F335560
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 223 | 147 | 224 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10395276|Ga0105242_103952762 |
| Length | 214 |
| Sequence | LDGNRQTVIGNWQSVLKFLRIYFRIVDCRFPTKHNKFQTKIKTLQQVILVNEHDEPIGTMEKMEAHEKGLLHRAFSIFIFNKKGEMLLQQRAADKYHSPNLWTNACCSHPSPDETVEDAAHRRLKEELGFDVSLVKAFNFTYKTAFDNGLTEHEYDHVFTGIYDGAVHPDNKEVKDHRFAEIKNVRTDMLIHSEQYTSWFKIAFPKLEEYLAGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 106 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 107 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 108 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 109 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 110 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 111 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 112 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 113 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 114 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 115 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 116 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 117 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 136 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 137 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 138 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 141 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 147 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.9 |
| Nodule | 0 |
| Rhizoplane | 0.45 |
| Rhizosphere | 93.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10035635 | 3300003316 | Bacteria | 3039 |
| 2 | rootH2_10013635 | 3300003320 | Bacteria | 31266 |
| 3 | rootL2_10007802 | 3300003322 | Bacteria | 13532 |
| 4 | rootL2_10051660 | 3300003322 | Bacteria | 5468 |
| 5 | rootL2_10243796 | 3300003322 | Bacteria | 3042 |
| 6 | rootH1_10003627 | 3300003323 | Bacteria | 3130 |
| 7 | rootH1_10011599 | 3300003316 | Bacteria | 6776 |
| 8 | rootH1_10011599 | 3300003323 | Bacteria | 9596 |
| 9 | rootH1_10050428 | 3300003323 | Bacteria | 6863 |
| 10 | rootH1_10242877 | 3300003323 | Unclassified | 1260 |
| 11 | Ga0065712_10016974 | 3300005290 | Bacteria | 2335 |
| 12 | Ga0065712_10101550 | 3300005290 | Unclassified | 2031 |
| 13 | Ga0065712_10327576 | 3300005290 | Bacteria | 819 |
| 14 | Ga0065715_10000595 | 3300005293 | Bacteria | 9966 |
| 15 | Ga0070670_100065006 | 3300005331 | Bacteria | 3130 |
| 16 | Ga0070670_100106323 | 3300005331 | Unclassified | 2418 |
| 17 | Ga0070670_100187577 | 3300005331 | Bacteria | 1796 |
| 18 | Ga0068868_100389437 | 3300005338 | Bacteria | 1200 |
| 19 | Ga0070689_100123272 | 3300005340 | Bacteria | 2072 |
| 20 | Ga0070687_100027393 | 3300005343 | Bacteria | 2753 |
| 21 | Ga0070668_100192894 | 3300005347 | Bacteria | 1669 |
| 22 | Ga0070669_100010015 | 3300005353 | Bacteria | 6739 |
| 23 | Ga0070669_100739528 | 3300005353 | Unclassified | 833 |
| 24 | Ga0070675_100122362 | 3300005354 | Bacteria | 2211 |
| 25 | Ga0070671_100015427 | 3300005355 | Bacteria | 6172 |
| 26 | Ga0070688_100181708 | 3300005365 | Bacteria | 1460 |
| 27 | Ga0070667_100032027 | 3300005367 | Bacteria | 4384 |
| 28 | Ga0070667_100781199 | 3300005367 | Unclassified | 886 |
| 29 | Ga0070700_100099604 | 3300005441 | Bacteria | 1912 |
| 30 | Ga0070678_100276511 | 3300005456 | Unclassified | 1418 |
| 31 | Ga0068867_100211949 | 3300005459 | Unclassified | 1556 |
| 32 | Ga0070685_10054096 | 3300005466 | Bacteria | 2327 |
| 33 | Ga0068853_100634298 | 3300005539 | Bacteria | 1016 |
| 34 | Ga0070672_100023891 | 3300005543 | Bacteria | 4509 |
| 35 | Ga0070704_100123719 | 3300005549 | Bacteria | 1992 |
| 36 | Ga0068855_100557205 | 3300005563 | Bacteria | 1240 |
| 37 | Ga0070664_100917544 | 3300005564 | Bacteria | 821 |
| 38 | Ga0068857_100318493 | 3300005577 | Bacteria | 1436 |
| 39 | Ga0068854_100119592 | 3300005578 | Bacteria | 1998 |
| 40 | Ga0068852_100114031 | 3300005616 | Bacteria | 2462 |
| 41 | Ga0068852_101300936 | 3300005616 | Bacteria | 749 |
| 42 | Ga0068859_100756565 | 3300005617 | Bacteria | 1060 |
| 43 | Ga0068859_101548638 | 3300005617 | Bacteria | 732 |
| 44 | Ga0068864_100172542 | 3300005618 | Bacteria | 1973 |
