F335560

General Info

Members Datasets Scaffolds Average Seq Length
223 147 224 181

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10395276|Ga0105242_103952762
Length 214
Sequence LDGNRQTVIGNWQSVLKFLRIYFRIVDCRFPTKHNKFQTKIKTLQQVILVNEHDEPIGTMEKMEAHEKGLLHRAFSIFIFNKKGEMLLQQRAADKYHSPNLWTNACCSHPSPDETVEDAAHRRLKEELGFDVSLVKAFNFTYKTAFDNGLTEHEYDHVFTGIYDGAVHPDNKEVKDHRFAEIKNVRTDMLIHSEQYTSWFKIAFPKLEEYLAGL

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
136 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 0.45
Rhizosphere 93.27
Stem 0
Stem Tuber 0
Unclassified 5.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10035635 3300003316 Bacteria 3039
2 rootH2_10013635 3300003320 Bacteria 31266
3 rootL2_10007802 3300003322 Bacteria 13532
4 rootL2_10051660 3300003322 Bacteria 5468
5 rootL2_10243796 3300003322 Bacteria 3042
6 rootH1_10003627 3300003323 Bacteria 3130
7 rootH1_10011599 3300003316 Bacteria 6776
8 rootH1_10011599 3300003323 Bacteria 9596
9 rootH1_10050428 3300003323 Bacteria 6863
10 rootH1_10242877 3300003323 Unclassified 1260
11 Ga0065712_10016974 3300005290 Bacteria 2335
12 Ga0065712_10101550 3300005290 Unclassified 2031
13 Ga0065712_10327576 3300005290 Bacteria 819
14 Ga0065715_10000595 3300005293 Bacteria 9966
15 Ga0070670_100065006 3300005331 Bacteria 3130
16 Ga0070670_100106323 3300005331 Unclassified 2418
17 Ga0070670_100187577 3300005331 Bacteria 1796
18 Ga0068868_100389437 3300005338 Bacteria 1200
19 Ga0070689_100123272 3300005340 Bacteria 2072
20 Ga0070687_100027393 3300005343 Bacteria 2753
21 Ga0070668_100192894 3300005347 Bacteria 1669
22 Ga0070669_100010015 3300005353 Bacteria 6739
23 Ga0070669_100739528 3300005353 Unclassified 833
24 Ga0070675_100122362 3300005354 Bacteria 2211
25 Ga0070671_100015427 3300005355 Bacteria 6172
26 Ga0070688_100181708 3300005365 Bacteria 1460
27 Ga0070667_100032027 3300005367 Bacteria 4384
28 Ga0070667_100781199 3300005367 Unclassified 886
29 Ga0070700_100099604 3300005441 Bacteria 1912
30 Ga0070678_100276511 3300005456 Unclassified 1418
31 Ga0068867_100211949 3300005459 Unclassified 1556
32 Ga0070685_10054096 3300005466 Bacteria 2327
33 Ga0068853_100634298 3300005539 Bacteria 1016
34 Ga0070672_100023891 3300005543 Bacteria 4509
35 Ga0070704_100123719 3300005549 Bacteria 1992
36 Ga0068855_100557205 3300005563 Bacteria 1240
37 Ga0070664_100917544 3300005564 Bacteria 821
38 Ga0068857_100318493 3300005577 Bacteria 1436
39 Ga0068854_100119592 3300005578 Bacteria 1998
40 Ga0068852_100114031 3300005616 Bacteria 2462
41 Ga0068852_101300936 3300005616 Bacteria 749
42 Ga0068859_100756565 3300005617 Bacteria 1060
43 Ga0068859_101548638 3300005617 Bacteria 732
44 Ga0068864_100172542 3300005618 Bacteria 1973
45 Ga0068864_100192492 3300005618 Unclassified 1870
46 Ga0068864_100657773 3300005618 Unclassified 1021
47 Ga0068861_100305552 3300005719 Bacteria 1380
48 Ga0068863_100041001 3300005841 Bacteria 4401
49 Ga0068863_100080270 3300005841 Bacteria 3090
50 Ga0068863_100726965 3300005841 Bacteria 988
