F335582

General Info

Members Datasets Scaffolds Average Seq Length
223 153 446 243

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10174635|Ga0105246_101746352
Length 265
Sequence MRIVIGAVLILVKAWNLPSGAQPQDGSMTRSLTPVFVARNLTKTYQMGEVKVSALRGVDLEIYEGEFVVLLGPSGSGKSTLLNILGGLDTATSGEVRWRDHDLVRASEHELTRYRRQHVGFVFQFYNLIPSLTVRENVALVTDLVEHPMAPEDALRLVGLDHRLDHFPSQLSGGEQQRVAIARAIAKRPDELLCDEPTGALDYQTGVVVLDAIARINQELHTTAIVITHNAAIAGMADRVLRLADGLIVDIEQNLRKLSPQELRW

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
103 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
104 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
105 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
115 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
153 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 1.79
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.73
Nodule 0
Rhizoplane 0
Rhizosphere 91.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10174635 3300011119 Bacteria 1649
2 JGI25152J39213_1005826 3300002773 Bacteria 3494
3 JGI25150J39212_1017379 3300002774 Bacteria 1163
4 JGI25153J46596_10000762 3300003215 Bacteria 19694
5 JGI25153J46596_10009191 3300003215 Bacteria 4627
6 Ga0055526_1010951 3300003771 Bacteria 4149
7 Ga0065712_10092429 3300005290 Bacteria 2331
8 Ga0070658_10194345 3300005327 Bacteria 1711
9 Ga0070690_100174163 3300005330 Bacteria 1483
10 Ga0070670_100004261 3300005331 Bacteria 11965
11 Ga0070670_100461296 3300005331 Bacteria 1127
12 Ga0070666_10423524 3300005335 Bacteria 959
13 Ga0070689_100052606 3300005340 Bacteria 3150
14 Ga0070669_100016738 3300005353 Bacteria 5232
15 Ga0070675_100019995 3300005354 Bacteria 5341
16 Ga0070675_100075185 3300005354 Bacteria 2808
17 Ga0070675_100088592 3300005354 Bacteria 2590
18 Ga0070675_100430631 3300005354 Bacteria 1181
19 Ga0070671_100123484 3300005355 Bacteria 2180
20 Ga0070674_100171060 3300005356 Bacteria 1656
21 Ga0070673_100004424 3300005364 Bacteria 8890
22 Ga0070673_100047091 3300005364 Bacteria 3353
23 Ga0070713_100000622 3300005436 Bacteria 22633
24 Ga0070701_10015997 3300005438 Bacteria 3478
25 Ga0070701_10097158 3300005438 Bacteria 1625
26 Ga0070711_100191321 3300005439 Bacteria 1573
27 Ga0070700_100058436 3300005441 Bacteria 2423
28 Ga0068867_100119478 3300005459 Bacteria 2035
29 Ga0070699_100194128 3300005518 Bacteria 1804
30 Ga0070679_100057719 3300005530 Bacteria 3869
31 Ga0070684_100699854 3300005535 Bacteria 945
32 Ga0070672_100003931 3300005543 Bacteria 9685
33 Ga0070672_100048757 3300005543 Bacteria 3292
34 Ga0070664_100013432 3300005564 Bacteria 6670
35 Ga0068857_100026194 3300005577 Bacteria 5138
36 Ga0068857_100058687 3300005577 Bacteria 3418
37 Ga0068857_100688026 3300005577 Bacteria 971
38 Ga0068859_100103151 3300005617 Bacteria 2910
39 Ga0068859_100123276 3300005617 Bacteria 2659
40 Ga0068859_100338427 3300005617 Bacteria 1599
41 Ga0068861_100005375 3300005719 Bacteria 8660
42 Ga0068870_10017112 3300005840 Bacteria 3478
43 Ga0068870_10043670 3300005840 Bacteria 2339