| 45 | Ga0068864_100192492 | 3300005618 | Unclassified | 1870 |
| 46 | Ga0068864_100657773 | 3300005618 | Unclassified | 1021 |
| 47 | Ga0068861_100305552 | 3300005719 | Bacteria | 1380 |
| 48 | Ga0068863_100041001 | 3300005841 | Bacteria | 4401 |
| 49 | Ga0068863_100080270 | 3300005841 | Bacteria | 3090 |
| 50 | Ga0068863_100726965 | 3300005841 | Bacteria | 988 |
| 51 | Ga0068858_100415915 | 3300005842 | Bacteria | 1293 |
| 52 | Ga0068860_100002687 | 3300005843 | Bacteria | 18508 |
| 53 | Ga0068860_100025101 | 3300005843 | Bacteria | 5751 |
| 54 | Ga0068860_100512532 | 3300005843 | Bacteria | 1199 |
| 55 | Ga0068862_100311987 | 3300005844 | Unclassified | 1450 |
| 56 | Ga0068862_100422620 | 3300005844 | Bacteria | 1251 |
| 57 | Ga0070715_10164760 | 3300006163 | Bacteria | 1099 |
| 58 | Ga0097621_100000465 | 3300006237 | Bacteria | 28387 |
| 59 | Ga0097621_100488949 | 3300006237 | Bacteria | 1113 |
| 60 | Ga0068871_100001644 | 3300006358 | Bacteria | 15052 |
| 61 | Ga0068871_100132989 | 3300006358 | Bacteria | 2110 |
| 62 | Ga0075428_100158847 | 3300006844 | Bacteria | 2454 |
| 63 | Ga0075428_101046758 | 3300006844 | Bacteria | 863 |
| 64 | Ga0075430_100005505 | 3300006846 | Bacteria | 10697 |
| 65 | Ga0075431_100021879 | 3300006847 | Bacteria | 6537 |
| 66 | Ga0075434_100084958 | 3300006871 | Bacteria | 3164 |
| 67 | Ga0075429_100132079 | 3300006880 | Bacteria | 2184 |
| 68 | Ga0068865_100611491 | 3300006881 | Bacteria | 922 |
| 69 | Ga0068865_100719266 | 3300006881 | Bacteria | 855 |
| 70 | Ga0097620_100756578 | 3300006931 | Bacteria | 1060 |
| 71 | Ga0097620_101548130 | 3300006931 | Bacteria | 732 |
| 72 | Ga0105240_10000198 | 3300009093 | Bacteria | 122388 |
| 73 | Ga0111539_10041368 | 3300009094 | Bacteria | 5541 |
| 74 | Ga0111539_11439793 | 3300009094 | Bacteria | 799 |
| 75 | Ga0114129_10072555 | 3300009147 | Bacteria | 4798 |
| 76 | Ga0105241_10009669 | 3300009174 | Bacteria | 7087 |
| 77 | Ga0105241_10322233 | 3300009174 | Bacteria | 1333 |
| 78 | Ga0105242_10047157 | 3300009176 | Bacteria | 3498 |
| 79 | Ga0105242_10062413 | 3300009176 | Bacteria | 3066 |
| 80 | Ga0105242_10089475 | 3300009176 | Bacteria | 2588 |
| 81 | Ga0105242_10384348 | 3300009176 | Unclassified | 1306 |
| 82 | Ga0105242_10395276 | 3300009176 | Bacteria | 1288 |
| 83 | Ga0105237_10005617 | 3300009545 | Bacteria | 14137 |
| 84 | Ga0105238_10007301 | 3300009551 | Bacteria | 11064 |
| 85 | Ga0105249_10024612 | 3300009553 | Bacteria | 5411 |
| 86 | Ga0105249_10079009 | 3300009553 | Unclassified | 3053 |
| 87 | Ga0105249_10640602 | 3300009553 | Bacteria | 1120 |
| 88 | Ga0105239_10018886 | 3300010375 | Bacteria | 7616 |
| 89 | Ga0105239_10207917 | 3300010375 | Bacteria | 2193 |
| 90 | Ga0105246_10614855 | 3300011119 | Bacteria | 941 |
| 91 | Ga0157371_10229573 | 3300013102 | Bacteria | 1334 |
| 92 | Ga0157371_10385299 | 3300013102 | Bacteria | 1024 |
| 93 | Ga0157370_10177420 | 3300013104 | Unclassified | 1980 |
| 94 | Ga0157374_10155033 | 3300013296 | Unclassified | 2229 |
| 95 | Ga0157378_10063074 | 3300013297 | Unclassified | 3310 |
| 96 | Ga0157378_10209824 | 3300013297 | Unclassified | 1846 |
| 97 | Ga0157378_10515786 | 3300013297 | Bacteria | 1196 |
| 98 | Ga0163162_10000782 | 3300013306 | Bacteria | 29601 |
| 99 | Ga0163162_10070237 | 3300013306 | Unclassified | 3553 |
| 100 | Ga0163162_10367560 | 3300013306 | Bacteria | 1571 |
| 101 | Ga0163162_10645396 | 3300013306 | Bacteria | 1182 |
| 102 | Ga0157372_10006597 | 3300013307 | Bacteria | 12351 |
| 103 | Ga0157372_10127461 | 3300013307 | Unclassified | 2926 |
| 104 | Ga0157375_10000911 | 3300013308 | Bacteria | 25700 |
| 105 | Ga0163163_10000215 | 3300014325 | Bacteria | 60028 |
| 106 | Ga0163163_10137152 | 3300014325 | Bacteria | 2488 |
| 107 | Ga0157380_10002513 | 3300014326 | Bacteria | 12359 |
| 108 | Ga0157380_10039065 | 3300014326 | Bacteria | 3689 |
| 109 | Ga0157380_10055466 | 3300014326 | Bacteria | 3147 |
| 110 | Ga0157380_10200778 | 3300014326 | Bacteria | 1769 |
| 111 | Ga0157380_10226468 | 3300014326 | Unclassified | 1676 |
| 112 | Ga0157377_10027383 | 3300014745 | Bacteria | 3060 |