51 Ga0068858_100415915 3300005842 Bacteria 1293
52 Ga0068860_100002687 3300005843 Bacteria 18508
53 Ga0068860_100025101 3300005843 Bacteria 5751
54 Ga0068860_100512532 3300005843 Bacteria 1199
55 Ga0068862_100311987 3300005844 Unclassified 1450
56 Ga0068862_100422620 3300005844 Bacteria 1251
57 Ga0070715_10164760 3300006163 Bacteria 1099
58 Ga0097621_100000465 3300006237 Bacteria 28387
59 Ga0097621_100488949 3300006237 Bacteria 1113
60 Ga0068871_100001644 3300006358 Bacteria 15052
61 Ga0068871_100132989 3300006358 Bacteria 2110
62 Ga0075428_100158847 3300006844 Bacteria 2454
63 Ga0075428_101046758 3300006844 Bacteria 863
64 Ga0075430_100005505 3300006846 Bacteria 10697
65 Ga0075431_100021879 3300006847 Bacteria 6537
66 Ga0075434_100084958 3300006871 Bacteria 3164
67 Ga0075429_100132079 3300006880 Bacteria 2184
68 Ga0068865_100611491 3300006881 Bacteria 922
69 Ga0068865_100719266 3300006881 Bacteria 855
70 Ga0097620_100756578 3300006931 Bacteria 1060
71 Ga0097620_101548130 3300006931 Bacteria 732
72 Ga0105240_10000198 3300009093 Bacteria 122388
73 Ga0111539_10041368 3300009094 Bacteria 5541
74 Ga0111539_11439793 3300009094 Bacteria 799
75 Ga0114129_10072555 3300009147 Bacteria 4798
76 Ga0105241_10009669 3300009174 Bacteria 7087
77 Ga0105241_10322233 3300009174 Bacteria 1333
78 Ga0105242_10047157 3300009176 Bacteria 3498
79 Ga0105242_10062413 3300009176 Bacteria 3066
80 Ga0105242_10089475 3300009176 Bacteria 2588
81 Ga0105242_10384348 3300009176 Unclassified 1306
82 Ga0105242_10395276 3300009176 Bacteria 1288
83 Ga0105237_10005617 3300009545 Bacteria 14137
84 Ga0105238_10007301 3300009551 Bacteria 11064
85 Ga0105249_10024612 3300009553 Bacteria 5411
86 Ga0105249_10079009 3300009553 Unclassified 3053
87 Ga0105249_10640602 3300009553 Bacteria 1120
88 Ga0105239_10018886 3300010375 Bacteria 7616
89 Ga0105239_10207917 3300010375 Bacteria 2193
90 Ga0105246_10614855 3300011119 Bacteria 941
91 Ga0157371_10229573 3300013102 Bacteria 1334
92 Ga0157371_10385299 3300013102 Bacteria 1024
93 Ga0157370_10177420 3300013104 Unclassified 1980
94 Ga0157374_10155033 3300013296 Unclassified 2229
95 Ga0157378_10063074 3300013297 Unclassified 3310
96 Ga0157378_10209824 3300013297 Unclassified 1846
97 Ga0157378_10515786 3300013297 Bacteria 1196
98 Ga0163162_10000782 3300013306 Bacteria 29601
99 Ga0163162_10070237 3300013306 Unclassified 3553
100 Ga0163162_10367560 3300013306 Bacteria 1571
101 Ga0163162_10645396 3300013306 Bacteria 1182
102 Ga0157372_10006597 3300013307 Bacteria 12351
103 Ga0157372_10127461 3300013307 Unclassified 2926
104 Ga0157375_10000911 3300013308 Bacteria 25700
105 Ga0163163_10000215 3300014325 Bacteria 60028
106 Ga0163163_10137152 3300014325 Bacteria 2488
107 Ga0157380_10002513 3300014326 Bacteria 12359
108 Ga0157380_10039065 3300014326 Bacteria 3689
109 Ga0157380_10055466 3300014326 Bacteria 3147
110 Ga0157380_10200778 3300014326 Bacteria 1769
111 Ga0157380_10226468 3300014326 Unclassified 1676
112 Ga0157377_10027383 3300014745 Bacteria 3060