44 Ga0068863_100000302 3300005841 Bacteria 50916
45 Ga0068860_100086259 3300005843 Bacteria 2988
46 Ga0068862_100006976 3300005844 Bacteria 9373
47 Ga0068862_100016681 3300005844 Bacteria 6115
48 Ga0070717_10127106 3300006028 Bacteria 2189
49 Ga0075364_10024030 3300006051 Bacteria 3865
50 Ga0075428_100214533 3300006844 Bacteria 2079
51 Ga0075430_100071836 3300006846 Bacteria 2903
52 Ga0075431_100322703 3300006847 Bacteria 1557
53 Ga0075431_100342725 3300006847 Bacteria 1504
54 Ga0075433_10218818 3300006852 Bacteria 1692
55 Ga0068865_100532545 3300006881 Bacteria 984
56 Ga0097620_100103149 3300006931 Bacteria 2910
57 Ga0097620_100123277 3300006931 Bacteria 2659
58 Ga0097620_100338432 3300006931 Bacteria 1599
59 Ga0105240_10000256 3300009093 Bacteria 105227
60 Ga0111539_10055769 3300009094 Bacteria 4698
61 Ga0111539_10327490 3300009094 Bacteria 1783
62 Ga0105243_10010228 3300009148 Bacteria 7129
63 Ga0105242_10104554 3300009176 Bacteria 2404
64 Ga0105248_10001230 3300009177 Bacteria 28575
65 Ga0105249_10003056 3300009553 Bacteria 14443
66 Ga0105249_10028698 3300009553 Bacteria 5022
67 Ga0163162_10119043 3300013306 Bacteria 2743
68 Ga0157375_10042084 3300013308 Bacteria 4418
69 Ga0163163_10213767 3300014325 Bacteria 1977
70 Ga0157380_10064365 3300014326 Bacteria 2943
71 Ga0182008_10007650 3300014497 Bacteria 5955
72 Ga0207425_1000672 3300025245 Bacteria 18705
73 Ga0209129_1000210 3300025258 Bacteria 68046
74 Ga0209564_1003418 3300025295 Bacteria 10886
75 Ga0209758_1000078 3300025297 Bacteria 266153
76 Ga0209758_1000091 3300025297 Bacteria 242583
77 Ga0209256_1009170 3300025299 Bacteria 4398
78 Ga0209257_1039280 3300025304 Bacteria 1424
79 Ga0207642_10030991 3300025899 Bacteria 2235
80 Ga0207643_10018486 3300025908 Bacteria 3816
81 Ga0207643_10075366 3300025908 Bacteria 1947
82 Ga0207705_10030596 3300025909 Bacteria 3841
83 Ga0207705_10156328 3300025909 Bacteria 1711
84 Ga0207695_10001775 3300025913 Bacteria 34048
85 Ga0207695_10151235 3300025913 Bacteria 2260
86 Ga0207660_10096331 3300025917 Bacteria 2203
87 Ga0207660_10470136 3300025917 Bacteria 1018
88 Ga0207662_10006248 3300025918 Bacteria 6415
89 Ga0207657_10017350 3300025919 Bacteria 6906
90 Ga0207681_10039406 3300025923 Bacteria 3137
91 Ga0207681_10039490 3300025923 Bacteria 3134
92 Ga0207694_10229282 3300025924 Bacteria 1516
93 Ga0207650_10010932 3300025925 Bacteria 6239
94 Ga0207650_10040613 3300025925 Bacteria 3405
95 Ga0207659_10029119 3300025926 Bacteria 3760
96 Ga0207659_10201533 3300025926 Bacteria 1590
97 Ga0207659_10292389 3300025926 Bacteria 1335
98 Ga0207700_10000241 3300025928 Bacteria 32753
99 Ga0207664_10174966 3300025929 Bacteria 1839
100 Ga0207706_10403488 3300025933 Bacteria 1185
101 Ga0207686_10081420 3300025934 Bacteria 2113
102 Ga0207670_10569000 3300025936 Bacteria 928
103 Ga0207669_10145007 3300025937 Bacteria 1654
104 Ga0207691_10051377 3300025940 Bacteria 3769
105 Ga0207691_10056517 3300025940 Bacteria 3574
106 Ga0207691_10069870 3300025940 Bacteria 3172
107 Ga0207711_10069475 3300025941 Bacteria 3053