| 113 | Ga0157377_10408444 | 3300014745 | Bacteria | 927 |
| 114 | Ga0157379_10044598 | 3300014968 | Unclassified | 3958 |
| 115 | Ga0157379_10135525 | 3300014968 | Bacteria | 2218 |
| 116 | Ga0157376_10000958 | 3300014969 | Bacteria | 18796 |
| 117 | Ga0157376_10060713 | 3300014969 | Bacteria | 3176 |
| 118 | Ga0163161_10000224 | 3300017792 | Bacteria | 51786 |
| 119 | Ga0163161_10015479 | 3300017792 | Bacteria | 5318 |
| 120 | Ga0163161_10015639 | 3300017792 | Bacteria | 5292 |
| 121 | Ga0163161_10026514 | 3300017792 | Bacteria | 4104 |
| 122 | Ga0163161_10078825 | 3300017792 | Bacteria | 2421 |
| 123 | Ga0207654_10055947 | 3300025911 | Bacteria | 2287 |
| 124 | Ga0207695_10000346 | 3300025913 | Bacteria | 107028 |
| 125 | Ga0207671_10002977 | 3300025914 | Bacteria | 17383 |
| 126 | Ga0207662_10222368 | 3300025918 | Bacteria | 1230 |
| 127 | Ga0207681_10066446 | 3300025923 | Bacteria | 2496 |
| 128 | Ga0207650_10027230 | 3300025925 | Bacteria | 4090 |
| 129 | Ga0207650_10084147 | 3300025925 | Unclassified | 2418 |
| 130 | Ga0207659_10040732 | 3300025926 | Bacteria | 3250 |
| 131 | Ga0207644_10011068 | 3300025931 | Bacteria | 5959 |
| 132 | Ga0207686_10010705 | 3300025934 | Bacteria | 4996 |
| 133 | Ga0207670_10002843 | 3300025936 | Bacteria | 9138 |
| 134 | Ga0207670_10782925 | 3300025936 | Bacteria | 794 |
| 135 | Ga0207669_10009106 | 3300025937 | Bacteria | 4709 |
| 136 | Ga0207704_10031438 | 3300025938 | Bacteria | 2991 |
| 137 | Ga0207704_10498731 | 3300025938 | Bacteria | 981 |
| 138 | Ga0207691_10115607 | 3300025940 | Bacteria | 2382 |
| 139 | Ga0207689_10032978 | 3300025942 | Bacteria | 4305 |
| 140 | Ga0207689_10916398 | 3300025942 | Unclassified | 739 |
| 141 | Ga0207679_11080807 | 3300025945 | Bacteria | 736 |
| 142 | Ga0207651_10170124 | 3300025960 | Bacteria | 1717 |
| 143 | Ga0207712_10033032 | 3300025961 | Bacteria | 3496 |
| 144 | Ga0207712_10359992 | 3300025961 | Bacteria | 1212 |
| 145 | Ga0207712_10559004 | 3300025961 | Bacteria | 985 |
| 146 | Ga0207658_10020983 | 3300025986 | Unclassified | 4529 |
| 147 | Ga0207677_10185735 | 3300026023 | Bacteria | 1639 |
| 148 | Ga0207639_10313546 | 3300026041 | Bacteria | 1390 |
| 149 | Ga0207639_10892323 | 3300026041 | Bacteria | 831 |
| 150 | Ga0207708_10112997 | 3300026075 | Bacteria | 2110 |
| 151 | Ga0207708_10671026 | 3300026075 | Bacteria | 884 |
| 152 | Ga0207702_10520111 | 3300026078 | Unclassified | 1162 |
| 153 | Ga0207641_10000111 | 3300026088 | Bacteria | 120527 |
| 154 | Ga0207641_10026788 | 3300026088 | Bacteria | 4759 |
| 155 | Ga0207641_10231983 | 3300026088 | Bacteria | 1716 |
| 156 | Ga0207641_10289978 | 3300026088 | Unclassified | 1542 |
| 157 | Ga0207641_10666295 | 3300026088 | Unclassified | 1023 |
| 158 | Ga0207648_10185966 | 3300026089 | Bacteria | 1840 |
| 159 | Ga0207676_10029483 | 3300026095 | Bacteria | 4110 |
| 160 | Ga0207676_10031248 | 3300026095 | Bacteria | 4004 |
| 161 | Ga0207676_10058271 | 3300026095 | Bacteria | 3046 |
| 162 | Ga0207676_10098012 | 3300026095 | Unclassified | 2423 |
| 163 | Ga0207676_10118463 | 3300026095 | Bacteria | 2228 |
| 164 | Ga0207674_10272168 | 3300026116 | Bacteria | 1641 |
| 165 | Ga0207674_10396571 | 3300026116 | Bacteria | 1334 |
| 166 | Ga0207675_100095902 | 3300026118 | Bacteria | 2792 |
| 167 | Ga0207683_10131739 | 3300026121 | Unclassified | 2249 |
| 168 | Ga0207698_10081677 | 3300026142 | Bacteria | 2610 |
| 169 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 170 | Ga0268265_10085943 | 3300028380 | Bacteria | 2498 |
| 171 | Ga0268264_10003294 | 3300028381 | Bacteria | 13957 |
| 172 | Ga0268264_10009386 | 3300028381 | Bacteria | 8099 |
| 173 | Ga0268264_10226467 | 3300028381 | Bacteria | 1724 |
| 174 | Ga0268264_10276720 | 3300028381 | Bacteria | 1570 |
| 175 | Ga0307509_10353776 | 3300031507 | Bacteria | 1191 |
| 176 | Ga0307408_100002945 | 3300031548 | Bacteria | 11795 |
| 177 | Ga0307408_100005195 | 3300031548 | Bacteria | 8727 |
| 178 | Ga0307409_100541780 | 3300031995 | Bacteria | 1141 |
| 179 | Ga0307416_100108728 | 3300032002 | Bacteria | 2437 |
| 180 | Ga0316574_0196704 | 3300035398 | Bacteria | 1296 |
