F335581

General Info

Members Datasets Scaffolds Average Seq Length
223 187 197 165

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10881940|Ga0105239_108819401
Length 187
Sequence MSQNGLGTFLAALAVIPLIMNTEKAILAGGCFWGVEELIRSQEGVIKTTVGYTGGDVPNATYRNHGTHAEAIRIEFDPSKTSYRKLLEFFFQLHDPTTRNRQGNDIGASYRSAIFYLDEDQKNIANQLIAELTAAHVYPRPIVTEVTPATEFWDAEEEHQDYLQKHPYGYTCHYIRPDWKLPAEAAK

Samples

Sample ID Description Type Environment
1 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
2 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
3 2718217882 Rhizobium sp. N741 Isolate Nodule
4 2718218009 Rhizobium sp. N561 Isolate Nodule
5 2718218363 Rhizobium sp. N113 Isolate Nodule
6 2718218365 Rhizobium sp. N731 Isolate Nodule
7 2718218366 Rhizobium sp. N621 Isolate Nodule
8 2721755514 Rhizobium sp. N6212 Isolate Nodule
9 2721755810 Rhizobium sp. N871 Isolate Nodule
10 2728369365 Rhizobium sp. N1341 Isolate Nodule
11 2728369397 Rhizobium sp. N1314 Isolate Nodule
12 2738541283 Pedobacter sp. OK701 Isolate Unclassified
13 2739367663 Pedobacter sp. YR510 Isolate Unclassified
14 2791355260 Rhizobium sp. L9 Isolate Nodule
15 2791355264 Rhizobium sp. S9 Isolate Nodule
16 2791355265 Rhizobium sp. H4 Isolate Nodule
17 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
18 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
19 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
20 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
21 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
22 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
23 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
24 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
187 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.55
Metatranscriptomes 1.79
Isolates 11.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.45
Nodule 8.07
Rhizoplane 2.24
Rhizosphere 70.85
Stem 0
Stem Tuber 0
Unclassified 5.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055533_1000925 3300003756 Bacteria 8762
2 Ga0055536_1000038 3300003781 Bacteria 133102
3 Ga0055530_10000250 3300003791 Bacteria 48786
4 Ga0065714_10153132 3300005288 Bacteria 1094
5 Ga0068869_100282474 3300005334 Bacteria 1335
6 Ga0070661_100336494 3300005344 Bacteria 1182
7 Ga0070668_100777105 3300005347 Bacteria 849
8 Ga0070667_100137866 3300005367 Bacteria 2134
9 Ga0070667_100175943 3300005367 Bacteria 1891
10 Ga0070707_100264499 3300005468 Bacteria 1673
11 Ga0070698_100012245 3300005471 Bacteria 9087
12 Ga0070698_100225770 3300005471 Bacteria 1806
13 Ga0070699_100417601 3300005518 Unclassified 1214
14 Ga0068853_100084619 3300005539 Bacteria 2779
15 Ga0070672_100036140 3300005543 Bacteria 3762
16 Ga0068857_100593785 3300005577 Unclassified 1046
17 Ga0068854_100005658 3300005578 Bacteria 7896
18 Ga0068856_100000029 3300005614 Bacteria 130205
19 Ga0068856_100261149 3300005614 Bacteria 1747
20 Ga0068852_100000485 3300005616 Bacteria 26052
21 Ga0068859_100793807 3300005617 Bacteria 1035
22 Ga0068860_100003143 3300005843 Bacteria 17059
23 Ga0075365_10625225 3300006038 Bacteria 761
24 Ga0075368_10157041 3300006042 Bacteria 952
25 Ga0075363_100093700 3300006048 Bacteria 1655
26 Ga0075364_10024760 3300006051 Bacteria 3814
27 Ga0075364_10791662 3300006051 Bacteria 646
28 Ga0075367_10170736 3300006178 Bacteria 1355