108 Ga0207689_10213667 3300025942 Bacteria 1594
109 Ga0207679_10012670 3300025945 Bacteria 5504
110 Ga0207679_10220598 3300025945 Bacteria 1595
111 Ga0207667_10039784 3300025949 Bacteria 5007
112 Ga0207651_10031136 3300025960 Bacteria 3406
113 Ga0207712_10006278 3300025961 Bacteria 7498
114 Ga0207668_10084509 3300025972 Bacteria 2313
115 Ga0207640_10011478 3300025981 Bacteria 5019
116 Ga0207658_10025277 3300025986 Bacteria 4158
117 Ga0207703_10415007 3300026035 Bacteria 1251
118 Ga0207678_10017077 3300026067 Bacteria 6373
119 Ga0207708_10189201 3300026075 Bacteria 1638
120 Ga0207641_10002806 3300026088 Bacteria 15848
121 Ga0207676_10692369 3300026095 Bacteria 987
122 Ga0207674_10008502 3300026116 Bacteria 11850
123 Ga0207674_10043769 3300026116 Bacteria 4615
124 Ga0207674_10157334 3300026116 Bacteria 2227
125 Ga0207674_10358172 3300026116 Bacteria 1410
126 Ga0207675_100010038 3300026118 Bacteria 8876
127 Ga0207698_10013819 3300026142 Bacteria 5343
128 Ga0209966_1000090 3300027695 Bacteria 39638
129 Ga0207428_10435397 3300027907 Bacteria 957
130 Ga0268265_10010869 3300028380 Bacteria 6148
131 Ga0268265_10291278 3300028380 Bacteria 1466
132 Ga0268264_10095460 3300028381 Bacteria 2573
133 Ga0316575_10036068 3300031665 Bacteria 1945
134 Ga0316575_10124502 3300031665 Bacteria 1055
135 Ga0316579_10051252 3300031691 Bacteria 1931
136 Ga0316576_10073306 3300031727 Bacteria 2529
137 Ga0316578_10026710 3300031728 Bacteria 3258
138 Ga0316578_10196455 3300031728 Bacteria 1215
139 Ga0316578_10225941 3300031728 Bacteria 1125
140 Ga0316577_10001732 3300031733 Bacteria 10480
141 Ga0316577_10029765 3300031733 Bacteria 3047
142 Ga0316577_10102030 3300031733 Bacteria 1608
143 Ga0316583_10041191 3300032133 Bacteria 1635
144 Ga0316585_10036602 3300032137 Bacteria 1555
145 Ga0316586_1010089 3300033527 Bacteria 1425
146 Ga0316586_1029163 3300033527 Bacteria 939
147 Ga0316588_1008028 3300033528 Bacteria 2160
148 Ga0316587_1015755 3300033529 Bacteria 1257
149 Ga0373934_0025444 3300035086 Bacteria 2292
150 Ga0373955_0171643 3300035172 Bacteria 1284
151 Ga0316574_0016142 3300035398 Bacteria 4346
152 Ga0316574_0024101 3300035398 Bacteria 3638
153 Ga0316574_0057015 3300035398 Bacteria 2445
154 Ga0316574_0081383 3300035398 Bacteria 2057
155 Ga0316574_0119901 3300035398 Bacteria 1689
156 Ga0316574_0283935 3300035398 Bacteria 1054
157 Ga0373947_0027166 3300035725 Bacteria 3349
158 Ga0316582_0010255 3300036647 Bacteria 5123
159 Ga0316582_0180633 3300036647 Bacteria 1435
160 Ga0316582_0548178 3300036647 Bacteria 797
161 Ga0316584_0023595 3300036712 Bacteria 4495
162 Ga0316584_0044318 3300036712 Bacteria 3317
163 Ga0316584_0131704 3300036712 Bacteria 1867
164 Ga0316584_0447906 3300036712 Bacteria 913
165 Ga0316581_0030325 3300037588 Bacteria 1628
166 Ga0316581_0085850 3300037588 Bacteria 968
167 Ga0400483_247662 3300039062 Bacteria 19088
168 Ga0436365_0027171 3300039437 Bacteria 1862
169 Ga0451577_0002356 3300042876 Bacteria 22717
170 Ga0451577_0002684 3300042876 Bacteria 20757