| 181 | Ga0316584_0309005 | 3300036712 | Bacteria | 1143 |
| 182 | Ga0436365_1899890 | 3300039437 | Bacteria | 879 |
| 183 | Ga0451802_1785986 | 3300041460 | Bacteria | 860 |
| 184 | Ga0451853_2716109 | 3300041512 | Bacteria | 782 |
| 185 | Ga0439431_0001199 | 3300041997 | Bacteria | 5681 |
| 186 | Ga0439445_0009239 | 3300042004 | Bacteria | 2320 |
| 187 | Ga0451577_0097314 | 3300042876 | Unclassified | 2628 |
| 188 | Ga0453683_0101742 | 3300044673 | Unclassified | 1804 |
| 189 | Ga0466965_0244004 | 3300044683 | Bacteria | 962 |
| 190 | Ga0453684_0158510 | 3300044712 | Unclassified | 2680 |
| 191 | Ga0451576_0003687 | 3300045051 | Bacteria | 20777 |
| 192 | Ga0495638_0147439 | 3300046460 | Bacteria | 1368 |
| 193 | Ga0495594_0116487 | 3300046499 | Bacteria | 1509 |
| 194 | Ga0495610_0002019 | 3300046512 | Bacteria | 17362 |
| 195 | Ga0495621_0099176 | 3300046539 | Unclassified | 1107 |
| 196 | Ga0495658_0189361 | 3300046683 | Unclassified | 1279 |
| 197 | Ga0495600_0500474 | 3300046809 | Bacteria | 747 |
| 198 | Ga0495636_0484687 | 3300047318 | Unclassified | 597 |
| 199 | Ga0495672_0032233 | 3300047320 | Bacteria | 3263 |
| 200 | Ga0495676_0224012 | 3300047321 | Bacteria | 1295 |
| 201 | Ga0501031_0405336 | 3300049568 | Unclassified | 882 |
| 202 | Ga0501032_0087782 | 3300049569 | Bacteria | 2065 |
| 203 | Ga0501033_0011190 | 3300049570 | Bacteria | 6873 |
| 204 | Ga0501034_0002811 | 3300049571 | Bacteria | 20358 |
| 205 | Ga0501036_0324215 | 3300049572 | Unclassified | 1287 |
| 206 | Ga0501037_0040768 | 3300049573 | Bacteria | 3416 |
| 207 | Ga0501039_0044073 | 3300049575 | Bacteria | 3445 |
| 208 | Ga0501043_0017830 | 3300049579 | Bacteria | 5566 |
| 209 | Ga0501043_0020117 | 3300049579 | Bacteria | 5238 |
| 210 | Ga0501047_0751066 | 3300049581 | Bacteria | 791 |
| 211 | Ga0501243_009959 | 3300049675 | Bacteria | 1480 |
| 212 | Ga0501219_000110 | 3300049703 | Bacteria | 14324 |
| 213 | Ga0501225_0021770 | 3300049705 | Bacteria | 1770 |
| 214 | Ga0501035_0096479 | 3300049822 | Bacteria | 2598 |
| 215 | Ga0501035_0121919 | 3300049822 | Bacteria | 2278 |
| 216 | Ga0501044_0028603 | 3300049823 | Bacteria | 5883 |
| 217 | Ga0501284_00054 | 3300050005 | Bacteria | 42687 |
| 218 | nmdc:mga05p37_385602_c1 | 3300050507 | Unclassified | 1640 |
| 219 | nmdc:mga09592_243747_c1 | 3300050508 | Unclassified | 1558 |
| 220 | nmdc:mga0qj67_82018_c1 | 3300050509 | Bacteria | 2586 |
| 221 | nmdc:mga08y16_1188365_c1 | 3300050511 | Unclassified | 734 |
| 222 | nmdc:mga0n895_26949_c1 | 3300050512 | Bacteria | 5452 |
| 223 | Ga0500616_0003349 | 3300053153 | Bacteria | 12329 |
| 224 | Ga0500611_000155 | 3300053727 | Bacteria | 10865 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003320 | rootH2_10013635 | rootH2_100136352 | 164 |
| 2 | 3300003322 | rootL2_10051660 | rootL2_100516605 | 164 |
| 3 | 3300003323 | rootH1_10011599 | rootH1_1001159912 | 164 |
| 4 | 3300011119 | Ga0105246_10614855 | Ga0105246_106148552 | 165 |
| 5 | 3300003322 | rootL2_10243796 | rootL2_102437963 | 166 |
| 6 | 3300042876 | Ga0451577_0097314 | Ga0451577_0097314_961_1482 | 166 |
| 7 | 3300044673 | Ga0453683_0101742 | Ga0453683_0101742_378_899 | 166 |
| 8 | 3300044712 | Ga0453684_0158510 | Ga0453684_0158510_1796_2317 | 166 |
| 9 | 3300045051 | Ga0451576_0003687 | Ga0451576_0003687_15878_16399 | 166 |
| 10 | 3300005844 | Ga0068862_100422620 | Ga0068862_1004226202 | 169 |
| 11 | 3300005331 | Ga0070670_100065006 | Ga0070670_1000650063 | 170 |
| 12 | 3300005347 | Ga0070668_100192894 | Ga0070668_1001928942 | 170 |
| 13 | 3300005353 | Ga0070669_100739528 | Ga0070669_1007395281 | 170 |
| 14 | 3300005578 | Ga0068854_100119592 | Ga0068854_1001195923 | 170 |
| 15 | 3300005617 | Ga0068859_101548638 | Ga0068859_1015486381 | 170 |
| 16 | 3300005618 | Ga0068864_100657773 | Ga0068864_1006577732 | 170 |
| 17 | 3300005843 | Ga0068860_100002687 | Ga0068860_10000268718 | 170 |
| 18 | 3300005843 | Ga0068860_100025101 | Ga0068860_1000251015 | 170 |
| 19 | 3300006931 | Ga0097620_101548130 | Ga0097620_1015481302 | 170 |
| 20 | 3300013297 | Ga0157378_10515786 | Ga0157378_105157862 | 170 |
| 21 | 3300025925 | Ga0207650_10027230 | Ga0207650_100272303 | 170 |
