F335639

General Info

Members Datasets Scaffolds Average Seq Length
223 151 446 85

Family's Representative Sequence

Representative Sequence 3300024225|Ga0224572_1003011|Ga0224572_10030115
Length 95
Sequence MTNLASSGRQVGAFEAKNTLGTLLDRVERGEEIVITRHGKPVARLVPNAEHGGQDQALTAFEGLRERARQLAKENPGRPAFDWEEIKKLRDEGRR

Samples

Sample ID Description Type Environment
1 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
150 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
151 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 1.35
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 0.45
Rhizosphere 95.52
Stem 0
Stem Tuber 0
Unclassified 33.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224572_1003011 3300024225 Bacteria 2796
2 Ga0055524_1013245 3300003775 Bacteria 3119
3 Ga0070683_100138381 3300005329 Bacteria 2306
4 Ga0070683_100660931 3300005329 Unclassified 1001
5 Ga0070683_101757757 3300005329 Unclassified 596
6 Ga0070690_100322363 3300005330 Bacteria 1114
7 Ga0070680_101461816 3300005336 Unclassified 592
8 Ga0068868_100515688 3300005338 Unclassified 1049
9 Ga0070692_10003793 3300005345 Bacteria 6215
10 Ga0070671_100974560 3300005355 Unclassified 742
11 Ga0070667_101328086 3300005367 Unclassified 674
12 Ga0070709_10102842 3300005434 Unclassified 1906
13 Ga0070709_10128054 3300005434 Bacteria 1730
14 Ga0070709_10460691 3300005434 Bacteria 959
15 Ga0070709_11324403 3300005434 Bacteria 581
16 Ga0070714_100000183 3300005435 Bacteria 49970
17 Ga0070714_100839628 3300005435 Bacteria 891
18 Ga0070714_100984477 3300005435 Bacteria 820
19 Ga0070714_101734922 3300005435 Bacteria 610
20 Ga0070714_101864601 3300005435 Unclassified 587
21 Ga0070713_100486321 3300005436 Unclassified 1163
22 Ga0070713_100777049 3300005436 Unclassified 917
23 Ga0070713_101456543 3300005436 Unclassified 664
24 Ga0070711_100006541 3300005439 Bacteria 7029
25 Ga0070708_100195149 3300005445 Bacteria 1894
26 Ga0070681_10050656 3300005458 Bacteria 4143
27 Ga0070681_11109899 3300005458 Unclassified 712
28 Ga0068867_101913384 3300005459 Unclassified 559
29 Ga0070706_100045622 3300005467 Unclassified 4048
30 Ga0070707_101065618 3300005468 Unclassified 774
31 Ga0070698_100701089 3300005471 Bacteria 954
32 Ga0070679_100207429 3300005530 Bacteria 1924
33 Ga0070684_100162649 3300005535 Bacteria 2025
34 Ga0070684_100237239 3300005535 Bacteria 1666
35 Ga0070686_100801707 3300005544 Bacteria 759
36 Ga0070665_100424275 3300005548 Bacteria 1339
37 Ga0068855_100481442 3300005563 Bacteria 1351
38 Ga0068855_101900328 3300005563 Bacteria 603
39 Ga0068854_100937412 3300005578 Unclassified 763
40 Ga0068856_101634055 3300005614 Bacteria 657
41 Ga0068859_103062342 3300005617 Unclassified 510
42 Ga0068864_100706456 3300005618 Unclassified 985
43 Ga0068858_100144106 3300005842 Bacteria 2237
44 Ga0068858_100389540 3300005842 Unclassified 1338
45 Ga0070717_10194633 3300006028 Bacteria 1773
46 Ga0070717_10278770 3300006028 Bacteria 1482
47 Ga0070717_10595499 3300006028 Bacteria 1003
48 Ga0070715_10462770 3300006163 Bacteria 718
49 Ga0070716_100088565 3300006173 Unclassified 1867
50 Ga0070716_100992343 3300006173 Unclassified 663
51 Ga0068865_101385338 3300006881 Bacteria 627
52 Ga0097620_103062570 3300006931 Unclassified 510
53 Ga0105240_10129031 3300009093 Bacteria 3035
54 Ga0105240_10975930 3300009093 Unclassified 907