29 Ga0075369_10055761 3300006186 Bacteria 1718
30 Ga0075429_100903667 3300006880 Bacteria 773
31 Ga0097620_100793893 3300006931 Bacteria 1035
32 Ga0105240_10743748 3300009093 Bacteria 1067
33 Ga0105242_10464497 3300009176 Bacteria 1196
34 Ga0105237_10000171 3300009545 Bacteria 90778
35 Ga0105237_10081876 3300009545 Bacteria 3219
36 Ga0105238_10117541 3300009551 Bacteria 2639
37 Ga0105238_11183947 3300009551 Bacteria 788
38 Ga0105239_10000301 3300010375 Bacteria 73122
39 Ga0105239_10000609 3300010375 Bacteria 50949
40 Ga0105239_10721929 3300010375 Bacteria 1140
41 Ga0105239_10881940 3300010375 Bacteria 1027
42 Ga0157328_1011053 3300012478 Bacteria 635
43 Ga0157370_10028936 3300013104 Bacteria 5444
44 Ga0157374_10000002 3300013296 Bacteria 1054226
45 Ga0163162_10492740 3300013306 Bacteria 1356
46 Ga0163162_11121273 3300013306 Bacteria 892
47 Ga0157372_10002122 3300013307 Bacteria 21533
48 Ga0157375_10364733 3300013308 Bacteria 1611
49 Ga0157377_10874272 3300014745 Bacteria 670
50 Ga0157377_10923449 3300014745 Bacteria 654
51 Ga0157376_10020025 3300014969 Bacteria 5167
52 Ga0157376_10657044 3300014969 Bacteria 1049
53 Ga0209674_100043 3300025226 Bacteria 369728
54 Ga0209676_1000201 3300025292 Bacteria 133195
55 Ga0209050_1000203 3300025298 Bacteria 133156
56 Ga0207647_10015333 3300025904 Bacteria 5258
57 Ga0207647_10071224 3300025904 Bacteria 2097
58 Ga0207684_10061497 3300025910 Unclassified 3189
59 Ga0207684_10291695 3300025910 Bacteria 1406
60 Ga0207695_10138611 3300025913 Bacteria 2384
61 Ga0207671_10008187 3300025914 Bacteria 8913
62 Ga0207671_10100963 3300025914 Bacteria 2185
63 Ga0207671_10115163 3300025914 Bacteria 2049
64 Ga0207649_10262680 3300025920 Bacteria 1248
65 Ga0207652_10031856 3300025921 Bacteria 4428
66 Ga0207646_10229314 3300025922 Bacteria 1678
67 Ga0207694_10006499 3300025924 Bacteria 8894
68 Ga0207694_10047783 3300025924 Bacteria 3310
69 Ga0207694_10747272 3300025924 Bacteria 826
70 Ga0207687_10853790 3300025927 Bacteria 778
71 Ga0207669_10201331 3300025937 Bacteria 1446
72 Ga0207689_10281412 3300025942 Bacteria 1377
73 Ga0207667_10000100 3300025949 Bacteria 138482
74 Ga0207667_10243283 3300025949 Bacteria 1841
75 Ga0207668_10553265 3300025972 Unclassified 997
76 Ga0207658_10301212 3300025986 Bacteria 1381
77 Ga0207639_10152220 3300026041 Bacteria 1939
78 Ga0207702_10000057 3300026078 Bacteria 131118
79 Ga0207702_10228561 3300026078 Bacteria 1737
80 Ga0207674_11518529 3300026116 Unclassified 639
81 Ga0207683_10605855 3300026121 Bacteria 1014
82 Ga0207698_10000364 3300026142 Bacteria 26611
83 Ga0209813_10157623 3300027866 Bacteria 817
84 Ga0268264_10039507 3300028381 Bacteria 3899
85 Ga0265338_10046455 3300028800 Bacteria 3979
86 Ga0265760_10061600 3300031090 Bacteria 1141
87 Ga0265325_10000245 3300031241 Bacteria 38510
88 Ga0265325_10070018 3300031241 Bacteria 1763
89 Ga0265339_10004214 3300031249 Bacteria 9850
90 Ga0265316_10037185 3300031344 Bacteria 3932
91 Ga0307509_10290691 3300031507 Bacteria 1389
92 Ga0307407_10015888 3300031903 Bacteria 3735
93 Ga0307409_100544679 3300031995 Bacteria 1138
94 Ga0373954_0160106 3300035118 Bacteria 1101
95 Ga0373946_0090223 3300035171 Bacteria 1357
96 Ga0373933_0204715 3300035724 Bacteria 1263
97 Ga0373937_0026449 3300036401 Bacteria 5244
98 Ga0373937_1275676 3300036401 Bacteria 683