| 22 | 3300025942 | Ga0207689_10916398 | Ga0207689_109163981 | 170 |
| 23 | 3300025961 | Ga0207712_10359992 | Ga0207712_103599921 | 170 |
| 24 | 3300026088 | Ga0207641_10666295 | Ga0207641_106662952 | 170 |
| 25 | 3300026095 | Ga0207676_10031248 | Ga0207676_100312482 | 170 |
| 26 | 3300028380 | Ga0268265_10085943 | Ga0268265_100859432 | 170 |
| 27 | 3300028381 | Ga0268264_10003294 | Ga0268264_100032945 | 170 |
| 28 | 3300028381 | Ga0268264_10009386 | Ga0268264_100093866 | 170 |
| 29 | 3300003316 | rootH1_10035635 | rootH1_100356352 | 171 |
| 30 | 3300003322 | rootL2_10007802 | rootL2_100078027 | 171 |
| 31 | 3300003323 | rootH1_10003627 | rootH1_100036274 | 171 |
| 32 | 3300003323 | rootH1_10050428 | rootH1_100504284 | 171 |
| 33 | 3300003323 | rootH1_10242877 | rootH1_102428772 | 171 |
| 34 | 3300005290 | Ga0065712_10016974 | Ga0065712_100169743 | 171 |
| 35 | 3300005290 | Ga0065712_10101550 | Ga0065712_101015503 | 171 |
| 36 | 3300005290 | Ga0065712_10327576 | Ga0065712_103275762 | 171 |
| 37 | 3300005293 | Ga0065715_10000595 | Ga0065715_100005952 | 171 |
| 38 | 3300005331 | Ga0070670_100106323 | Ga0070670_1001063232 | 171 |
| 39 | 3300005331 | Ga0070670_100187577 | Ga0070670_1001875772 | 171 |
| 40 | 3300005338 | Ga0068868_100389437 | Ga0068868_1003894372 | 171 |
| 41 | 3300005340 | Ga0070689_100123272 | Ga0070689_1001232722 | 171 |
| 42 | 3300005343 | Ga0070687_100027393 | Ga0070687_1000273932 | 171 |
| 43 | 3300005353 | Ga0070669_100010015 | Ga0070669_1000100156 | 171 |
| 44 | 3300005354 | Ga0070675_100122362 | Ga0070675_1001223623 | 171 |
| 45 | 3300005355 | Ga0070671_100015427 | Ga0070671_1000154277 | 171 |
| 46 | 3300005365 | Ga0070688_100181708 | Ga0070688_1001817083 | 171 |
| 47 | 3300005367 | Ga0070667_100032027 | Ga0070667_1000320273 | 171 |
| 48 | 3300005367 | Ga0070667_100781199 | Ga0070667_1007811991 | 171 |
| 49 | 3300005441 | Ga0070700_100099604 | Ga0070700_1000996043 | 171 |
| 50 | 3300005456 | Ga0070678_100276511 | Ga0070678_1002765112 | 171 |
| 51 | 3300005459 | Ga0068867_100211949 | Ga0068867_1002119492 | 171 |
| 52 | 3300005466 | Ga0070685_10054096 | Ga0070685_100540963 | 171 |
| 53 | 3300005539 | Ga0068853_100634298 | Ga0068853_1006342982 | 171 |
| 54 | 3300005543 | Ga0070672_100023891 | Ga0070672_1000238915 | 171 |
| 55 | 3300005549 | Ga0070704_100123719 | Ga0070704_1001237192 | 171 |
| 56 | 3300005563 | Ga0068855_100557205 | Ga0068855_1005572052 | 171 |
| 57 | 3300005564 | Ga0070664_100917544 | Ga0070664_1009175441 | 171 |
| 58 | 3300005577 | Ga0068857_100318493 | Ga0068857_1003184932 | 171 |
| 59 | 3300005616 | Ga0068852_100114031 | Ga0068852_1001140313 | 171 |
| 60 | 3300005616 | Ga0068852_101300936 | Ga0068852_1013009361 | 171 |
| 61 | 3300005617 | Ga0068859_100756565 | Ga0068859_1007565651 | 171 |
| 62 | 3300005618 | Ga0068864_100172542 | Ga0068864_1001725422 | 171 |
| 63 | 3300005618 | Ga0068864_100192492 | Ga0068864_1001924922 | 171 |
| 64 | 3300005719 | Ga0068861_100305552 | Ga0068861_1003055522 | 171 |
| 65 | 3300005841 | Ga0068863_100041001 | Ga0068863_1000410014 | 171 |
| 66 | 3300005841 | Ga0068863_100080270 | Ga0068863_1000802703 | 171 |
| 67 | 3300005841 | Ga0068863_100726965 | Ga0068863_1007269652 | 171 |
| 68 | 3300005842 | Ga0068858_100415915 | Ga0068858_1004159152 | 171 |
| 69 | 3300005843 | Ga0068860_100512532 | Ga0068860_1005125322 | 171 |
| 70 | 3300005844 | Ga0068862_100311987 | Ga0068862_1003119871 | 171 |
| 71 | 3300006163 | Ga0070715_10164760 | Ga0070715_101647602 | 171 |
| 72 | 3300006237 | Ga0097621_100000465 | Ga0097621_10000046513 | 171 |
| 73 | 3300006237 | Ga0097621_100488949 | Ga0097621_1004889492 | 171 |
| 74 | 3300006358 | Ga0068871_100001644 | Ga0068871_10000164413 | 171 |
| 75 | 3300006358 | Ga0068871_100132989 | Ga0068871_1001329893 | 171 |
| 76 | 3300006844 | Ga0075428_100158847 | Ga0075428_1001588473 | 171 |
| 77 | 3300006844 | Ga0075428_101046758 | Ga0075428_1010467581 | 171 |
| 78 | 3300006846 | Ga0075430_100005505 | Ga0075430_10000550510 | 171 |
| 79 | 3300006847 | Ga0075431_100021879 | Ga0075431_1000218795 | 171 |
| 80 | 3300006871 | Ga0075434_100084958 | Ga0075434_1000849584 | 171 |