55 Ga0105240_12362667 3300009093 Unclassified 550
56 Ga0111539_10607075 3300009094 Bacteria 1274
57 Ga0105245_10242788 3300009098 Bacteria 1747
58 Ga0105247_10614819 3300009101 Bacteria 807
59 Ga0105241_10165030 3300009174 Bacteria 1824
60 Ga0105241_10271646 3300009174 Bacteria 1445
61 Ga0105248_10239391 3300009177 Bacteria 2043
62 Ga0105248_10472714 3300009177 Bacteria 1413
63 Ga0105248_10744115 3300009177 Bacteria 1106
64 Ga0105237_10685015 3300009545 Bacteria 1032
65 Ga0105237_11145092 3300009545 Unclassified 785
66 Ga0105238_10603109 3300009551 Bacteria 1106
67 Ga0105249_11776465 3300009553 Bacteria 689
68 Ga0105239_10534819 3300010375 Bacteria 1334
69 Ga0105239_11808340 3300010375 Bacteria 708
70 Ga0157370_10630082 3300013104 Bacteria 981
71 Ga0157369_10191825 3300013105 Unclassified 2147
72 Ga0157369_10265154 3300013105 Bacteria 1791
73 Ga0157374_10162081 3300013296 Bacteria 2178
74 Ga0157374_10381857 3300013296 Bacteria 1403
75 Ga0157374_10636912 3300013296 Bacteria 1077
76 Ga0157374_10836488 3300013296 Unclassified 937
77 Ga0163162_12284345 3300013306 Bacteria 621
78 Ga0157372_10011561 3300013307 Bacteria 9391
79 Ga0157372_11032011 3300013307 Unclassified 952
80 Ga0157372_12920922 3300013307 Unclassified 547
81 Ga0157372_13264073 3300013307 Unclassified 517
82 Ga0157375_12575503 3300013308 Viruses 608
83 Ga0163163_10237016 3300014325 Bacteria 1874
84 Ga0163163_10288369 3300014325 Bacteria 1693
85 Ga0163163_10738859 3300014325 Bacteria 1047
86 Ga0163163_11665490 3300014325 Bacteria 699
87 Ga0157379_10349681 3300014968 Bacteria 1353
88 Ga0157379_10764751 3300014968 Bacteria 910
89 Ga0157376_10406944 3300014969 Unclassified 1317
90 Ga0157376_10531079 3300014969 Unclassified 1161
91 Ga0206354_10881763 3300020081 Bacteria 725
92 Ga0213876_10511297 3300021384 Unclassified 639
93 Ga0213875_10116560 3300021388 Bacteria 1248
94 Ga0224572_1016181 3300024225 Bacteria 1430
95 Ga0228598_1000049 3300024227 Bacteria 17063
96 Ga0228598_1040943 3300024227 Unclassified 914
97 Ga0209256_1000084 3300025299 Bacteria 219257
98 Ga0209256_1006478 3300025299 Bacteria 6165
99 Ga0207710_10410948 3300025900 Bacteria 695
100 Ga0207680_10929531 3300025903 Unclassified 623
101 Ga0207685_10465137 3300025905 Bacteria 660
102 Ga0207699_10128956 3300025906 Unclassified 1647
103 Ga0207699_10425783 3300025906 Bacteria 949
104 Ga0207699_11017042 3300025906 Bacteria 613
105 Ga0207684_10050885 3300025910 Unclassified 3515
106 Ga0207684_11020705 3300025910 Unclassified 691
107 Ga0207654_11053264 3300025911 Unclassified 592
108 Ga0207707_10087429 3300025912 Bacteria 2723
109 Ga0207707_10948702 3300025912 Bacteria 709
110 Ga0207707_11461069 3300025912 Unclassified 543
111 Ga0207695_10166185 3300025913 Bacteria 2135
112 Ga0207671_11594463 3300025914 Unclassified 502
113 Ga0207663_10361736 3300025916 Unclassified 1101
114 Ga0207652_10752751 3300025921 Unclassified 867
115 Ga0207681_11814917 3300025923 Unclassified 509
116 Ga0207694_11024272 3300025924 Bacteria 699
117 Ga0207687_10039185 3300025927 Bacteria 3243
118 Ga0207700_10193986 3300025928 Unclassified 1708
119 Ga0207700_10734487 3300025928 Unclassified 882
120 Ga0207700_10789106 3300025928 Unclassified 849
121 Ga0207664_10000212 3300025929 Bacteria 44097
122 Ga0207664_10685654 3300025929 Bacteria 921
123 Ga0207664_11263544 3300025929 Unclassified 657