171 Ga0451577_0035794 3300042876 Bacteria 4471
172 Ga0451577_0231000 3300042876 Bacteria 1673
173 Ga0453683_0034220 3300044673 Bacteria 3203
174 Ga0453684_0001440 3300044712 Bacteria 67958
175 Ga0453684_0024725 3300044712 Bacteria 8758
176 Ga0453684_0038250 3300044712 Bacteria 6563
177 Ga0453684_0039002 3300044712 Bacteria 6480
178 Ga0453684_0098042 3300044712 Bacteria 3595
179 Ga0453684_0167089 3300044712 Bacteria 2596
180 Ga0453684_1162215 3300044712 Bacteria 812
181 Ga0466959_0004122 3300045049 Bacteria 9684
182 Ga0451576_0014075 3300045051 Bacteria 8914
183 Ga0495650_0114851 3300046471 Bacteria 996
184 Ga0495598_0005184 3300046537 Bacteria 2872
185 Ga0495609_0103272 3300046538 Bacteria 1234
186 Ga0495588_0368659 3300046674 Bacteria 754
187 Ga0495657_0278926 3300046675 Bacteria 1001
188 Ga0495670_0062541 3300046691 Bacteria 1873
189 Ga0495604_0399651 3300047317 Bacteria 905
190 Ga0501032_0220810 3300049569 Bacteria 1233
191 Ga0501036_0175683 3300049572 Bacteria 1803
192 Ga0501038_0143092 3300049574 Bacteria 1955
193 Ga0501039_0371636 3300049575 Bacteria 1123
194 Ga0501040_0182458 3300049576 Bacteria 1488
195 Ga0501040_0198540 3300049576 Bacteria 1424
196 Ga0501041_0173470 3300049577 Bacteria 1349
197 Ga0501041_0205094 3300049577 Bacteria 1236
198 Ga0501043_0081094 3300049579 Bacteria 2549
199 Ga0501046_0372157 3300049580 Bacteria 1035
200 Ga0501071_0085800 3300049587 Bacteria 2309
201 Ga0501072_0134071 3300049588 Bacteria 1975
202 Ga0501074_0346474 3300049590 Bacteria 1054
203 Ga0501076_0165244 3300049592 Bacteria 1804
204 Ga0501077_0013538 3300049593 Bacteria 5116
205 Ga0501077_0181427 3300049593 Bacteria 1338
206 Ga0501081_0090363 3300049743 Bacteria 2153
207 Ga0501081_0145653 3300049743 Bacteria 1699
208 Ga0501035_0266865 3300049822 Bacteria 1450
209 nmdc:mga00v17_219801_c1 3300050491 Bacteria 1230
210 nmdc:mga09592_146110_c1 3300050508 Bacteria 2039
211 nmdc:mga0qj67_17767_c1 3300050509 Bacteria 5410
212 nmdc:mga0qj67_20757_c1 3300050509 Bacteria 5030
213 nmdc:mga06r32_10987_c1 3300050510 Bacteria 4270
214 nmdc:mga06r32_234545_c1 3300050510 Bacteria 1823
215 nmdc:mga06r32_338266_c1 3300050510 Bacteria 1490
216 nmdc:mga08y16_54426_c1 3300050511 Bacteria 4181
217 nmdc:mga08y16_74411_c1 3300050511 Bacteria 3539
218 Ga0500660_111882 3300053100 Bacteria 1162
219 Ga0501084_0810593 3300054114 Bacteria 788
220 Ga0501082_0022494 3300060353 Bacteria 5430
221 Ga0530510_0041970 3300061734 Bacteria 3304
222 Ga0530510_0721714 3300061734 Bacteria 760
223 2919709167 2919704043 Bacteria 5560311
224 Ga0105246_10174635
225 JGI25152J39213_1005826
226 JGI25150J39212_1017379
227 JGI25153J46596_10000762
228 JGI25153J46596_10009191
229 Ga0055526_1010951
230 Ga0065712_10092429
231 Ga0070658_10194345
232 Ga0070690_100174163
233 Ga0070670_100004261
234 Ga0070670_100461296
235 Ga0070666_10423524
236 Ga0070689_100052606
237 Ga0070669_100016738
238 Ga0070675_100019995
239 Ga0070675_100075185
240 Ga0070675_100088592
241 Ga0070675_100430631
242 Ga0070671_100123484