99 Ga0265778_012331 3300036457 Bacteria 993
100 Ga0395900_0000001 3300037418 Bacteria 931146
101 Ga0395898_0000002 3300037466 Bacteria 931013
102 Ga0395901_0000006 3300038443 Bacteria 514112
103 Ga0436365_0404478 3300039437 Bacteria 1421
104 Ga0436360_0687766 3300039438 Bacteria 571
105 Ga0439461_0058787 3300041410 Bacteria 869
106 Ga0466972_0401015 3300044658 Bacteria 643
107 Ga0466968_0340666 3300044735 Bacteria 727
108 Ga0466967_1076749 3300045976 Bacteria 801
109 Ga0466967_2415146 3300045976 Bacteria 521
110 Ga0495592_0008964 3300046454 Bacteria 7514
111 Ga0495590_0019033 3300046457 Bacteria 2451
112 Ga0495638_0002467 3300046460 Bacteria 15060
113 Ga0495651_0032617 3300046462 Bacteria 4061
114 Ga0495653_0004284 3300046463 Bacteria 11555
115 Ga0495650_0101642 3300046471 Bacteria 1079
116 Ga0495605_0053656 3300046474 Bacteria 1955
117 Ga0495584_0242947 3300046491 Bacteria 915
118 Ga0495585_0368363 3300046492 Bacteria 696
119 Ga0495608_0001169 3300046511 Bacteria 18590
120 Ga0495618_0292129 3300046514 Bacteria 1014
121 Ga0495628_0037312 3300046516 Bacteria 3896
122 Ga0495632_0117558 3300046519 Bacteria 1244
123 Ga0495652_0007582 3300046529 Bacteria 10001
124 Ga0495640_0030441 3300046533 Bacteria 3865
125 Ga0495587_0001510 3300046536 Bacteria 15481
126 Ga0495598_0280617 3300046537 Bacteria 625
127 Ga0495645_0013006 3300046543 Bacteria 5876
128 Ga0495667_0004483 3300046559 Bacteria 9419
129 Ga0495634_0099323 3300046642 Bacteria 1882
130 Ga0495634_0118606 3300046642 Bacteria 1696
131 Ga0495625_0004634 3300046660 Bacteria 12924
132 Ga0495635_0276274 3300046663 Bacteria 1129
133 Ga0495659_0011834 3300046664 Bacteria 2814
134 Ga0495657_0033270 3300046675 Bacteria 3590
135 Ga0495646_0066361 3300046680 Bacteria 2134
136 Ga0495670_0000003 3300046691 Bacteria 326779
137 Ga0495600_0033103 3300046809 Bacteria 3355
138 Ga0495604_0008918 3300047317 Bacteria 7928
139 Ga0495636_0000409 3300047318 Bacteria 15972
140 Ga0495636_0078444 3300047318 Bacteria 1419
141 Ga0495674_0023778 3300047319 Bacteria 5641
142 Ga0495680_0020411 3300047322 Bacteria 5574
143 Ga0495687_232549 3300047443 Bacteria 562
144 Ga0495684_0054755 3300047471 Bacteria 3042
145 Ga0495602_0046980 3300048088 Bacteria 3894
146 Ga0496100_0731687 3300048903 Bacteria 773
147 Ga0496102_0025980 3300048905 Bacteria 5219
148 Ga0496108_0061974 3300048911 Bacteria 3149
149 Ga0496112_1716238 3300048915 Bacteria 540
150 Ga0496114_0398013 3300048917 Bacteria 1220
151 Ga0496121_0208364 3300048924 Bacteria 1387
152 Ga0496126_0017080 3300048929 Bacteria 7237
153 Ga0496126_0243036 3300048929 Bacteria 1503
154 Ga0501031_0126247 3300049568 Bacteria 1671
155 Ga0501032_0003743 3300049569 Bacteria 11534
156 Ga0501033_0000876 3300049570 Bacteria 27523
157 Ga0501034_0003888 3300049571 Bacteria 16804
158 Ga0501037_0044171 3300049573 Bacteria 3273
159 Ga0501038_0007746 3300049574 Bacteria 9900
160 Ga0501038_0408274 3300049574 Bacteria 1050
161 Ga0501038_1277406 3300049574 Bacteria 531
162 Ga0501039_1232514 3300049575 Bacteria 578
163 Ga0501043_0008147 3300049579 Bacteria 8271
164 Ga0501046_0000265 3300049580 Bacteria 53355
165 Ga0501047_0006383 3300049581 Bacteria 11088
166 Ga0501068_0487413 3300049584 Bacteria 799
167 Ga0501070_0292007 3300049586 Bacteria 1329
168 Ga0501070_0726652 3300049586 Bacteria 784
