8-F1-model_v4 Uncharacterized protein 0.9108 93 236
AF-A0A2V9CIH4-F1-model_v4 Uncharacterized protein 0.9073 88 236

Map