243 Ga0070674_100171060
244 Ga0070673_100004424
245 Ga0070673_100047091
246 Ga0070713_100000622
247 Ga0070701_10015997
248 Ga0070701_10097158
249 Ga0070711_100191321
250 Ga0070700_100058436
251 Ga0068867_100119478
252 Ga0070699_100194128
253 Ga0070679_100057719
254 Ga0070684_100699854
255 Ga0070672_100003931
256 Ga0070672_100048757
257 Ga0070664_100013432
258 Ga0068857_100026194
259 Ga0068857_100058687
260 Ga0068857_100688026
261 Ga0068859_100103151
262 Ga0068859_100123276
263 Ga0068859_100338427
264 Ga0068861_100005375
265 Ga0068870_10017112
266 Ga0068870_10043670
267 Ga0068863_100000302
268 Ga0068860_100086259
269 Ga0068862_100006976
270 Ga0068862_100016681
271 Ga0070717_10127106
272 Ga0075364_10024030
273 Ga0075428_100214533
274 Ga0075430_100071836
275 Ga0075431_100322703
276 Ga0075431_100342725
277 Ga0075433_10218818
278 Ga0068865_100532545
279 Ga0097620_100103149
280 Ga0097620_100123277
281 Ga0097620_100338432
282 Ga0105240_10000256
283 Ga0111539_10055769
284 Ga0111539_10327490
285 Ga0105243_10010228
286 Ga0105242_10104554
287 Ga0105248_10001230
288 Ga0105249_10003056
289 Ga0105249_10028698
290 Ga0163162_10119043
291 Ga0157375_10042084
292 Ga0163163_10213767
293 Ga0157380_10064365
294 Ga0182008_10007650
295 Ga0207425_1000672
296 Ga0209129_1000210
297 Ga0209564_1003418
298 Ga0209758_1000078
299 Ga0209758_1000091
300 Ga0209256_1009170
301 Ga0209257_1039280
302 Ga0207642_10030991
303 Ga0207643_10018486
304 Ga0207643_10075366
305 Ga0207705_10030596
306 Ga0207705_10156328
307 Ga0207695_10001775
308 Ga0207695_10151235
309 Ga0207660_10096331
310 Ga0207660_10470136
311 Ga0207662_10006248
312 Ga0207657_10017350
313 Ga0207681_10039406
314 Ga0207681_10039490
315 Ga0207694_10229282
316 Ga0207650_10010932
317 Ga0207650_10040613
318 Ga0207659_10029119
319 Ga0207659_10201533
320 Ga0207659_10292389
321 Ga0207700_10000241
322 Ga0207664_10174966
323 Ga0207706_10403488
324 Ga0207686_10081420
325 Ga0207670_10569000
326 Ga0207669_10145007
327 Ga0207691_10051377
328 Ga0207691_10056517
329 Ga0207691_10069870
330 Ga0207711_10069475
331 Ga0207689_10213667
332 Ga0207679_10012670
333 Ga0207679_10220598
334 Ga0207667_10039784
335 Ga0207651_10031136
336 Ga0207712_10006278
337 Ga0207668_10084509
338 Ga0207640_10011478
339 Ga0207658_10025277
340 Ga0207703_10415007
341 Ga0207678_10017077
342 Ga0207708_10189201
343 Ga0207641_10002806
344 Ga0207676_10692369
345 Ga0207674_10008502
346 Ga0207674_10043769
347 Ga0207674_10157334
348 Ga0207674_10358172
349 Ga0207675_100010038
350 Ga0207698_10013819
351 Ga0209966_1000090
352 Ga0207428_10435397
353 Ga0268265_10010869
354 Ga0268265_10291278
355 Ga0268264_10095460
356 Ga0316575_10036068
357 Ga0316575_10124502
358 Ga0316579_10051252
359 Ga0316576_10073306
360 Ga0316578_10026710
361 Ga0316578_10196455
362 Ga0316578_10225941
363 Ga0316577_10001732
364 Ga0316577_10029765
365 Ga0316577_10102030
366 Ga0316583_10041191
367 Ga0316585_10036602
368 Ga0316586_1010089
369 Ga0316586_1029163
370 Ga0316588_1008028
371 Ga0316587_1015755
372 Ga0373934_0025444