124 Ga0207664_11290410 3300025929 Bacteria 649
125 Ga0207665_10422501 3300025939 Bacteria 1019
126 Ga0207711_10479538 3300025941 Bacteria 1159
127 Ga0207711_10568809 3300025941 Unclassified 1057
128 Ga0207711_11071340 3300025941 Unclassified 746
129 Ga0207661_10554667 3300025944 Unclassified 1053
130 Ga0207661_11338384 3300025944 Unclassified 658
131 Ga0207661_11776701 3300025944 Unclassified 562
132 Ga0207667_11664446 3300025949 Bacteria 605
133 Ga0207667_11700251 3300025949 Unclassified 598
134 Ga0207640_11627843 3300025981 Unclassified 582
135 Ga0207677_11911595 3300026023 Unclassified 551
136 Ga0207702_11066452 3300026078 Unclassified 802
137 Ga0207702_11549531 3300026078 Bacteria 656
138 Ga0207676_12050094 3300026095 Unclassified 571
139 Ga0265356_1006530 3300028017 Unclassified 1361
140 Ga0268266_11671374 3300028379 Unclassified 612
141 Ga0268266_12144564 3300028379 Unclassified 531
142 Ga0268264_12682520 3300028381 Bacteria 502
143 Ga0265338_10232280 3300028800 Bacteria 1371
144 Ga0265762_1004308 3300030760 Bacteria 2550
145 Ga0265760_10127463 3300031090 Unclassified 821
146 Ga0265330_10346519 3300031235 Bacteria 627
147 Ga0265332_10122577 3300031238 Unclassified 1092
148 Ga0265325_10225150 3300031241 Bacteria 857
149 Ga0265325_10290043 3300031241 Bacteria 732
150 Ga0265340_10082584 3300031247 Unclassified 1511
151 Ga0265340_10141045 3300031247 Bacteria 1102
152 Ga0265340_10253614 3300031247 Unclassified 784
153 Ga0265339_10049703 3300031249 Bacteria 2295
154 Ga0265339_10097112 3300031249 Bacteria 1537
155 Ga0265339_10121105 3300031249 Bacteria 1345
156 Ga0265339_10272342 3300031249 Unclassified 814
157 Ga0265327_10002305 3300031251 Bacteria 20407
158 Ga0265316_10120664 3300031344 Bacteria 1980
159 Ga0265316_10263816 3300031344 Unclassified 1262
160 Ga0265316_10278221 3300031344 Bacteria 1223
161 Ga0265313_10089851 3300031595 Bacteria 1381
162 Ga0265342_10030405 3300031712 Bacteria 3346
163 Ga0265342_10049315 3300031712 Bacteria 2520
164 Ga0265342_10496756 3300031712 Bacteria 623
165 Ga0265342_10572722 3300031712 Bacteria 571
166 Ga0373934_0318581 3300035086 Bacteria 646
167 Ga0373953_0075354 3300035117 Bacteria 1397
168 Ga0373954_0215101 3300035118 Bacteria 945
169 Ga0373957_0053297 3300035120 Bacteria 1552
170 Ga0373955_0993052 3300035172 Bacteria 517
171 Ga0373924_0194291 3300035410 Bacteria 894
172 Ga0373935_0560070 3300035692 Bacteria 834
173 Ga0373947_0149619 3300035725 Bacteria 1503
174 Ga0373937_0097558 3300036401 Bacteria 2726
175 Ga0395905_1048531 3300037471 Bacteria 718
176 Ga0395905_1869643 3300037471 Unclassified 506
177 Ga0436364_1462783 3300037853 Bacteria 3008
178 Ga0436365_0964720 3300039437 Unclassified 639
179 Ga0436360_0187301 3300039438 Bacteria 668
180 Ga0436361_0403767 3300039447 Bacteria 4074
181 Ga0436362_0594947 3300039453 Bacteria 682
182 Ga0436362_0990336 3300039453 Bacteria 583
183 Ga0466966_0058940 3300044684 Bacteria 2426
184 Ga0466963_0616688 3300044694 Unclassified 766
185 Ga0466970_0590842 3300044765 Bacteria 644
186 Ga0466957_0628950 3300044842 Bacteria 753
187 Ga0466959_0025130 3300045049 Bacteria 4412
188 Ga0466959_0425547 3300045049 Unclassified 901
189 Ga0466958_0087537 3300045836 Bacteria 1923
190 Ga0495653_0432635 3300046463 Bacteria 831
191 Ga0495580_0937651 3300046472 Bacteria 555
192 Ga0495637_0013204 3300046520 Bacteria 3927