169 Ga0501073_0022215 3300049589 Bacteria 4572
170 Ga0501074_0025586 3300049590 Bacteria 4284
171 Ga0501076_0321541 3300049592 Bacteria 1269
172 Ga0501080_0321383 3300049742 Bacteria 1401
173 Ga0501035_0012466 3300049822 Bacteria 7855
174 Ga0501044_0888323 3300049823 Bacteria 766
175 Ga0501045_0375032 3300049824 Bacteria 1059
176 nmdc:mga03683_319690_c1 3300050489 Bacteria 730
177 nmdc:mga03n38_10714_c2 3300050490 Bacteria 3086
178 nmdc:mga03n38_114526_c1 3300050490 Bacteria 1318
179 nmdc:mga03n38_598407_c1 3300050490 Bacteria 628
180 nmdc:mga00v17_120831_c1 3300050491 Bacteria 1668
181 nmdc:mga00v17_42650_c1 3300050491 Bacteria 2729
182 nmdc:mga00v17_9383_c1 3300050491 Bacteria 5293
183 nmdc:mga0yw44_523377_c1 3300050492 Bacteria 805
184 nmdc:mga0yw44_661800_c1 3300050492 Bacteria 710
185 nmdc:mga06z11_101007_c1 3300050494 Bacteria 1582
186 nmdc:mga06z11_387810_c1 3300050494 Bacteria 840
187 nmdc:mga04h51_143092_c1 3300050495 Bacteria 908
188 nmdc:mga07m45_258590_c1 3300050496 Bacteria 1013
189 nmdc:mga07m45_88942_c1 3300050496 Bacteria 1768
190 nmdc:mga09592_790656_c1 3300050508 Bacteria 803
191 nmdc:mga06r32_477736_c1 3300050510 Bacteria 1224
192 nmdc:mga0sz30_135799_c1 3300050516 Bacteria 1085
193 Ga0495601_0098876 3300053077 Bacteria 1883
194 Ga0495619_0902063 3300053085 Bacteria 594
195 Ga0500641_0026933 3300053096 Bacteria 2236
196 Ga0587088_029061 3300059508 Bacteria 976
197 Ga0587062_017562 3300059639 Bacteria 980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0242947 Ga0495584_0242947_424_879 151
2 3300050492 nmdc:mga0yw44_523377_c1 nmdc:mga0yw44_523377_c1_316_771 151
3 3300044658 Ga0466972_0401015 Ga0466972_0401015_167_625 152
4 3300047443 Ga0495687_232549 Ga0495687_232549_75_533 152
5 3300005471 Ga0070698_100225770 Ga0070698_1002257701 153
6 3300012478 Ga0157328_1011053 Ga0157328_10110531 153
7 3300014745 Ga0157377_10874272 Ga0157377_108742722 153
8 3300035171 Ga0373946_0090223 Ga0373946_0090223_24_491 153
9 3300036401 Ga0373937_1275676 Ga0373937_1275676_196_663 153
10 3300036457 Ga0265778_012331 Ga0265778_012331_103_570 153
11 3300039438 Ga0436360_0687766 Ga0436360_0687766_28_495 153
12 3300041410 Ga0439461_0058787 Ga0439461_0058787_378_854 153
13 3300045976 Ga0466967_1076749 Ga0466967_1076749_256_732 153
14 3300045976 Ga0466967_2415146 Ga0466967_2415146_39_506 153
15 3300046457 Ga0495590_0019033 Ga0495590_0019033_1966_2433 153
16 3300046471 Ga0495650_0101642 Ga0495650_0101642_321_788 153
17 3300046537 Ga0495598_0280617 Ga0495598_0280617_18_503 153
18 3300046642 Ga0495634_0099323 Ga0495634_0099323_1245_1715 153
19 3300048903 Ga0496100_0731687 Ga0496100_0731687_265_732 153
20 3300048905 Ga0496102_0025980 Ga0496102_0025980_28_495 153
21 3300048915 Ga0496112_1716238 Ga0496112_1716238_51_518 153
22 3300048917 Ga0496114_0398013 Ga0496114_0398013_726_1196 153
23 3300048929 Ga0496126_0017080 Ga0496126_0017080_3645_4106 153
24 3300049568 Ga0501031_0126247 Ga0501031_0126247_501_980 153
25 3300049569 Ga0501032_0003743 Ga0501032_0003743_4517_4996 153
26 3300049570 Ga0501033_0000876 Ga0501033_0000876_2308_2787 153
27 3300049571 Ga0501034_0003888 Ga0501034_0003888_13693_14172 153
28 3300049573 Ga0501037_0044171 Ga0501037_0044171_2144_2623 153
29 3300049574 Ga0501038_0007746 Ga0501038_0007746_2849_3328 153
30 3300049574 Ga0501038_0408274 Ga0501038_0408274_567_1034 153
31 3300049574 Ga0501038_1277406 Ga0501038_1277406_33_503 153
32 3300049575 Ga0501039_1232514 Ga0501039_1232514_20_499 153
33 3300049579 Ga0501043_0008147 Ga0501043_0008147_4898_5377 153
34 3300049580 Ga0501046_0000265 Ga0501046_0000265_50860_51339 153
35 3300049581 Ga0501047_0006383 Ga0501047_0006383_4922_5401 153
36 3300049584 Ga0501068_0487413 Ga0501068_0487413_168_647 153
37 3300049586 Ga0501070_0292007 Ga0501070_0292007_166_645 153
38 3300049586 Ga0501070_0726652 Ga0501070_0726652_288_749 153
39 3300049589 Ga0501073_0022215 Ga0501073_0022215_2678_3157 153
40 3300049590 Ga0501074_0025586 Ga0501074_0025586_2737_3216 153
41 3300049822 Ga0501035_0012466 Ga0501035_0012466_5197_5676 153
42 3300049823 Ga0501044_0888323 Ga0501044_0888323_103_585 153
43 3300049824 Ga0501045_0375032 Ga0501045_0375032_507_986 153
44 3300050489 nmdc:mga03683_319690_c1 nmdc:mga03683_319690_c1_79_543 153
45 3300050490 nmdc:mga03n38_10714_c2 nmdc:mga03n38_10714_c2_2003_2467 153
46 3300050490 nmdc:mga03n38_114526_c1 nmdc:mga03n38_114526_c1_204_668 153
47 3300050490 nmdc:mga03n38_598407_c1 nmdc:mga03n38_598407_c1_154_618 153
48 3300050491 nmdc:mga00v17_120831_c1 nmdc:mga00v17_120831_c1_387_851 153
49 3300050491 nmdc:mga00v17_42650_c1 nmdc:mga00v17_42650_c1_953_1417 153
50 3300050491 nmdc:mga00v17_9383_c1 nmdc:mga00v17_9383_c1_2873_3337 153
51 3300050492 nmdc:mga0yw44_661800_c1 nmdc:mga0yw44_661800_c1_136_600 153
52 3300050494 nmdc:mga06z11_101007_c1 nmdc:mga06z11_101007_c1_41_505 153
53 3300050494 nmdc:mga06z11_387810_c1 nmdc:mga06z11_387810_c1_316_780 153
54 3300050495 nmdc:mga04h51_143092_c1 nmdc:mga04h51_143092_c1_357_821 153
55 3300050496 nmdc:mga07m45_258590_c1 nmdc:mga07m45_258590_c1_11_475 153
56 3300050496 nmdc:mga07m45_88942_c1 nmdc:mga07m45_88942_c1_788_1252 153
57 3300050516 nmdc:mga0sz30_135799_c1 nmdc:mga0sz30_135799_c1_345_809 153
58 3300005614 Ga0068856_100000029 Ga0068856_1000000298 155
59 3300010375 Ga0105239_10000301 Ga0105239_1000030136 155
60 3300026078 Ga0207702_10000057 Ga0207702_1000005724 155
61 3300037418 Ga0395900_0000001 Ga0395900_0000001_319220_319687 155
62 3300037466 Ga0395898_0000002 Ga0395898_0000002_786319_786786 155
63 3300038443 Ga0395901_0000006 Ga0395901_0000006_431995_432462 155
64 iso_pu_bacteria 2738541283 2738754902 159
65 iso_pu_bacteria 2739367663 2739644831 159
66 iso_pu_bacteria 2857627736 2857630691 159
67 3300005468 Ga0070707_100264499 Ga0070707_1002644992 161
68 3300005471 Ga0070698_100012245 Ga0070698_1000122451 161
69 3300005518 Ga0070699_100417601 Ga0070699_1004176012 161
70 3300005577 Ga0068857_100593785 Ga0068857_1005937852 161
71 3300025910 Ga0207684_10061497 Ga0207684_100614972 161
72 3300025922 Ga0207646_10229314 Ga0207646_102293141 161
73 3300026116 Ga0207674_11518529 Ga0207674_115185291 161
74 3300003781 Ga0055536_1000038 Ga0055536_100003830 162
75 3300003791 Ga0055530_10000250 Ga0055530_100002509 162
76 3300025292 Ga0209676_1000201 Ga0209676_100020174 162
77 3300025298 Ga0209050_1000203 Ga0209050_100020374 162
78 3300025937 Ga0207669_10201331 Ga0207669_102013312 162
79 3300005288 Ga0065714_10153132 Ga0065714_101531321 163
80 3300013104 Ga0157370_10028936 Ga0157370_100289362 163
81 3300031507 Ga0307509_10290691 Ga0307509_102906911 163
82 3300048929 Ga0496126_0243036 Ga0496126_0243036_456_947 163
83 3300050510 nmdc:mga06r32_477736_c1 nmdc:mga06r32_477736_c1_66_602 163
84 iso_pu_bacteria 2690316117 2692320329 163
85 iso_pu_bacteria 2847417321 2847424091 163
86 3300005347 Ga0070668_100777105 Ga0070668_1007771051 164
87 3300025972 Ga0207668_10553265 Ga0207668_105532651 164
88 3300046663 Ga0495635_0276274 Ga0495635_0276274_75_575 164
89 iso_pu_bacteria 2597489875 2597812824 164
90 iso_pu_bacteria 2718217882 2719184613 164
91 iso_pu_bacteria 2718218009 2719728633 164
92 iso_pu_bacteria 2718218363 2721144324 164
93 iso_pu_bacteria 2718218365 2721161119 164
94 iso_pu_bacteria 2718218366 2721161694 164
95 iso_pu_bacteria 2721755514 2722842839 164
96 iso_pu_bacteria 2721755810 2724041658 164
97 iso_pu_bacteria 2728369365 2730160728 164
98 iso_pu_bacteria 2728369397 2730301227 164
99 iso_pu_bacteria 2791355260 2793322534 164
100 iso_pu_bacteria 2791355264 2793345502 164
101 iso_pu_bacteria 2791355265 2793356250 164
102 iso_pu_bacteria 2842285085 2842288105 164
103 iso_pu_bacteria 2842402390 2842405371 164
104 iso_pu_bacteria 2842409023 2842411872 164
105 iso_pu_bacteria 2842415677 2842418601 164
106 iso_pu_bacteria 8005301065 8005302099 164
107 iso_pu_bacteria 8005688590 8005692977 164
108 iso_pu_bacteria 2917736166 2917743135 166
109 3300005334 Ga0068869_100282474 Ga0068869_1002824742 168
110 3300005367 Ga0070667_100137866 Ga0070667_1001378662 168
111 3300005367 Ga0070667_100175943 Ga0070667_1001759432 168
112 3300005543 Ga0070672_100036140 Ga0070672_1000361403 168
113 3300005578 Ga0068854_100005658 Ga0068854_1000056588 168
114 3300005614 Ga0068856_100261149 Ga0068856_1002611492 168
115 3300005616 Ga0068852_100000485 Ga0068852_10000048523 168
116 3300005617 Ga0068859_100793807 Ga0068859_1007938073 168
117 3300005843 Ga0068860_100003143 Ga0068860_1000031439 168
118 3300006038 Ga0075365_10625225 Ga0075365_106252251 168
119 3300006042 Ga0075368_10157041 Ga0075368_101570412 168
120 3300006048 Ga0075363_100093700 Ga0075363_1000937003 168
121 3300006051 Ga0075364_10024760 Ga0075364_100247603 168
122 3300006051 Ga0075364_10791662 Ga0075364_107916622 168
123 3300006178 Ga0075367_10170736 Ga0075367_101707362 168
124 3300006186 Ga0075369_10055761 Ga0075369_100557613 168
125 3300006880 Ga0075429_100903667 Ga0075429_1009036672 168
126 3300006931 Ga0097620_100793893 Ga0097620_1007938933 168
127 3300009093 Ga0105240_10743748 Ga0105240_107437481 168
128 3300009545 Ga0105237_10000171 Ga0105237_1000017119 168
129 3300009545 Ga0105237_10081876 Ga0105237_100818762 168
130 3300009551 Ga0105238_10117541 Ga0105238_101175412 168
131 3300009551 Ga0105238_11183947 Ga0105238_111839471 168
132 3300010375 Ga0105239_10000609 Ga0105239_1000060916 168
133 3300010375 Ga0105239_10721929 Ga0105239_107219291 168
134 3300013296 Ga0157374_10000002 Ga0157374_1000000269 168
135 3300013306 Ga0163162_10492740 Ga0163162_104927403 168
136 3300013306 Ga0163162_11121273 Ga0163162_111212732 168
137 3300013307 Ga0157372_10002122 Ga0157372_100021224 168
138 3300013308 Ga0157375_10364733 Ga0157375_103647332 168
139 3300014969 Ga0157376_10020025 Ga0157376_100200254 168
140 3300014969 Ga0157376_10657044 Ga0157376_106570441 168
141 3300025904 Ga0207647_10015333 Ga0207647_100153336 168
142 3300025904 Ga0207647_10071224 Ga0207647_100712242 168
143 3300025910 Ga0207684_10291695 Ga0207684_102916953 168
144 3300025913 Ga0207695_10138611 Ga0207695_101386113 168
145 3300025914 Ga0207671_10008187 Ga0207671_100081873 168
146 3300025914 Ga0207671_10100963 Ga0207671_101009632 168
147 3300025920 Ga0207649_10262680 Ga0207649_102626802 168
148 3300025924 Ga0207694_10006499 Ga0207694_100064999 168
149 3300025924 Ga0207694_10047783 Ga0207694_100477832 168
150 3300025924 Ga0207694_10747272 Ga0207694_107472722 168
151 3300025942 Ga0207689_10281412 Ga0207689_102814122 168
152 3300025949 Ga0207667_10000100 Ga0207667_100001005 168
153 3300025949 Ga0207667_10243283 Ga0207667_102432832 168
154 3300025986 Ga0207658_10301212 Ga0207658_103012122 168
155 3300026041 Ga0207639_10152220 Ga0207639_101522202 168
156 3300026078 Ga0207702_10228561 Ga0207702_102285613 168
157 3300026142 Ga0207698_10000364 Ga0207698_100003647 168
158 3300027866 Ga0209813_10157623 Ga0209813_101576231 168
159 3300028381 Ga0268264_10039507 Ga0268264_100395072 168
160 3300028800 Ga0265338_10046455 Ga0265338_100464553 168
161 3300031090 Ga0265760_10061600 Ga0265760_100616002 168
162 3300031241 Ga0265325_10000245 Ga0265325_1000024513 168
163 3300031241 Ga0265325_10070018 Ga0265325_100700183 168
164 3300031249 Ga0265339_10004214 Ga0265339_100042143 168
165 3300031344 Ga0265316_10037185 Ga0265316_100371852 168
166 3300031903 Ga0307407_10015888 Ga0307407_100158883 168
167 3300031995 Ga0307409_100544679 Ga0307409_1005446792 168
168 3300044735 Ga0466968_0340666 Ga0466968_0340666_101_607 168
169 3300046460 Ga0495638_0002467 Ga0495638_0002467_620_1126 168
170 3300046474 Ga0495605_0053656 Ga0495605_0053656_1068_1574 168
171 3300046519 Ga0495632_0117558 Ga0495632_0117558_109_615 168
172 3300046660 Ga0495625_0004634 Ga0495625_0004634_9347_9853 168
173 3300046664 Ga0495659_0011834 Ga0495659_0011834_341_862 168
174 3300046691 Ga0495670_0000003 Ga0495670_0000003_224195_224704 168
175 3300047318 Ga0495636_0000409 Ga0495636_0000409_8632_9138 168
176 3300047318 Ga0495636_0078444 Ga0495636_0078444_55_576 168
177 3300049592 Ga0501076_0321541 Ga0501076_0321541_91_597 168
178 3300049742 Ga0501080_0321383 Ga0501080_0321383_94_600 168
179 3300050508 nmdc:mga09592_790656_c1 nmdc:mga09592_790656_c1_111_632 168
180 3300053096 Ga0500641_0026933 Ga0500641_0026933_241_753 168
181 3300059508 Ga0587088_029061 Ga0587088_029061_46_561 168
182 3300059639 Ga0587062_017562 Ga0587062_017562_61_573 168
183 3300009176 Ga0105242_10464497 Ga0105242_104644972 169
184 3300048924 Ga0496121_0208364 Ga0496121_0208364_734_1246 169
185 iso_pu_bacteria 2895660088 2895660875 169
186 3300003756 Ga0055533_1000925 Ga0055533_10009253 170
187 3300005344 Ga0070661_100336494 Ga0070661_1003364942 170
188 3300005539 Ga0068853_100084619 Ga0068853_1000846192 170
189 3300010375 Ga0105239_10881940 Ga0105239_108819401 170
190 3300014745 Ga0157377_10923449 Ga0157377_109234491 170
191 3300025226 Ga0209674_100043 Ga0209674_100043182 170
192 3300025914 Ga0207671_10115163 Ga0207671_101151632 170
193 3300025921 Ga0207652_10031856 Ga0207652_100318564 170
194 3300025927 Ga0207687_10853790 Ga0207687_108537901 170
195 3300026121 Ga0207683_10605855 Ga0207683_106058551 170
196 3300035118 Ga0373954_0160106 Ga0373954_0160106_536_1057 170
197 3300035724 Ga0373933_0204715 Ga0373933_0204715_666_1187 170
198 3300036401 Ga0373937_0026449 Ga0373937_0026449_2557_3078 170