| 81 | 3300006880 | Ga0075429_100132079 | Ga0075429_1001320793 | 171 |
| 82 | 3300006881 | Ga0068865_100611491 | Ga0068865_1006114912 | 171 |
| 83 | 3300006881 | Ga0068865_100719266 | Ga0068865_1007192661 | 171 |
| 84 | 3300006931 | Ga0097620_100756578 | Ga0097620_1007565782 | 171 |
| 85 | 3300009093 | Ga0105240_10000198 | Ga0105240_1000019847 | 171 |
| 86 | 3300009094 | Ga0111539_10041368 | Ga0111539_100413686 | 171 |
| 87 | 3300009094 | Ga0111539_11439793 | Ga0111539_114397932 | 171 |
| 88 | 3300009147 | Ga0114129_10072555 | Ga0114129_100725556 | 171 |
| 89 | 3300009174 | Ga0105241_10009669 | Ga0105241_100096696 | 171 |
| 90 | 3300009174 | Ga0105241_10322233 | Ga0105241_103222332 | 171 |
| 91 | 3300009176 | Ga0105242_10047157 | Ga0105242_100471571 | 171 |
| 92 | 3300009176 | Ga0105242_10062413 | Ga0105242_100624132 | 171 |
| 93 | 3300009176 | Ga0105242_10089475 | Ga0105242_100894753 | 171 |
| 94 | 3300009176 | Ga0105242_10384348 | Ga0105242_103843482 | 171 |
| 95 | 3300009176 | Ga0105242_10395276 | Ga0105242_103952762 | 171 |
| 96 | 3300009545 | Ga0105237_10005617 | Ga0105237_100056177 | 171 |
| 97 | 3300009551 | Ga0105238_10007301 | Ga0105238_1000730110 | 171 |
| 98 | 3300009553 | Ga0105249_10024612 | Ga0105249_100246123 | 171 |
| 99 | 3300009553 | Ga0105249_10079009 | Ga0105249_100790094 | 171 |
| 100 | 3300009553 | Ga0105249_10640602 | Ga0105249_106406022 | 171 |
| 101 | 3300010375 | Ga0105239_10018886 | Ga0105239_100188867 | 171 |
| 102 | 3300010375 | Ga0105239_10207917 | Ga0105239_102079172 | 171 |
| 103 | 3300013102 | Ga0157371_10229573 | Ga0157371_102295734 | 171 |
| 104 | 3300013102 | Ga0157371_10385299 | Ga0157371_103852992 | 171 |
| 105 | 3300013104 | Ga0157370_10177420 | Ga0157370_101774201 | 171 |
| 106 | 3300013296 | Ga0157374_10155033 | Ga0157374_101550332 | 171 |
| 107 | 3300013297 | Ga0157378_10063074 | Ga0157378_100630743 | 171 |
| 108 | 3300013297 | Ga0157378_10209824 | Ga0157378_102098242 | 171 |
| 109 | 3300013306 | Ga0163162_10000782 | Ga0163162_1000078213 | 171 |
| 110 | 3300013306 | Ga0163162_10070237 | Ga0163162_100702372 | 171 |
| 111 | 3300013306 | Ga0163162_10367560 | Ga0163162_103675602 | 171 |
| 112 | 3300013306 | Ga0163162_10645396 | Ga0163162_106453962 | 171 |
| 113 | 3300013307 | Ga0157372_10006597 | Ga0157372_100065979 | 171 |
| 114 | 3300013307 | Ga0157372_10127461 | Ga0157372_101274614 | 171 |
| 115 | 3300013308 | Ga0157375_10000911 | Ga0157375_100009117 | 171 |
| 116 | 3300014325 | Ga0163163_10000215 | Ga0163163_100002156 | 171 |
| 117 | 3300014325 | Ga0163163_10137152 | Ga0163163_101371522 | 171 |
| 118 | 3300014326 | Ga0157380_10002513 | Ga0157380_100025138 | 171 |
| 119 | 3300014326 | Ga0157380_10039065 | Ga0157380_100390653 | 171 |
| 120 | 3300014326 | Ga0157380_10055466 | Ga0157380_100554662 | 171 |
| 121 | 3300014326 | Ga0157380_10200778 | Ga0157380_102007782 | 171 |
| 122 | 3300014326 | Ga0157380_10226468 | Ga0157380_102264682 | 171 |
| 123 | 3300014745 | Ga0157377_10027383 | Ga0157377_100273831 | 171 |
| 124 | 3300014745 | Ga0157377_10408444 | Ga0157377_104084442 | 171 |
| 125 | 3300014968 | Ga0157379_10044598 | Ga0157379_100445984 | 171 |
| 126 | 3300014968 | Ga0157379_10135525 | Ga0157379_101355252 | 171 |
| 127 | 3300014969 | Ga0157376_10000958 | Ga0157376_1000095818 | 171 |
| 128 | 3300014969 | Ga0157376_10060713 | Ga0157376_100607132 | 171 |
| 129 | 3300017792 | Ga0163161_10000224 | Ga0163161_1000022423 | 171 |
| 130 | 3300017792 | Ga0163161_10015479 | Ga0163161_100154795 | 171 |
| 131 | 3300017792 | Ga0163161_10015639 | Ga0163161_100156391 | 171 |
| 132 | 3300017792 | Ga0163161_10026514 | Ga0163161_100265142 | 171 |
| 133 | 3300017792 | Ga0163161_10078825 | Ga0163161_100788252 | 171 |
| 134 | 3300025911 | Ga0207654_10055947 | Ga0207654_100559473 | 171 |
| 135 | 3300025913 | Ga0207695_10000346 | Ga0207695_1000034645 | 171 |
| 136 | 3300025914 | Ga0207671_10002977 | Ga0207671_1000297712 | 171 |
| 137 | 3300025918 | Ga0207662_10222368 | Ga0207662_102223682 | 171 |
| 138 | 3300025923 | Ga0207681_10066446 | Ga0207681_100664463 | 171 |
| 139 | 3300025925 | Ga0207650_10084147 | Ga0207650_100841472 | 171 |