193 Ga0495666_0339874 3300046526 Bacteria 677
194 Ga0495642_0211510 3300046528 Bacteria 846
195 Ga0495652_0266975 3300046529 Bacteria 1260
196 Ga0495645_0636228 3300046543 Unclassified 653
197 Ga0495668_0285219 3300046616 Bacteria 905
198 Ga0495625_0089681 3300046660 Bacteria 2128
199 Ga0495599_0525018 3300046678 Unclassified 695
200 Ga0495669_0000005 3300046684 Bacteria 193971
201 Ga0495604_0028150 3300047317 Bacteria 4470
202 Ga0495674_1376534 3300047319 Bacteria 527
203 Ga0495602_0348088 3300048088 Bacteria 1070
204 Ga0495602_0797693 3300048088 Bacteria 634
205 Ga0496104_1881055 3300048907 Unclassified 500
206 Ga0501031_0673975 3300049568 Bacteria 664
207 Ga0501032_0372735 3300049569 Bacteria 918
208 Ga0501036_0214790 3300049572 Bacteria 1616
209 Ga0501037_0304870 3300049573 Bacteria 1105
210 Ga0501039_0673541 3300049575 Bacteria 810
211 Ga0501041_0435473 3300049577 Bacteria 832
212 Ga0501047_0096168 3300049581 Bacteria 2840
213 Ga0501048_0953584 3300049582 Bacteria 617
214 Ga0501068_0611985 3300049584 Bacteria 710
215 Ga0501071_0891757 3300049587 Bacteria 686
216 Ga0501072_1460878 3300049588 Bacteria 528
217 Ga0501074_0500530 3300049590 Bacteria 861
218 Ga0501075_0172567 3300049591 Bacteria 1650
219 Ga0500651_0620230 3300053093 Unclassified 585
220 Ga0501084_0373942 3300054114 Bacteria 1204
221 Ga0466962_0293901 3300061719 Bacteria 803
222 2523108146 2522572158 Bacteria 6514390
223 2937848055 2937843397 Bacteria 5256375
224 Ga0224572_1003011
225 Ga0055524_1013245
226 Ga0070683_100138381
227 Ga0070683_100660931
228 Ga0070683_101757757
229 Ga0070690_100322363
230 Ga0070680_101461816
231 Ga0068868_100515688
232 Ga0070692_10003793
233 Ga0070671_100974560
234 Ga0070667_101328086
235 Ga0070709_10102842
236 Ga0070709_10128054
237 Ga0070709_10460691
238 Ga0070709_11324403
239 Ga0070714_100000183
240 Ga0070714_100839628
241 Ga0070714_100984477
242 Ga0070714_101734922
243 Ga0070714_101864601
244 Ga0070713_100486321
245 Ga0070713_100777049
246 Ga0070713_101456543
247 Ga0070711_100006541
248 Ga0070708_100195149
249 Ga0070681_10050656
250 Ga0070681_11109899
251 Ga0068867_101913384
252 Ga0070706_100045622
253 Ga0070707_101065618
254 Ga0070698_100701089
255 Ga0070679_100207429
256 Ga0070684_100162649
257 Ga0070684_100237239
258 Ga0070686_100801707
259 Ga0070665_100424275
260 Ga0068855_100481442
261 Ga0068855_101900328
262 Ga0068854_100937412
263 Ga0068856_101634055
264 Ga0068859_103062342
265 Ga0068864_100706456
266 Ga0068858_100144106
267 Ga0068858_100389540
268 Ga0070717_10194633
269 Ga0070717_10278770
270 Ga0070717_10595499
271 Ga0070715_10462770
272 Ga0070716_100088565
273 Ga0070716_100992343
274 Ga0068865_101385338
275 Ga0097620_103062570
276 Ga0105240_10129031
277 Ga0105240_10975930
278 Ga0105240_12362667
279 Ga0111539_10607075
280 Ga0105245_10242788
281 Ga0105247_10614819
282 Ga0105241_10165030
283 Ga0105241_10271646
284 Ga0105248_10239391
285 Ga0105248_10472714
286 Ga0105248_10744115
287 Ga0105237_10685015
288 Ga0105237_11145092
289 Ga0105238_10603109
290 Ga0105249_11776465
291 Ga0105239_10534819
292 Ga0105239_11808340
293 Ga0157370_10630082
294 Ga0157369_10191825
295 Ga0157369_10265154
296 Ga0157374_10162081
297 Ga0157374_10381857
298 Ga0157374_10636912
299 Ga0157374_10836488
300 Ga0163162_12284345
301 Ga0157372_10011561
302 Ga0157372_11032011
303 Ga0157372_12920922
304 Ga0157372_13264073