373 Ga0373955_0171643
374 Ga0316574_0016142
375 Ga0316574_0024101
376 Ga0316574_0057015
377 Ga0316574_0081383
378 Ga0316574_0119901
379 Ga0316574_0283935
380 Ga0373947_0027166
381 Ga0316582_0010255
382 Ga0316582_0180633
383 Ga0316582_0548178
384 Ga0316584_0023595
385 Ga0316584_0044318
386 Ga0316584_0131704
387 Ga0316584_0447906
388 Ga0316581_0030325
389 Ga0316581_0085850
390 Ga0400483_247662
391 Ga0436365_0027171
392 Ga0451577_0002356
393 Ga0451577_0002684
394 Ga0451577_0035794
395 Ga0451577_0231000
396 Ga0453683_0034220
397 Ga0453684_0001440
398 Ga0453684_0024725
399 Ga0453684_0038250
400 Ga0453684_0039002
401 Ga0453684_0098042
402 Ga0453684_0167089
403 Ga0453684_1162215
404 Ga0466959_0004122
405 Ga0451576_0014075
406 Ga0495650_0114851
407 Ga0495598_0005184
408 Ga0495609_0103272
409 Ga0495588_0368659
410 Ga0495657_0278926
411 Ga0495670_0062541
412 Ga0495604_0399651
413 Ga0501032_0220810
414 Ga0501036_0175683
415 Ga0501038_0143092
416 Ga0501039_0371636
417 Ga0501040_0182458
418 Ga0501040_0198540
419 Ga0501041_0173470
420 Ga0501041_0205094
421 Ga0501043_0081094
422 Ga0501046_0372157
423 Ga0501071_0085800
424 Ga0501072_0134071
425 Ga0501074_0346474
426 Ga0501076_0165244
427 Ga0501077_0013538
428 Ga0501077_0181427
429 Ga0501081_0090363
430 Ga0501081_0145653
431 Ga0501035_0266865
432 nmdc:mga00v17_219801_c1
433 nmdc:mga09592_146110_c1
434 nmdc:mga0qj67_17767_c1
435 nmdc:mga0qj67_20757_c1
436 nmdc:mga06r32_10987_c1
437 nmdc:mga06r32_234545_c1
438 nmdc:mga06r32_338266_c1
439 nmdc:mga08y16_54426_c1
440 nmdc:mga08y16_74411_c1
441 Ga0500660_111882
442 Ga0501084_0810593
443 Ga0501082_0022494
444 Ga0530510_0041970
445 Ga0530510_0721714
446 2919709167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

199

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9532 11 231
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9439 9 226
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9427 10 228
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9391 9 230
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9314 9 231
ID Description Score Start End Superfamily
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 37 234 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9626 9 229 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9618 9 234 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9604 9 231 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9473 7 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V6SMF6-F1-model_v4 ABC transporter ATP-binding protein 0.9812 11 240 GO:0005524
GO:0016887
AF-A0A7V6SMF6-F1-model_v4 ABC transporter ATP-binding protein 0.9728 11 240 GO:0005524
GO:0016887
AF-A0A7V9TM51-F1-model_v4 ABC transporter ATP-binding protein 0.9708 27 228 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A4Q6EYY1-F1-model_v4 ABC transporter ATP-binding protein 0.9633 104 228 GO:0005524
GO:0016887
AF-A0A7V9BJ15-F1-model_v4 ABC transporter ATP-binding protein 0.9616 11 226 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map