| 140 | 3300025926 | Ga0207659_10040732 | Ga0207659_100407323 | 171 |
| 141 | 3300025931 | Ga0207644_10011068 | Ga0207644_100110686 | 171 |
| 142 | 3300025934 | Ga0207686_10010705 | Ga0207686_100107052 | 171 |
| 143 | 3300025936 | Ga0207670_10002843 | Ga0207670_100028432 | 171 |
| 144 | 3300025936 | Ga0207670_10782925 | Ga0207670_107829251 | 171 |
| 145 | 3300025937 | Ga0207669_10009106 | Ga0207669_100091062 | 171 |
| 146 | 3300025938 | Ga0207704_10031438 | Ga0207704_100314383 | 171 |
| 147 | 3300025938 | Ga0207704_10498731 | Ga0207704_104987311 | 171 |
| 148 | 3300025940 | Ga0207691_10115607 | Ga0207691_101156072 | 171 |
| 149 | 3300025942 | Ga0207689_10032978 | Ga0207689_100329783 | 171 |
| 150 | 3300025945 | Ga0207679_11080807 | Ga0207679_110808071 | 171 |
| 151 | 3300025960 | Ga0207651_10170124 | Ga0207651_101701242 | 171 |
| 152 | 3300025961 | Ga0207712_10033032 | Ga0207712_100330322 | 171 |
| 153 | 3300025961 | Ga0207712_10559004 | Ga0207712_105590042 | 171 |
| 154 | 3300025986 | Ga0207658_10020983 | Ga0207658_100209833 | 171 |
| 155 | 3300026023 | Ga0207677_10185735 | Ga0207677_101857352 | 171 |
| 156 | 3300026041 | Ga0207639_10313546 | Ga0207639_103135462 | 171 |
| 157 | 3300026041 | Ga0207639_10892323 | Ga0207639_108923231 | 171 |
| 158 | 3300026075 | Ga0207708_10112997 | Ga0207708_101129971 | 171 |
| 159 | 3300026075 | Ga0207708_10671026 | Ga0207708_106710261 | 171 |
| 160 | 3300026078 | Ga0207702_10520111 | Ga0207702_105201112 | 171 |
| 161 | 3300026088 | Ga0207641_10000111 | Ga0207641_1000011124 | 171 |
| 162 | 3300026088 | Ga0207641_10026788 | Ga0207641_100267883 | 171 |
| 163 | 3300026088 | Ga0207641_10231983 | Ga0207641_102319833 | 171 |
| 164 | 3300026088 | Ga0207641_10289978 | Ga0207641_102899782 | 171 |
| 165 | 3300026089 | Ga0207648_10185966 | Ga0207648_101859662 | 171 |
| 166 | 3300026095 | Ga0207676_10029483 | Ga0207676_100294833 | 171 |
| 167 | 3300026095 | Ga0207676_10058271 | Ga0207676_100582712 | 171 |
| 168 | 3300026095 | Ga0207676_10098012 | Ga0207676_100980123 | 171 |
| 169 | 3300026095 | Ga0207676_10118463 | Ga0207676_101184632 | 171 |
| 170 | 3300026116 | Ga0207674_10272168 | Ga0207674_102721682 | 171 |
| 171 | 3300026116 | Ga0207674_10396571 | Ga0207674_103965712 | 171 |
| 172 | 3300026118 | Ga0207675_100095902 | Ga0207675_1000959023 | 171 |
| 173 | 3300026121 | Ga0207683_10131739 | Ga0207683_101317392 | 171 |
| 174 | 3300026142 | Ga0207698_10081677 | Ga0207698_100816773 | 171 |
| 175 | 3300028379 | Ga0268266_10000068 | Ga0268266_1000006870 | 171 |
| 176 | 3300028381 | Ga0268264_10226467 | Ga0268264_102264672 | 171 |
| 177 | 3300028381 | Ga0268264_10276720 | Ga0268264_102767203 | 171 |
| 178 | 3300031507 | Ga0307509_10353776 | Ga0307509_103537762 | 171 |
| 179 | 3300031548 | Ga0307408_100002945 | Ga0307408_1000029458 | 171 |
| 180 | 3300031548 | Ga0307408_100005195 | Ga0307408_1000051956 | 171 |
| 181 | 3300031995 | Ga0307409_100541780 | Ga0307409_1005417802 | 171 |
| 182 | 3300032002 | Ga0307416_100108728 | Ga0307416_1001087283 | 171 |
| 183 | 3300035398 | Ga0316574_0196704 | Ga0316574_0196704_454_972 | 171 |
| 184 | 3300036712 | Ga0316584_0309005 | Ga0316584_0309005_233_751 | 171 |
| 185 | 3300039437 | Ga0436365_1899890 | Ga0436365_1899890_321_863 | 171 |
| 186 | 3300041460 | Ga0451802_1785986 | Ga0451802_1785986_123_662 | 171 |
| 187 | 3300041512 | Ga0451853_2716109 | Ga0451853_2716109_116_661 | 171 |
| 188 | 3300041997 | Ga0439431_0001199 | Ga0439431_0001199_1808_2353 | 171 |
| 189 | 3300042004 | Ga0439445_0009239 | Ga0439445_0009239_43_588 | 171 |
| 190 | 3300044683 | Ga0466965_0244004 | Ga0466965_0244004_40_585 | 171 |
| 191 | 3300046460 | Ga0495638_0147439 | Ga0495638_0147439_730_1257 | 171 |
| 192 | 3300046499 | Ga0495594_0116487 | Ga0495594_0116487_57_605 | 171 |
| 193 | 3300046512 | Ga0495610_0002019 | Ga0495610_0002019_1922_2464 | 171 |
| 194 | 3300046539 | Ga0495621_0099176 | Ga0495621_0099176_108_659 | 171 |
| 195 | 3300046683 | Ga0495658_0189361 | Ga0495658_0189361_708_1256 | 171 |
| 196 | 3300046809 | Ga0495600_0500474 | Ga0495600_0500474_79_627 | 171 |
| 197 | 3300047318 | Ga0495636_0484687 | Ga0495636_0484687_19_570 | 171 |