199 3300039437 Ga0436365_0404478 Ga0436365_0404478_234_782 170
200 3300046454 Ga0495592_0008964 Ga0495592_0008964_2401_2922 170
201 3300046462 Ga0495651_0032617 Ga0495651_0032617_1796_2317 170
202 3300046463 Ga0495653_0004284 Ga0495653_0004284_4052_4573 170
203 3300046492 Ga0495585_0368363 Ga0495585_0368363_113_628 170
204 3300046511 Ga0495608_0001169 Ga0495608_0001169_3107_3628 170
205 3300046514 Ga0495618_0292129 Ga0495618_0292129_28_549 170
206 3300046516 Ga0495628_0037312 Ga0495628_0037312_544_1065 170
207 3300046529 Ga0495652_0007582 Ga0495652_0007582_1385_1906 170
208 3300046533 Ga0495640_0030441 Ga0495640_0030441_1992_2513 170
209 3300046536 Ga0495587_0001510 Ga0495587_0001510_1021_1542 170
210 3300046543 Ga0495645_0013006 Ga0495645_0013006_5025_5546 170
211 3300046559 Ga0495667_0004483 Ga0495667_0004483_4941_5462 170
212 3300046642 Ga0495634_0118606 Ga0495634_0118606_1157_1678 170
213 3300046675 Ga0495657_0033270 Ga0495657_0033270_1389_1910 170
214 3300046680 Ga0495646_0066361 Ga0495646_0066361_1164_1685 170
215 3300046809 Ga0495600_0033103 Ga0495600_0033103_55_576 170
216 3300047317 Ga0495604_0008918 Ga0495604_0008918_522_1043 170
217 3300047319 Ga0495674_0023778 Ga0495674_0023778_2283_2804 170
218 3300047322 Ga0495680_0020411 Ga0495680_0020411_1421_1942 170
219 3300047471 Ga0495684_0054755 Ga0495684_0054755_54_575 170
220 3300048088 Ga0495602_0046980 Ga0495602_0046980_2969_3490 170
221 3300048911 Ga0496108_0061974 Ga0496108_0061974_1955_2476 170
222 3300053077 Ga0495601_0098876 Ga0495601_0098876_364_885 170
223 3300053085 Ga0495619_0902063 Ga0495619_0902063_30_551 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

24

173

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lwl-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55a from clostridium oremlandii 0.933 4 145
4lwk-assembly2.cif.gz_B crystal structure of methionine sulfoxide reductase u16s from clostridium oremlandii 0.9076 4 149
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9003 6 168
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.8991 1 167
4lwm-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55d from clostridium oremlandii with methionie sulfoxide 0.8969 4 148
ID Description Score Start End Superfamily
4lwkB00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9076 4 149 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9051 1 167 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8999 1 167 3.30.1060.10
af_P0A086_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8939 4 150 3.30.1060.10
af_O02089_1_199_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8895 2 151 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A1G8TXS4-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9533 1 135 GO:0008113
GO:0033744
GO:0036211
AF-A0A524GBY9-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9464 4 139 GO:0008113
GO:0033744
AF-X8BIW2-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9458 2 133 GO:0008113
GO:0033744
GO:0036211
AF-A0A383E8Y5-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9419 5 138 GO:0008113
AF-A0A5P2QT91-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9397 1 113 GO:0008113
GO:0033744

Feature Viewer

pLDDT pTM Quality
84.57 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map