305 Ga0157375_12575503
306 Ga0163163_10237016
307 Ga0163163_10288369
308 Ga0163163_10738859
309 Ga0163163_11665490
310 Ga0157379_10349681
311 Ga0157379_10764751
312 Ga0157376_10406944
313 Ga0157376_10531079
314 Ga0206354_10881763
315 Ga0213876_10511297
316 Ga0213875_10116560
317 Ga0224572_1016181
318 Ga0228598_1000049
319 Ga0228598_1040943
320 Ga0209256_1000084
321 Ga0209256_1006478
322 Ga0207710_10410948
323 Ga0207680_10929531
324 Ga0207685_10465137
325 Ga0207699_10128956
326 Ga0207699_10425783
327 Ga0207699_11017042
328 Ga0207684_10050885
329 Ga0207684_11020705
330 Ga0207654_11053264
331 Ga0207707_10087429
332 Ga0207707_10948702
333 Ga0207707_11461069
334 Ga0207695_10166185
335 Ga0207671_11594463
336 Ga0207663_10361736
337 Ga0207652_10752751
338 Ga0207681_11814917
339 Ga0207694_11024272
340 Ga0207687_10039185
341 Ga0207700_10193986
342 Ga0207700_10734487
343 Ga0207700_10789106
344 Ga0207664_10000212
345 Ga0207664_10685654
346 Ga0207664_11263544
347 Ga0207664_11290410
348 Ga0207665_10422501
349 Ga0207711_10479538
350 Ga0207711_10568809
351 Ga0207711_11071340
352 Ga0207661_10554667
353 Ga0207661_11338384
354 Ga0207661_11776701
355 Ga0207667_11664446
356 Ga0207667_11700251
357 Ga0207640_11627843
358 Ga0207677_11911595
359 Ga0207702_11066452
360 Ga0207702_11549531
361 Ga0207676_12050094
362 Ga0265356_1006530
363 Ga0268266_11671374
364 Ga0268266_12144564
365 Ga0268264_12682520
366 Ga0265338_10232280
367 Ga0265762_1004308
368 Ga0265760_10127463
369 Ga0265330_10346519
370 Ga0265332_10122577
371 Ga0265325_10225150
372 Ga0265325_10290043
373 Ga0265340_10082584
374 Ga0265340_10141045
375 Ga0265340_10253614
376 Ga0265339_10049703
377 Ga0265339_10097112
378 Ga0265339_10121105
379 Ga0265339_10272342
380 Ga0265327_10002305
381 Ga0265316_10120664
382 Ga0265316_10263816
383 Ga0265316_10278221
384 Ga0265313_10089851
385 Ga0265342_10030405
386 Ga0265342_10049315
387 Ga0265342_10496756
388 Ga0265342_10572722
389 Ga0373934_0318581
390 Ga0373953_0075354
391 Ga0373954_0215101
392 Ga0373957_0053297
393 Ga0373955_0993052
394 Ga0373924_0194291
395 Ga0373935_0560070
396 Ga0373947_0149619
397 Ga0373937_0097558
398 Ga0395905_1048531
399 Ga0395905_1869643
400 Ga0436364_1462783
401 Ga0436365_0964720
402 Ga0436360_0187301
403 Ga0436361_0403767
404 Ga0436362_0594947
405 Ga0436362_0990336
406 Ga0466966_0058940
407 Ga0466963_0616688
408 Ga0466970_0590842
409 Ga0466957_0628950
410 Ga0466959_0025130
411 Ga0466959_0425547
412 Ga0466958_0087537
413 Ga0495653_0432635
414 Ga0495580_0937651
415 Ga0495637_0013204
416 Ga0495666_0339874
417 Ga0495642_0211510
418 Ga0495652_0266975
419 Ga0495645_0636228
420 Ga0495668_0285219
421 Ga0495625_0089681
422 Ga0495599_0525018
423 Ga0495669_0000005
424 Ga0495604_0028150
425 Ga0495674_1376534
426 Ga0495602_0348088
427 Ga0495602_0797693
428 Ga0496104_1881055
429 Ga0501031_0673975
430 Ga0501032_0372735
431 Ga0501036_0214790
432 Ga0501037_0304870
433 Ga0501039_0673541
434 Ga0501041_0435473
435 Ga0501047_0096168
436 Ga0501048_0953584
437 Ga0501068_0611985
438 Ga0501071_0891757
439 Ga0501072_1460878
440 Ga0501074_0500530
441 Ga0501075_0172567
442 Ga0500651_0620230
443 Ga0501084_0373942
444 Ga0466962_0293901
445 2523108146
446 2937848055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02604

PhdYeFM_antitox

Antitoxin Phd_YefM, type II toxin-antitoxin system

9

74

0.94

Map