| 198 | 3300047320 | Ga0495672_0032233 | Ga0495672_0032233_1006_1533 | 171 |
| 199 | 3300047321 | Ga0495676_0224012 | Ga0495676_0224012_341_889 | 171 |
| 200 | 3300049568 | Ga0501031_0405336 | Ga0501031_0405336_45_572 | 171 |
| 201 | 3300049569 | Ga0501032_0087782 | Ga0501032_0087782_652_1179 | 171 |
| 202 | 3300049570 | Ga0501033_0011190 | Ga0501033_0011190_1856_2383 | 171 |
| 203 | 3300049571 | Ga0501034_0002811 | Ga0501034_0002811_11176_11703 | 171 |
| 204 | 3300049572 | Ga0501036_0324215 | Ga0501036_0324215_114_641 | 171 |
| 205 | 3300049573 | Ga0501037_0040768 | Ga0501037_0040768_2298_2825 | 171 |
| 206 | 3300049575 | Ga0501039_0044073 | Ga0501039_0044073_133_660 | 171 |
| 207 | 3300049579 | Ga0501043_0017830 | Ga0501043_0017830_1008_1535 | 171 |
| 208 | 3300049579 | Ga0501043_0020117 | Ga0501043_0020117_509_1063 | 171 |
| 209 | 3300049581 | Ga0501047_0751066 | Ga0501047_0751066_200_727 | 171 |
| 210 | 3300049675 | Ga0501243_009959 | Ga0501243_009959_393_923 | 171 |
| 211 | 3300049703 | Ga0501219_000110 | Ga0501219_000110_2701_3246 | 171 |
| 212 | 3300049705 | Ga0501225_0021770 | Ga0501225_0021770_1143_1688 | 171 |
| 213 | 3300049822 | Ga0501035_0096479 | Ga0501035_0096479_1956_2477 | 171 |
| 214 | 3300049822 | Ga0501035_0121919 | Ga0501035_0121919_1326_1853 | 171 |
| 215 | 3300049823 | Ga0501044_0028603 | Ga0501044_0028603_5095_5622 | 171 |
| 216 | 3300050005 | Ga0501284_00054 | Ga0501284_00054_39800_40345 | 171 |
| 217 | 3300050507 | nmdc:mga05p37_385602_c1 | nmdc:mga05p37_385602_c1_125_676 | 171 |
| 218 | 3300050508 | nmdc:mga09592_243747_c1 | nmdc:mga09592_243747_c1_857_1408 | 171 |
| 219 | 3300050509 | nmdc:mga0qj67_82018_c1 | nmdc:mga0qj67_82018_c1_1596_2147 | 171 |
| 220 | 3300050511 | nmdc:mga08y16_1188365_c1 | nmdc:mga08y16_1188365_c1_77_625 | 171 |
| 221 | 3300050512 | nmdc:mga0n895_26949_c1 | nmdc:mga0n895_26949_c1_4725_5258 | 171 |
| 222 | 3300053153 | Ga0500616_0003349 | Ga0500616_0003349_4267_4818 | 171 |
| 223 | 3300053727 | Ga0500611_000155 | Ga0500611_000155_975_1502 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nfz-assembly1.cif.gz_B | structure and mechanism of action of isopentenylpyrophosphate-dimethylallylpyrophosphate isomerase: complex with eipp | 0.927 | 4 | 160 |
| 1hzt-assembly1.cif.gz_A | crystal structure of metal-free isopentenyl diphosphate:dimethylallyl diphosphate isomerase | 0.9215 | 29 | 160 |
| 2fkb-assembly2.cif.gz_B | crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12 | 0.9177 | 1 | 168 |
| 2g74-assembly1.cif.gz_A | y104f mutant of type 1 isopentenylpyrophosphate-dimethylallylpyrophosphate isomerase | 0.9169 | 4 | 160 |
| 1q54-assembly1.cif.gz_A | structure and mechanism of action of isopentenylpyrophosphate-dimethylallylpyrophosphate isomerase: complex with the bromohydrine of ipp | 0.915 | 4 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55D56_1_193_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9401 | 1 | 155 | 3.90.79.10 |
| af_P9WKK5_11_180_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9375 | 3 | 166 | 3.90.79.10 |
| af_G5EFQ1_4_235_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9268 | 1 | 160 | 3.90.79.10 |
| af_Q9VDC2_18_256_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9128 | 2 | 163 | 3.90.79.10 |
| 1i9aB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9074 | 4 | 159 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3SVI0-F1-model_v4 | Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2) | 0.9989 | 18 | 170 |
GO:0004452
GO:0005737 GO:0009240 GO:0046872 GO:0050992 |
| AF-A0A1V2B1R0-F1-model_v4 | Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2) | 0.9987 | 1 | 171 |
GO:0004452
GO:0005737 GO:0009240 GO:0046872 GO:0050992 |
| AF-A0A561IF82-F1-model_v4 | deleted | 0.9975 | 1 | 171 |
|
| AF-A0A837INU8-F1-model_v4 | Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2) | 0.9964 | 1 | 170 |
GO:0004452
GO:0005737 GO:0009240 GO:0046872 GO:0050992 |
| AF-A0A4Q3BY32-F1-model_v4 | isopentenyl-diphosphate Delta-isomerase (EC 5.3.3.2) | 0.9959 | 36 | 170 |
GO:0004452
GO:0005737 GO:0009240 GO:0046872 GO:0050992 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar