F335750

General Info

Members Datasets Scaffolds Average Seq Length
223 156 216 274

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10214232|Ga0307513_102142322
Length 273
Sequence MSKIIFITGASKGFGKLWAEAFLKRGDKVAATARNITALNDLVATYGNNVLPLQLDVNNREEVFTVVNKIEKQFGRIDVLINNAGHGLFGTTEETTEAQAREQMETNFFGSLWVTQAVLPVFRKQKSGHIVQVSSYLGITTLPMLGLYNASKFAVEGLIESISLEVAHLGIKTTLLEPNGYATDWAGASAKGTASDISDYTPVREAFGKATQNPAIWGNPEAIVAPVLQVVDSPTPPQRLLLGNIAYNTVHKVYTQRLKDIEAWKEVSIAAHG

Samples

Sample ID Description Type Environment
1 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2855730933 Achromobacter sp. HZ28 Isolate Nodule
4 2855767633 Achromobacter sp. HZ34 Isolate Nodule
5 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
111 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
112 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
113 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
114 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
150 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
151 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
155 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
156 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.97
Nodule 0.9
Rhizoplane 0
Rhizosphere 64.57
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017234 3300001979 Bacteria 2588
2 JGI24739J22299_10005162 3300001989 Bacteria 4973
3 JGI25154J39366_1000054 3300002738 Bacteria 117961
4 JGI25153J46596_10000743 3300003215 Bacteria 19932
5 JGI25153J46596_10036992 3300003215 Bacteria 1557
6 rootH1_10133619 3300003316 Bacteria 2647
7 rootH2_10034182 3300003320 Bacteria 51191
8 rootH2_10063224 3300003320 Bacteria 10606
9 rootH2_10088645 3300003320 Bacteria 4466
10 rootL2_10011351 3300003322 Bacteria 12756
11 rootL2_10029977 3300003322 Bacteria 5762
12 rootH1_10092276 3300003323 Bacteria 1678
13 rootH1_10180373 3300003323 Bacteria 3765
14 JGI25160J50197_1005392 3300003354 Bacteria 5333
15 JGI25160J50197_1007907 3300003354 Bacteria 4101
16 Ga0055535_1004878 3300003761 Bacteria 3113
17 Ga0055526_1005302 3300003771 Bacteria 7468
18 Ga0055526_1017234 3300003771 Bacteria 2773
19 Ga0055528_1000153 3300003790 Bacteria 57255
20 Ga0055530_10000943 3300003791 Bacteria 23778
21 Ga0055530_10010908 3300003791 Bacteria 3307
22 Ga0065165_1000123 3300005262 Bacteria 130852
23 Ga0065165_1000159 3300005262 Bacteria 116983
24 Ga0065165_1011048 3300005262 Bacteria 3820
25 Ga0065714_10094709 3300005288 Bacteria 1808
26 Ga0065714_10104961 3300005288 Bacteria 1574
27 Ga0068869_100022655 3300005334 Bacteria 4331
28 Ga0070666_10024817 3300005335 Bacteria 3908
29 Ga0068868_100008176 3300005338 Bacteria 7484
30 Ga0070668_100046143 3300005347 Bacteria 3345
31 Ga0070668_100057418 3300005347 Bacteria 3008
32 Ga0070669_100147839 3300005353 Bacteria 1816
33 Ga0070675_100078915 3300005354 Viruses 2742
34 Ga0070674_100024485 3300005356 Bacteria 3918
35 Ga0070667_100154291 3300005367 Bacteria 2019
36 Ga0070678_100035732 3300005456 Bacteria 3472
37 Ga0070662_100068176 3300005457 Unclassified 2615
38 Ga0068867_100381403 3300005459 Bacteria 1184
39 Ga0068853_100122447 3300005539 Bacteria 2322
40 Ga0070672_100064619 3300005543 Bacteria 2892
41 Ga0070665_100000002 3300005548 Bacteria 849037
42 Ga0070665_100000008 3300005548 Bacteria 606341
43 Ga0070665_100018701 3300005548 Bacteria 6946
44 Ga0070665_100512009 3300005548 Bacteria 1212
45 Ga0068856_100031660 3300005614 Bacteria 5176
46 Ga0068852_100263361 3300005616 Bacteria 1656
47 Ga0068859_100157519 3300005617 Bacteria 2349
48 Ga0068866_10068986 3300005718 Bacteria 1861
49 Ga0068861_100018821 3300005719 Bacteria 4924
50 Ga0068870_10008209 3300005840 Bacteria 4686
51 Ga0068863_100344508 3300005841 Bacteria 1450
52 Ga0068860_100000029 3300005843 Bacteria 259192
53 Ga0068860_100053604 3300005843 Bacteria 3835
54 Ga0075366_10007285 3300006195 Bacteria 6101
55 Ga0075366_10013185 3300006195 Bacteria 4700
56 Ga0075366_10019633 3300006195 Bacteria 3915
57 Ga0097621_100177729 3300006237 Bacteria 1838
58 Ga0068871_100009227 3300006358 Bacteria 7136
59 Ga0068865_100019159 3300006881 Bacteria 4426
60 Ga0097620_100157531 3300006931 Bacteria 2349
61 Ga0105240_10004698 3300009093 Bacteria 20646
62 Ga0105240_10080638 3300009093 Unclassified 4001
63 Ga0105240_10352355 3300009093 Bacteria 1670
64 Ga0105241_10002334 3300009174 Bacteria 14255
65 Ga0105241_10088893 3300009174 Bacteria 2433
66 Ga0105237_10000243 3300009545 Bacteria 77722
67 Ga0105237_10001860 3300009545 Bacteria 26993
68 Ga0105237_10012817 3300009545 Bacteria 8818
69 Ga0105237_10032582 3300009545 Bacteria 5276
70 Ga0105238_10004052 3300009551 Bacteria 14527
71 Ga0105249_10012985 3300009553 Bacteria 7351
72 Ga0105249_10063270 3300009553 Bacteria 3399
73 Ga0105249_10137283 3300009553 Bacteria 2341
74 Ga0105249_10369948 3300009553 Bacteria 1457
75 Ga0105239_10000064 3300010375 Bacteria 151674
76 Ga0105246_10010257 3300011119 Bacteria 5788
77 Ga0157371_10097501 3300013102 Bacteria 2084
78 Ga0157371_10403126 3300013102 Bacteria 1001
79 Ga0157370_10005140 3300013104 Bacteria 14752
80 Ga0157370_10005342 3300013104 Bacteria 14431
81 Ga0157370_10013401 3300013104 Bacteria 8446
82 Ga0157370_10039925 3300013104 Bacteria 4534
83 Ga0157374_10000009 3300013296 Bacteria 564330
84 Ga0157374_10008897 3300013296 Bacteria 8601
85 Ga0163162_10000038 3300013306 Bacteria 138065
86 Ga0163162_10023976 3300013306 Bacteria 6021
87 Ga0163162_10438660 3300013306 Bacteria 1438
88 Ga0157372_10003310 3300013307 Bacteria 17409
89 Ga0157372_10133886 3300013307 Bacteria 2853
90 Ga0157375_10063368 3300013308 Bacteria 3677
91 Ga0163163_10099199 3300014325 Viruses 2934
92 Ga0157377_10065369 3300014745 Bacteria 2089
93 Ga0157376_10010724 3300014969 Bacteria 6720
94 Ga0163161_10014788 3300017792 Bacteria 5438
95 Ga0209258_100193 3300025242 Bacteria 124682
96 Ga0209646_1000009 3300025246 Bacteria 652154
97 Ga0209026_1000133 3300025250 Bacteria 117872
98 Ga0209148_1000167 3300025254 Bacteria 135407
99 Ga0209673_1000016 3300025273 Bacteria 506202
100 Ga0209673_1047976 3300025273 Bacteria 1154
101 Ga0209676_1000001 3300025292 Bacteria 1852142
102 Ga0209564_1001786 3300025295 Bacteria 19896
103 Ga0209564_1018125 3300025295 Bacteria 2702
104 Ga0209758_1002237 3300025297 Bacteria 20100
105 Ga0209758_1003431 3300025297 Bacteria 14436
106 Ga0209758_1004449 3300025297 Bacteria 11654
107 Ga0209050_1000018 3300025298 Bacteria 723263
108 Ga0209050_1001171 3300025298 Bacteria 30973
109 Ga0209050_1024331 3300025298 Bacteria 2099
110 Ga0207426_1000203 3300025302 Bacteria 142379
111 Ga0207426_1005962 3300025302 Bacteria 5410
112 Ga0209257_1002721 3300025304 Bacteria 16813
113 Ga0207680_10128939 3300025903 Bacteria 1664
114 Ga0207645_10002731 3300025907 Bacteria 13744
115 Ga0207643_10015556 3300025908 Bacteria 4142
116 Ga0207654_10011633 3300025911 Bacteria 4490
117 Ga0207695_10001773 3300025913 Bacteria 34055
118 Ga0207671_10000514 3300025914 Bacteria 52449
119 Ga0207671_10003139 3300025914 Bacteria 16769
120 Ga0207671_10004514 3300025914 Bacteria 13245
121 Ga0207671_10004989 3300025914 Bacteria 12430
122 Ga0207681_10276180 3300025923 Bacteria 1321
123 Ga0207694_10066468 3300025924 Bacteria 2813
124 Ga0207644_10169205 3300025931 Bacteria 1705
125 Ga0207706_10041480 3300025933 Bacteria 4080
126 Ga0207686_10222858 3300025934 Bacteria 1363
127 Ga0207669_10149151 3300025937 Bacteria 1635
128 Ga0207704_10077382 3300025938 Bacteria 2135
129 Ga0207689_10006418 3300025942 Bacteria 10400
130 Ga0207689_10013051 3300025942 Bacteria 7094
131 Ga0207712_10005710 3300025961 Bacteria 7840
132 Ga0207668_10046578 3300025972 Bacteria 2963
133 Ga0207639_10017722 3300026041 Bacteria 5049
134 Ga0207639_10233402 3300026041 Bacteria 1596
135 Ga0207702_10014267 3300026078 Bacteria 6599
136 Ga0207648_10007498 3300026089 Bacteria 10716
137 Ga0207675_100015785 3300026118 Bacteria 7042
138 Ga0207683_10003831 3300026121 Bacteria 13032
139 Ga0268266_10000016 3300028379 Bacteria 629101
140 Ga0268266_10000022 3300028379 Bacteria 508060
141 Ga0268266_10232657 3300028379 Bacteria 1698
142 Ga0268265_10078229 3300028380 Unclassified 2601
143 Ga0268265_10343534 3300028380 Bacteria 1360
144 Ga0268264_10000072 3300028381 Bacteria 260791
145 Ga0268264_10037497 3300028381 Bacteria 3997
146 Ga0307517_10020717 3300028786 Bacteria 8357
147 Ga0307513_10099348 3300031456 Bacteria 2939
148 Ga0307513_10214232 3300031456 Bacteria 1754
149 Ga0307509_10032799 3300031507 Bacteria 5722
150 Ga0307509_10440370 3300031507 Bacteria 999
151 Ga0307516_10315353 3300031730 Bacteria 1236
152 Ga0307405_10000008 3300031731 Bacteria 264953
153 Ga0307407_10000037 3300031903 Bacteria 71023
154 Ga0307416_100000048 3300032002 Bacteria 120194
155 Ga0307414_10006098 3300032004 Bacteria 6690
156 Ga0307414_10151201 3300032004 Bacteria 1832
157 Ga0307414_10198620 3300032004 Bacteria 1629
158 Ga0395905_0008047 3300037471 Bacteria 10416
159 Ga0451833_0049368 3300041491 Bacteria 1052
160 Ga0439442_003363 3300042002 Bacteria 3161
161 Ga0439457_017974 3300042014 Unclassified 1569
162 Ga0439457_021813 3300042014 Bacteria 1419
163 Ga0450923_037498 3300042125 Bacteria 1009
164 Ga0450894_001980 3300042131 Unclassified 2827
165 Ga0450899_004199 3300042135 Bacteria 1543
166 Ga0439434_0006915 3300042435 Bacteria 3315
167 Ga0450893_0009805 3300042532 Bacteria 1567
168 Ga0466972_0039955 3300044658 Bacteria 2288
169 Ga0495650_0000098 3300046471 Bacteria 215716
170 Ga0495585_0000029 3300046492 Bacteria 145822
171 Ga0495606_0000021 3300046507 Bacteria 271238
172 Ga0495610_0001345 3300046512 Bacteria 21797
173 Ga0495616_0000972 3300046513 Bacteria 20531
174 Ga0495631_0005302 3300046518 Bacteria 6771
175 Ga0495632_0100022 3300046519 Bacteria 1367
176 Ga0495644_0008528 3300046523 Bacteria 3948
177 Ga0495648_0016044 3300046524 Bacteria 5409
178 Ga0495633_0000879 3300046558 Bacteria 25944
179 Ga0495611_0019719 3300046648 Bacteria 2898
180 Ga0495625_0001390 3300046660 Bacteria 29676
181 Ga0495625_0001643 3300046660 Bacteria 26273
182 Ga0495625_0167509 3300046660 Bacteria 1468
183 Ga0495625_0302576 3300046660 Bacteria 1023
184 Ga0495661_0000499 3300046665 Bacteria 40901
185 Ga0495661_0037726 3300046665 Bacteria 3015
186 Ga0495649_0000226 3300046694 Bacteria 49102
187 Ga0495687_000004 3300047443 Bacteria 779298
188 Ga0495677_0012827 3300047445 Bacteria 3054
189 Ga0495685_033535 3300047447 Bacteria 1764
190 Ga0495686_0125938 3300047472 Bacteria 1523
191 Ga0495686_0223847 3300047472 Bacteria 1069
192 Ga0496116_0002133 3300048919 Bacteria 21043
193 Ga0496117_0005779 3300048920 Bacteria 12848
194 Ga0496121_0000736 3300048924 Bacteria 60328
195 Ga0496122_0005453 3300048925 Bacteria 15139
196 Ga0496123_0014083 3300048926 Bacteria 6655
197 Ga0496124_0020191 3300048927 Bacteria 6167
198 Ga0496125_0198824 3300048928 Bacteria 1315
199 Ga0501241_001034 3300049758 Bacteria 5887
200 nmdc:mga0k408_3000_c1 3300050493 Bacteria 8954
201 nmdc:mga0k408_34570_c1 3300050493 Bacteria 2894
202 nmdc:mga0k408_53766_c1 3300050493 Unclassified 2334
203 Ga0500644_0000069 3300053088 Bacteria 61316
204 Ga0500646_0031852 3300053090 Bacteria 1453
205 Ga0500583_0002574 3300053092 Bacteria 5486
206 Ga0500583_0008117 3300053092 Bacteria 3744
207 Ga0500641_0000058 3300053096 Bacteria 47154
208 Ga0500562_000013 3300053108 Bacteria 150003
209 Ga0500608_000318 3300053122 Bacteria 18520
210 Ga0500652_026830 3300053131 Bacteria 2221
211 Ga0500568_0005566 3300053139 Bacteria 6488
212 Ga0500616_0056016 3300053153 Bacteria 2059
213 Ga0500622_0001847 3300053156 Bacteria 16014
214 Ga0500622_0004257 3300053156 Bacteria 9086
215 Ga0500622_0160650 3300053156 Bacteria 1054
216 Ga0500633_0003064 3300053160 Bacteria 3577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2721755487 2722728934 267
2 iso_pu_bacteria 2818991444 2819587308 267
3 iso_pu_bacteria 2855730933 2855736097 267
4 iso_pu_bacteria 2855767633 2855773034 267
5 iso_pu_bacteria 2929921140 2929924202 268
6 iso_pu_bacteria 8003151029 8003152550 268
7 3300031456 Ga0307513_10214232 Ga0307513_102142322 270
8 3300005548 Ga0070665_100512009 Ga0070665_1005120092 271
9 3300006195 Ga0075366_10013185 Ga0075366_100131855 271
10 3300006195 Ga0075366_10019633 Ga0075366_100196332 271
11 3300028379 Ga0268266_10232657 Ga0268266_102326571 271
12 3300031731 Ga0307405_10000008 Ga0307405_1000000864 271
13 3300031903 Ga0307407_10000037 Ga0307407_1000003749 271
14 3300032002 Ga0307416_100000048 Ga0307416_10000004819 271
15 3300032004 Ga0307414_10006098 Ga0307414_100060982 271
16 3300032004 Ga0307414_10151201 Ga0307414_101512012 271
17 3300041491 Ga0451833_0049368 Ga0451833_0049368_74_931 271
18 3300042002 Ga0439442_003363 Ga0439442_003363_850_1665 271
19 3300042014 Ga0439457_017974 Ga0439457_017974_234_1049 271
20 3300042125 Ga0450923_037498 Ga0450923_037498_47_862 271
21 3300042131 Ga0450894_001980 Ga0450894_001980_1349_2164 271
22 3300042135 Ga0450899_004199 Ga0450899_004199_551_1366 271
23 3300042435 Ga0439434_0006915 Ga0439434_0006915_1102_1917 271
24 3300042532 Ga0450893_0009805 Ga0450893_0009805_607_1422 271
25 3300044658 Ga0466972_0039955 Ga0466972_0039955_1036_1860 271
26 3300046660 Ga0495625_0001643 Ga0495625_0001643_2119_2967 271
27 3300048919 Ga0496116_0002133 Ga0496116_0002133_13256_14077 271
28 3300048920 Ga0496117_0005779 Ga0496117_0005779_4530_5351 271
29 3300048925 Ga0496122_0005453 Ga0496122_0005453_8777_9598 271
30 3300048926 Ga0496123_0014083 Ga0496123_0014083_1175_1996 271
31 3300048927 Ga0496124_0020191 Ga0496124_0020191_2499_3320 271
32 3300050493 nmdc:mga0k408_3000_c1 nmdc:mga0k408_3000_c1_5985_6833 271
33 3300050493 nmdc:mga0k408_34570_c1 nmdc:mga0k408_34570_c1_1800_2615 271
34 3300053156 Ga0500622_0004257 Ga0500622_0004257_6723_7538 271
35 3300001979 JGI24740J21852_10017234 JGI24740J21852_100172343 272
36 3300001989 JGI24739J22299_10005162 JGI24739J22299_100051622 272
37 3300002738 JGI25154J39366_1000054 JGI25154J39366_10000542 272
38 3300003215 JGI25153J46596_10000743 JGI25153J46596_100007432 272
39 3300003215 JGI25153J46596_10036992 JGI25153J46596_100369922 272
40 3300003316 rootH1_10133619 rootH1_101336194 272
41 3300003320 rootH2_10034182 rootH2_100341826 272
42 3300003320 rootH2_10063224 rootH2_100632243 272
43 3300003320 rootH2_10088645 rootH2_100886453 272
44 3300003322 rootL2_10011351 rootL2_100113518 272
45 3300003322 rootL2_10029977 rootL2_100299773 272
46 3300003323 rootH1_10092276 rootH1_100922762 272
47 3300003323 rootH1_10180373 rootH1_101803732 272
48 3300003354 JGI25160J50197_1005392 JGI25160J50197_10053922 272
49 3300003354 JGI25160J50197_1007907 JGI25160J50197_10079072 272
50 3300003761 Ga0055535_1004878 Ga0055535_10048783 272
51 3300003771 Ga0055526_1005302 Ga0055526_10053023 272
52 3300003771 Ga0055526_1017234 Ga0055526_10172343 272
53 3300003790 Ga0055528_1000153 Ga0055528_100015321 272
54 3300003791 Ga0055530_10000943 Ga0055530_1000094315 272
55 3300003791 Ga0055530_10010908 Ga0055530_100109084 272
56 3300005262 Ga0065165_1000123 Ga0065165_100012366 272
57 3300005262 Ga0065165_1000159 Ga0065165_100015969 272
58 3300005262 Ga0065165_1011048 Ga0065165_10110482 272
59 3300005288 Ga0065714_10094709 Ga0065714_100947093 272
60 3300005288 Ga0065714_10104961 Ga0065714_101049611 272
61 3300005334 Ga0068869_100022655 Ga0068869_1000226555 272
62 3300005335 Ga0070666_10024817 Ga0070666_100248174 272
63 3300005338 Ga0068868_100008176 Ga0068868_1000081762 272
64 3300005347 Ga0070668_100046143 Ga0070668_1000461433 272
65 3300005347 Ga0070668_100057418 Ga0070668_1000574183 272
66 3300005353 Ga0070669_100147839 Ga0070669_1001478393 272
67 3300005354 Ga0070675_100078915 Ga0070675_1000789153 272
68 3300005356 Ga0070674_100024485 Ga0070674_1000244854 272
69 3300005367 Ga0070667_100154291 Ga0070667_1001542911 272
70 3300005456 Ga0070678_100035732 Ga0070678_1000357323 272
71 3300005457 Ga0070662_100068176 Ga0070662_1000681762 272
72 3300005459 Ga0068867_100381403 Ga0068867_1003814031 272
73 3300005539 Ga0068853_100122447 Ga0068853_1001224473 272
74 3300005543 Ga0070672_100064619 Ga0070672_1000646192 272
75 3300005548 Ga0070665_100000002 Ga0070665_100000002245 272
76 3300005548 Ga0070665_100000008 Ga0070665_100000008287 272
77 3300005548 Ga0070665_100018701 Ga0070665_1000187013 272
78 3300005614 Ga0068856_100031660 Ga0068856_1000316605 272
79 3300005616 Ga0068852_100263361 Ga0068852_1002633612 272
80 3300005617 Ga0068859_100157519 Ga0068859_1001575192 272
81 3300005718 Ga0068866_10068986 Ga0068866_100689862 272
82 3300005719 Ga0068861_100018821 Ga0068861_1000188212 272
83 3300005840 Ga0068870_10008209 Ga0068870_100082092 272
84 3300005841 Ga0068863_100344508 Ga0068863_1003445082 272
85 3300005843 Ga0068860_100000029 Ga0068860_100000029126 272
86 3300005843 Ga0068860_100053604 Ga0068860_1000536043 272
87 3300006195 Ga0075366_10007285 Ga0075366_100072852 272
88 3300006237 Ga0097621_100177729 Ga0097621_1001777292 272
89 3300006358 Ga0068871_100009227 Ga0068871_1000092276 272
90 3300006881 Ga0068865_100019159 Ga0068865_1000191596 272
91 3300006931 Ga0097620_100157531 Ga0097620_1001575312 272
92 3300009093 Ga0105240_10004698 Ga0105240_100046985 272
93 3300009093 Ga0105240_10080638 Ga0105240_100806383 272
94 3300009093 Ga0105240_10352355 Ga0105240_103523553 272
95 3300009174 Ga0105241_10002334 Ga0105241_100023346 272
96 3300009174 Ga0105241_10088893 Ga0105241_100888932 272
97 3300009545 Ga0105237_10000243 Ga0105237_1000024361 272
98 3300009545 Ga0105237_10001860 Ga0105237_1000186025 272
99 3300009545 Ga0105237_10012817 Ga0105237_100128174 272
100 3300009545 Ga0105237_10032582 Ga0105237_100325824 272
101 3300009551 Ga0105238_10004052 Ga0105238_100040528 272
102 3300009553 Ga0105249_10012985 Ga0105249_100129853 272
103 3300009553 Ga0105249_10063270 Ga0105249_100632704 272
104 3300009553 Ga0105249_10137283 Ga0105249_101372832 272
105 3300009553 Ga0105249_10369948 Ga0105249_103699482 272
106 3300010375 Ga0105239_10000064 Ga0105239_1000006483 272
107 3300011119 Ga0105246_10010257 Ga0105246_100102575 272
108 3300013102 Ga0157371_10097501 Ga0157371_100975012 272
109 3300013102 Ga0157371_10403126 Ga0157371_104031261 272
110 3300013104 Ga0157370_10005140 Ga0157370_100051406 272
111 3300013104 Ga0157370_10005342 Ga0157370_100053424 272
112 3300013104 Ga0157370_10013401 Ga0157370_100134016 272
113 3300013104 Ga0157370_10039925 Ga0157370_100399252 272
114 3300013296 Ga0157374_10000009 Ga0157374_10000009205 272
115 3300013296 Ga0157374_10008897 Ga0157374_100088972 272
116 3300013306 Ga0163162_10000038 Ga0163162_10000038102 272
117 3300013306 Ga0163162_10023976 Ga0163162_100239764 272
118 3300013306 Ga0163162_10023976 Ga0163162_100239765 272
119 3300013306 Ga0163162_10438660 Ga0163162_104386601 272
120 3300013307 Ga0157372_10003310 Ga0157372_100033104 272
121 3300013307 Ga0157372_10133886 Ga0157372_101338862 272
122 3300013308 Ga0157375_10063368 Ga0157375_100633682 272
123 3300014325 Ga0163163_10099199 Ga0163163_100991993 272
124 3300014745 Ga0157377_10065369 Ga0157377_100653692 272
125 3300014969 Ga0157376_10010724 Ga0157376_100107243 272
126 3300017792 Ga0163161_10014788 Ga0163161_100147884 272
127 3300025242 Ga0209258_100193 Ga0209258_100193112 272
128 3300025246 Ga0209646_1000009 Ga0209646_1000009519 272
129 3300025250 Ga0209026_1000133 Ga0209026_10001332 272
130 3300025254 Ga0209148_1000167 Ga0209148_10001674 272
131 3300025273 Ga0209673_1000016 Ga0209673_1000016257 272
132 3300025273 Ga0209673_1047976 Ga0209673_10479761 272
133 3300025292 Ga0209676_1000001 Ga0209676_10000011144 272
134 3300025295 Ga0209564_1001786 Ga0209564_10017869 272
135 3300025295 Ga0209564_1018125 Ga0209564_10181252 272
136 3300025297 Ga0209758_1002237 Ga0209758_100223715 272
137 3300025297 Ga0209758_1003431 Ga0209758_10034319 272
138 3300025297 Ga0209758_1004449 Ga0209758_10044499 272
139 3300025298 Ga0209050_1000018 Ga0209050_1000018440 272
140 3300025298 Ga0209050_1001171 Ga0209050_10011715 272
141 3300025298 Ga0209050_1024331 Ga0209050_10243313 272
142 3300025302 Ga0207426_1000203 Ga0207426_1000203110 272
143 3300025302 Ga0207426_1005962 Ga0207426_10059622 272
144 3300025304 Ga0209257_1002721 Ga0209257_10027213 272
145 3300025903 Ga0207680_10128939 Ga0207680_101289391 272
146 3300025907 Ga0207645_10002731 Ga0207645_100027317 272
147 3300025908 Ga0207643_10015556 Ga0207643_100155564 272
148 3300025911 Ga0207654_10011633 Ga0207654_100116333 272
149 3300025913 Ga0207695_10001773 Ga0207695_1000177317 272
150 3300025914 Ga0207671_10000514 Ga0207671_1000051440 272
151 3300025914 Ga0207671_10003139 Ga0207671_100031393 272
152 3300025914 Ga0207671_10004514 Ga0207671_1000451414 272
153 3300025914 Ga0207671_10004989 Ga0207671_100049894 272
154 3300025923 Ga0207681_10276180 Ga0207681_102761802 272
155 3300025924 Ga0207694_10066468 Ga0207694_100664683 272
156 3300025931 Ga0207644_10169205 Ga0207644_101692052 272
157 3300025933 Ga0207706_10041480 Ga0207706_100414804 272
158 3300025934 Ga0207686_10222858 Ga0207686_102228581 272
159 3300025937 Ga0207669_10149151 Ga0207669_101491511 272
160 3300025938 Ga0207704_10077382 Ga0207704_100773821 272
161 3300025942 Ga0207689_10006418 Ga0207689_100064186 272
162 3300025942 Ga0207689_10013051 Ga0207689_100130513 272
163 3300025961 Ga0207712_10005710 Ga0207712_100057103 272
164 3300025972 Ga0207668_10046578 Ga0207668_100465783 272
165 3300026041 Ga0207639_10017722 Ga0207639_100177226 272
166 3300026041 Ga0207639_10233402 Ga0207639_102334022 272
167 3300026078 Ga0207702_10014267 Ga0207702_100142674 272
168 3300026089 Ga0207648_10007498 Ga0207648_100074989 272
169 3300026118 Ga0207675_100015785 Ga0207675_1000157852 272
170 3300026121 Ga0207683_10003831 Ga0207683_100038312 272
171 3300028379 Ga0268266_10000016 Ga0268266_10000016285 272
172 3300028379 Ga0268266_10000022 Ga0268266_10000022192 272
173 3300028380 Ga0268265_10078229 Ga0268265_100782292 272
174 3300028380 Ga0268265_10343534 Ga0268265_103435341 272
175 3300028381 Ga0268264_10000072 Ga0268264_10000072127 272
176 3300028381 Ga0268264_10037497 Ga0268264_100374973 272
177 3300028786 Ga0307517_10020717 Ga0307517_100207173 272
178 3300031456 Ga0307513_10099348 Ga0307513_100993484 272
179 3300031507 Ga0307509_10032799 Ga0307509_100327992 272
180 3300031507 Ga0307509_10440370 Ga0307509_104403701 272
181 3300031730 Ga0307516_10315353 Ga0307516_103153531 272
182 3300032004 Ga0307414_10198620 Ga0307414_101986202 272
183 3300037471 Ga0395905_0008047 Ga0395905_0008047_9003_9950 272
184 3300042014 Ga0439457_021813 Ga0439457_021813_382_1209 272
185 3300046471 Ga0495650_0000098 Ga0495650_0000098_73776_74594 272
186 3300046492 Ga0495585_0000029 Ga0495585_0000029_57454_58272 272
187 3300046507 Ga0495606_0000021 Ga0495606_0000021_138582_139400 272
188 3300046512 Ga0495610_0001345 Ga0495610_0001345_1215_2033 272
189 3300046513 Ga0495616_0000972 Ga0495616_0000972_2758_3576 272
190 3300046518 Ga0495631_0005302 Ga0495631_0005302_5675_6526 272
191 3300046519 Ga0495632_0100022 Ga0495632_0100022_359_1177 272
192 3300046523 Ga0495644_0008528 Ga0495644_0008528_2161_3012 272
193 3300046524 Ga0495648_0016044 Ga0495648_0016044_784_1602 272
194 3300046558 Ga0495633_0000879 Ga0495633_0000879_19208_20026 272
195 3300046648 Ga0495611_0019719 Ga0495611_0019719_1940_2758 272
196 3300046660 Ga0495625_0001390 Ga0495625_0001390_16481_17299 272
197 3300046660 Ga0495625_0167509 Ga0495625_0167509_598_1416 272
198 3300046660 Ga0495625_0302576 Ga0495625_0302576_42_893 272
199 3300046665 Ga0495661_0000499 Ga0495661_0000499_31037_31888 272
200 3300046665 Ga0495661_0037726 Ga0495661_0037726_504_1322 272
201 3300046694 Ga0495649_0000226 Ga0495649_0000226_16415_17233 272
202 3300047443 Ga0495687_000004 Ga0495687_000004_413203_414021 272
203 3300047445 Ga0495677_0012827 Ga0495677_0012827_668_1597 272
204 3300047447 Ga0495685_033535 Ga0495685_033535_877_1728 272
205 3300047472 Ga0495686_0125938 Ga0495686_0125938_95_913 272
206 3300047472 Ga0495686_0223847 Ga0495686_0223847_173_991 272
207 3300048924 Ga0496121_0000736 Ga0496121_0000736_31476_32294 272
208 3300048928 Ga0496125_0198824 Ga0496125_0198824_198_1016 272
209 3300049758 Ga0501241_001034 Ga0501241_001034_3855_4706 272
210 3300050493 nmdc:mga0k408_53766_c1 nmdc:mga0k408_53766_c1_1088_1906 272
211 3300053088 Ga0500644_0000069 Ga0500644_0000069_11676_12494 272
212 3300053090 Ga0500646_0031852 Ga0500646_0031852_444_1262 272
213 3300053092 Ga0500583_0002574 Ga0500583_0002574_3924_4742 272
214 3300053092 Ga0500583_0008117 Ga0500583_0008117_1299_2117 272
215 3300053096 Ga0500641_0000058 Ga0500641_0000058_12630_13448 272
216 3300053108 Ga0500562_000013 Ga0500562_000013_80494_81312 272
217 3300053122 Ga0500608_000318 Ga0500608_000318_17101_17952 272
218 3300053131 Ga0500652_026830 Ga0500652_026830_685_1692 272
219 3300053139 Ga0500568_0005566 Ga0500568_0005566_3554_4372 272
220 3300053153 Ga0500616_0056016 Ga0500616_0056016_1142_1960 272
221 3300053156 Ga0500622_0001847 Ga0500622_0001847_7264_8082 272
222 3300053156 Ga0500622_0160650 Ga0500622_0160650_194_1012 272
223 3300053160 Ga0500633_0003064 Ga0500633_0003064_516_1334 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

3

210

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

9

214

0.91

PF08659

KR

KR domain

4

174

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9351 3 241
3m1a-assembly6.cif.gz_J the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9348 2 269
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9332 1 239
3m1a-assembly6.cif.gz_J the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9281 2 269
3m1a-assembly4.cif.gz_E the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.923 1 268
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9569 2 175 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.944 3 179 3.40.50.720
af_Q869L6_6_285_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.943 2 268 3.40.50.720
af_Q54WM6_4_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9412 2 269 3.40.50.720
af_Q54G79_5_301_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9378 3 266 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W6TGF0-F1-model_v4 Short-chain dehydrogenase/reductase 0.9961 1 191 GO:0016491
AF-A0A7W8YXF5-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9957 1 272 GO:0016491
AF-A0A3A6RLM2-F1-model_v4 deleted 0.9937 1 181
AF-A0A4Q6BSI7-F1-model_v4 SDR family oxidoreductase 0.9918 1 180 GO:0016491
AF-A0A2W6TGF0-F1-model_v4 Short-chain dehydrogenase/reductase 0.9909 1 191 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.57 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map