113 Ga0157377_10408444 3300014745 Bacteria 927
114 Ga0157379_10044598 3300014968 Unclassified 3958
115 Ga0157379_10135525 3300014968 Bacteria 2218
116 Ga0157376_10000958 3300014969 Bacteria 18796
117 Ga0157376_10060713 3300014969 Bacteria 3176
118 Ga0163161_10000224 3300017792 Bacteria 51786
119 Ga0163161_10015479 3300017792 Bacteria 5318
120 Ga0163161_10015639 3300017792 Bacteria 5292
121 Ga0163161_10026514 3300017792 Bacteria 4104
122 Ga0163161_10078825 3300017792 Bacteria 2421
123 Ga0207654_10055947 3300025911 Bacteria 2287
124 Ga0207695_10000346 3300025913 Bacteria 107028
125 Ga0207671_10002977 3300025914 Bacteria 17383
126 Ga0207662_10222368 3300025918 Bacteria 1230
127 Ga0207681_10066446 3300025923 Bacteria 2496
128 Ga0207650_10027230 3300025925 Bacteria 4090
129 Ga0207650_10084147 3300025925 Unclassified 2418
130 Ga0207659_10040732 3300025926 Bacteria 3250
131 Ga0207644_10011068 3300025931 Bacteria 5959
132 Ga0207686_10010705 3300025934 Bacteria 4996
133 Ga0207670_10002843 3300025936 Bacteria 9138
134 Ga0207670_10782925 3300025936 Bacteria 794
135 Ga0207669_10009106 3300025937 Bacteria 4709
136 Ga0207704_10031438 3300025938 Bacteria 2991
137 Ga0207704_10498731 3300025938 Bacteria 981
138 Ga0207691_10115607 3300025940 Bacteria 2382
139 Ga0207689_10032978 3300025942 Bacteria 4305
140 Ga0207689_10916398 3300025942 Unclassified 739
141 Ga0207679_11080807 3300025945 Bacteria 736
142 Ga0207651_10170124 3300025960 Bacteria 1717
143 Ga0207712_10033032 3300025961 Bacteria 3496
144 Ga0207712_10359992 3300025961 Bacteria 1212
145 Ga0207712_10559004 3300025961 Bacteria 985
146 Ga0207658_10020983 3300025986 Unclassified 4529
147 Ga0207677_10185735 3300026023 Bacteria 1639
148 Ga0207639_10313546 3300026041 Bacteria 1390
149 Ga0207639_10892323 3300026041 Bacteria 831
150 Ga0207708_10112997 3300026075 Bacteria 2110
151 Ga0207708_10671026 3300026075 Bacteria 884
152 Ga0207702_10520111 3300026078 Unclassified 1162
153 Ga0207641_10000111 3300026088 Bacteria 120527
154 Ga0207641_10026788 3300026088 Bacteria 4759
155 Ga0207641_10231983 3300026088 Bacteria 1716
156 Ga0207641_10289978 3300026088 Unclassified 1542
157 Ga0207641_10666295 3300026088 Unclassified 1023
158 Ga0207648_10185966 3300026089 Bacteria 1840
159 Ga0207676_10029483 3300026095 Bacteria 4110
160 Ga0207676_10031248 3300026095 Bacteria 4004
161 Ga0207676_10058271 3300026095 Bacteria 3046
162 Ga0207676_10098012 3300026095 Unclassified 2423
163 Ga0207676_10118463 3300026095 Bacteria 2228
164 Ga0207674_10272168 3300026116 Bacteria 1641
165 Ga0207674_10396571 3300026116 Bacteria 1334
166 Ga0207675_100095902 3300026118 Bacteria 2792
167 Ga0207683_10131739 3300026121 Unclassified 2249
168 Ga0207698_10081677 3300026142 Bacteria 2610
169 Ga0268266_10000068 3300028379 Bacteria 241100
170 Ga0268265_10085943 3300028380 Bacteria 2498
171 Ga0268264_10003294 3300028381 Bacteria 13957
172 Ga0268264_10009386 3300028381 Bacteria 8099
173 Ga0268264_10226467 3300028381 Bacteria 1724
174 Ga0268264_10276720 3300028381 Bacteria 1570
175 Ga0307509_10353776 3300031507 Bacteria 1191
176 Ga0307408_100002945 3300031548 Bacteria 11795
177 Ga0307408_100005195 3300031548 Bacteria 8727
178 Ga0307409_100541780 3300031995 Bacteria 1141
179 Ga0307416_100108728 3300032002 Bacteria 2437
180 Ga0316574_0196704 3300035398 Bacteria 1296
181 Ga0316584_0309005 3300036712 Bacteria 1143
182 Ga0436365_1899890 3300039437 Bacteria 879
183 Ga0451802_1785986 3300041460 Bacteria 860
184 Ga0451853_2716109 3300041512 Bacteria 782
185 Ga0439431_0001199 3300041997 Bacteria 5681
186 Ga0439445_0009239 3300042004 Bacteria 2320
187 Ga0451577_0097314 3300042876 Unclassified 2628
188 Ga0453683_0101742 3300044673 Unclassified 1804
189 Ga0466965_0244004 3300044683 Bacteria 962
190 Ga0453684_0158510 3300044712 Unclassified 2680
191 Ga0451576_0003687 3300045051 Bacteria 20777
192 Ga0495638_0147439 3300046460 Bacteria 1368
193 Ga0495594_0116487 3300046499 Bacteria 1509
194 Ga0495610_0002019 3300046512 Bacteria 17362
195 Ga0495621_0099176 3300046539 Unclassified 1107
196 Ga0495658_0189361 3300046683 Unclassified 1279
197 Ga0495600_0500474 3300046809 Bacteria 747
198 Ga0495636_0484687 3300047318 Unclassified 597
199 Ga0495672_0032233 3300047320 Bacteria 3263
200 Ga0495676_0224012 3300047321 Bacteria 1295
201 Ga0501031_0405336 3300049568 Unclassified 882
202 Ga0501032_0087782 3300049569 Bacteria 2065
203 Ga0501033_0011190 3300049570 Bacteria 6873
204 Ga0501034_0002811 3300049571 Bacteria 20358
205 Ga0501036_0324215 3300049572 Unclassified 1287
206 Ga0501037_0040768 3300049573 Bacteria 3416
207 Ga0501039_0044073 3300049575 Bacteria 3445
208 Ga0501043_0017830 3300049579 Bacteria 5566
209 Ga0501043_0020117 3300049579 Bacteria 5238
210 Ga0501047_0751066 3300049581 Bacteria 791
211 Ga0501243_009959 3300049675 Bacteria 1480
212 Ga0501219_000110 3300049703 Bacteria 14324
213 Ga0501225_0021770 3300049705 Bacteria 1770
214 Ga0501035_0096479 3300049822 Bacteria 2598
215 Ga0501035_0121919 3300049822 Bacteria 2278
216 Ga0501044_0028603 3300049823 Bacteria 5883
217 Ga0501284_00054 3300050005 Bacteria 42687
218 nmdc:mga05p37_385602_c1 3300050507 Unclassified 1640
219 nmdc:mga09592_243747_c1 3300050508 Unclassified 1558
220 nmdc:mga0qj67_82018_c1 3300050509 Bacteria 2586
221 nmdc:mga08y16_1188365_c1 3300050511 Unclassified 734
222 nmdc:mga0n895_26949_c1 3300050512 Bacteria 5452
223 Ga0500616_0003349 3300053153 Bacteria 12329
224 Ga0500611_000155 3300053727 Bacteria 10865

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10013635 rootH2_100136352 164
2 3300003322 rootL2_10051660 rootL2_100516605 164
3 3300003323 rootH1_10011599 rootH1_1001159912 164
4 3300011119 Ga0105246_10614855 Ga0105246_106148552 165
5 3300003322 rootL2_10243796 rootL2_102437963 166
6 3300042876 Ga0451577_0097314 Ga0451577_0097314_961_1482 166
7 3300044673 Ga0453683_0101742 Ga0453683_0101742_378_899 166
8 3300044712 Ga0453684_0158510 Ga0453684_0158510_1796_2317 166
9 3300045051 Ga0451576_0003687 Ga0451576_0003687_15878_16399 166
10 3300005844 Ga0068862_100422620 Ga0068862_1004226202 169
11 3300005331 Ga0070670_100065006 Ga0070670_1000650063 170
12 3300005347 Ga0070668_100192894 Ga0070668_1001928942 170
13 3300005353 Ga0070669_100739528 Ga0070669_1007395281 170
14 3300005578 Ga0068854_100119592 Ga0068854_1001195923 170
15 3300005617 Ga0068859_101548638 Ga0068859_1015486381 170
16 3300005618 Ga0068864_100657773 Ga0068864_1006577732 170
17 3300005843 Ga0068860_100002687 Ga0068860_10000268718 170
18 3300005843 Ga0068860_100025101 Ga0068860_1000251015 170
19 3300006931 Ga0097620_101548130 Ga0097620_1015481302 170
20 3300013297 Ga0157378_10515786 Ga0157378_105157862 170
21 3300025925 Ga0207650_10027230 Ga0207650_100272303 170
22 3300025942 Ga0207689_10916398 Ga0207689_109163981 170
23 3300025961 Ga0207712_10359992 Ga0207712_103599921 170
24 3300026088 Ga0207641_10666295 Ga0207641_106662952 170
25 3300026095 Ga0207676_10031248 Ga0207676_100312482 170
26 3300028380 Ga0268265_10085943 Ga0268265_100859432 170
27 3300028381 Ga0268264_10003294 Ga0268264_100032945 170
28 3300028381 Ga0268264_10009386 Ga0268264_100093866 170
29 3300003316 rootH1_10035635 rootH1_100356352 171
30 3300003322 rootL2_10007802 rootL2_100078027 171
31 3300003323 rootH1_10003627 rootH1_100036274 171
32 3300003323 rootH1_10050428 rootH1_100504284 171
33 3300003323 rootH1_10242877 rootH1_102428772 171
34 3300005290 Ga0065712_10016974 Ga0065712_100169743 171
35 3300005290 Ga0065712_10101550 Ga0065712_101015503 171
36 3300005290 Ga0065712_10327576 Ga0065712_103275762 171
37 3300005293 Ga0065715_10000595 Ga0065715_100005952 171
38 3300005331 Ga0070670_100106323 Ga0070670_1001063232 171
39 3300005331 Ga0070670_100187577 Ga0070670_1001875772 171
40 3300005338 Ga0068868_100389437 Ga0068868_1003894372 171
41 3300005340 Ga0070689_100123272 Ga0070689_1001232722 171
42 3300005343 Ga0070687_100027393 Ga0070687_1000273932 171
43 3300005353 Ga0070669_100010015 Ga0070669_1000100156 171
44 3300005354 Ga0070675_100122362 Ga0070675_1001223623 171
45 3300005355 Ga0070671_100015427 Ga0070671_1000154277 171
46 3300005365 Ga0070688_100181708 Ga0070688_1001817083 171
47 3300005367 Ga0070667_100032027 Ga0070667_1000320273 171
48 3300005367 Ga0070667_100781199 Ga0070667_1007811991 171
49 3300005441 Ga0070700_100099604 Ga0070700_1000996043 171
50 3300005456 Ga0070678_100276511 Ga0070678_1002765112 171
51 3300005459 Ga0068867_100211949 Ga0068867_1002119492 171
52 3300005466 Ga0070685_10054096 Ga0070685_100540963 171
53 3300005539 Ga0068853_100634298 Ga0068853_1006342982 171
54 3300005543 Ga0070672_100023891 Ga0070672_1000238915 171
55 3300005549 Ga0070704_100123719 Ga0070704_1001237192 171
56 3300005563 Ga0068855_100557205 Ga0068855_1005572052 171
57 3300005564 Ga0070664_100917544 Ga0070664_1009175441 171
58 3300005577 Ga0068857_100318493 Ga0068857_1003184932 171
59 3300005616 Ga0068852_100114031 Ga0068852_1001140313 171
60 3300005616 Ga0068852_101300936 Ga0068852_1013009361 171
61 3300005617 Ga0068859_100756565 Ga0068859_1007565651 171
62 3300005618 Ga0068864_100172542 Ga0068864_1001725422 171
63 3300005618 Ga0068864_100192492 Ga0068864_1001924922 171
64 3300005719 Ga0068861_100305552 Ga0068861_1003055522 171
65 3300005841 Ga0068863_100041001 Ga0068863_1000410014 171
66 3300005841 Ga0068863_100080270 Ga0068863_1000802703 171
67 3300005841 Ga0068863_100726965 Ga0068863_1007269652 171
68 3300005842 Ga0068858_100415915 Ga0068858_1004159152 171
69 3300005843 Ga0068860_100512532 Ga0068860_1005125322 171
70 3300005844 Ga0068862_100311987 Ga0068862_1003119871 171
71 3300006163 Ga0070715_10164760 Ga0070715_101647602 171
72 3300006237 Ga0097621_100000465 Ga0097621_10000046513 171
73 3300006237 Ga0097621_100488949 Ga0097621_1004889492 171
74 3300006358 Ga0068871_100001644 Ga0068871_10000164413 171
75 3300006358 Ga0068871_100132989 Ga0068871_1001329893 171
76 3300006844 Ga0075428_100158847 Ga0075428_1001588473 171
77 3300006844 Ga0075428_101046758 Ga0075428_1010467581 171
78 3300006846 Ga0075430_100005505 Ga0075430_10000550510 171
79 3300006847 Ga0075431_100021879 Ga0075431_1000218795 171
80 3300006871 Ga0075434_100084958 Ga0075434_1000849584 171
81 3300006880 Ga0075429_100132079 Ga0075429_1001320793 171
82 3300006881 Ga0068865_100611491 Ga0068865_1006114912 171
83 3300006881 Ga0068865_100719266 Ga0068865_1007192661 171
84 3300006931 Ga0097620_100756578 Ga0097620_1007565782 171
85 3300009093 Ga0105240_10000198 Ga0105240_1000019847 171
86 3300009094 Ga0111539_10041368 Ga0111539_100413686 171
87 3300009094 Ga0111539_11439793 Ga0111539_114397932 171
88 3300009147 Ga0114129_10072555 Ga0114129_100725556 171
89 3300009174 Ga0105241_10009669 Ga0105241_100096696 171
90 3300009174 Ga0105241_10322233 Ga0105241_103222332 171
91 3300009176 Ga0105242_10047157 Ga0105242_100471571 171
92 3300009176 Ga0105242_10062413 Ga0105242_100624132 171
93 3300009176 Ga0105242_10089475 Ga0105242_100894753 171
94 3300009176 Ga0105242_10384348 Ga0105242_103843482 171
95 3300009176 Ga0105242_10395276 Ga0105242_103952762 171
96 3300009545 Ga0105237_10005617 Ga0105237_100056177 171
97 3300009551 Ga0105238_10007301 Ga0105238_1000730110 171
98 3300009553 Ga0105249_10024612 Ga0105249_100246123 171
99 3300009553 Ga0105249_10079009 Ga0105249_100790094 171
100 3300009553 Ga0105249_10640602 Ga0105249_106406022 171
101 3300010375 Ga0105239_10018886 Ga0105239_100188867 171
102 3300010375 Ga0105239_10207917 Ga0105239_102079172 171
103 3300013102 Ga0157371_10229573 Ga0157371_102295734 171
104 3300013102 Ga0157371_10385299 Ga0157371_103852992 171
105 3300013104 Ga0157370_10177420 Ga0157370_101774201 171
106 3300013296 Ga0157374_10155033 Ga0157374_101550332 171
107 3300013297 Ga0157378_10063074 Ga0157378_100630743 171
108 3300013297 Ga0157378_10209824 Ga0157378_102098242 171
109 3300013306 Ga0163162_10000782 Ga0163162_1000078213 171
110 3300013306 Ga0163162_10070237 Ga0163162_100702372 171
111 3300013306 Ga0163162_10367560 Ga0163162_103675602 171
112 3300013306 Ga0163162_10645396 Ga0163162_106453962 171
113 3300013307 Ga0157372_10006597 Ga0157372_100065979 171
114 3300013307 Ga0157372_10127461 Ga0157372_101274614 171
115 3300013308 Ga0157375_10000911 Ga0157375_100009117 171
116 3300014325 Ga0163163_10000215 Ga0163163_100002156 171
117 3300014325 Ga0163163_10137152 Ga0163163_101371522 171
118 3300014326 Ga0157380_10002513 Ga0157380_100025138 171
119 3300014326 Ga0157380_10039065 Ga0157380_100390653 171
120 3300014326 Ga0157380_10055466 Ga0157380_100554662 171
121 3300014326 Ga0157380_10200778 Ga0157380_102007782 171
122 3300014326 Ga0157380_10226468 Ga0157380_102264682 171
123 3300014745 Ga0157377_10027383 Ga0157377_100273831 171
124 3300014745 Ga0157377_10408444 Ga0157377_104084442 171
125 3300014968 Ga0157379_10044598 Ga0157379_100445984 171
126 3300014968 Ga0157379_10135525 Ga0157379_101355252 171
127 3300014969 Ga0157376_10000958 Ga0157376_1000095818 171
128 3300014969 Ga0157376_10060713 Ga0157376_100607132 171
129 3300017792 Ga0163161_10000224 Ga0163161_1000022423 171
130 3300017792 Ga0163161_10015479 Ga0163161_100154795 171
131 3300017792 Ga0163161_10015639 Ga0163161_100156391 171
132 3300017792 Ga0163161_10026514 Ga0163161_100265142 171
133 3300017792 Ga0163161_10078825 Ga0163161_100788252 171
134 3300025911 Ga0207654_10055947 Ga0207654_100559473 171
135 3300025913 Ga0207695_10000346 Ga0207695_1000034645 171
136 3300025914 Ga0207671_10002977 Ga0207671_1000297712 171
137 3300025918 Ga0207662_10222368 Ga0207662_102223682 171
138 3300025923 Ga0207681_10066446 Ga0207681_100664463 171
139 3300025925 Ga0207650_10084147 Ga0207650_100841472 171
140 3300025926 Ga0207659_10040732 Ga0207659_100407323 171
141 3300025931 Ga0207644_10011068 Ga0207644_100110686 171
142 3300025934 Ga0207686_10010705 Ga0207686_100107052 171
143 3300025936 Ga0207670_10002843 Ga0207670_100028432 171
144 3300025936 Ga0207670_10782925 Ga0207670_107829251 171
145 3300025937 Ga0207669_10009106 Ga0207669_100091062 171
146 3300025938 Ga0207704_10031438 Ga0207704_100314383 171
147 3300025938 Ga0207704_10498731 Ga0207704_104987311 171
148 3300025940 Ga0207691_10115607 Ga0207691_101156072 171
149 3300025942 Ga0207689_10032978 Ga0207689_100329783 171
150 3300025945 Ga0207679_11080807 Ga0207679_110808071 171
151 3300025960 Ga0207651_10170124 Ga0207651_101701242 171
152 3300025961 Ga0207712_10033032 Ga0207712_100330322 171
153 3300025961 Ga0207712_10559004 Ga0207712_105590042 171
154 3300025986 Ga0207658_10020983 Ga0207658_100209833 171
155 3300026023 Ga0207677_10185735 Ga0207677_101857352 171
156 3300026041 Ga0207639_10313546 Ga0207639_103135462 171
157 3300026041 Ga0207639_10892323 Ga0207639_108923231 171
158 3300026075 Ga0207708_10112997 Ga0207708_101129971 171
159 3300026075 Ga0207708_10671026 Ga0207708_106710261 171
160 3300026078 Ga0207702_10520111 Ga0207702_105201112 171
161 3300026088 Ga0207641_10000111 Ga0207641_1000011124 171
162 3300026088 Ga0207641_10026788 Ga0207641_100267883 171
163 3300026088 Ga0207641_10231983 Ga0207641_102319833 171
164 3300026088 Ga0207641_10289978 Ga0207641_102899782 171
165 3300026089 Ga0207648_10185966 Ga0207648_101859662 171
166 3300026095 Ga0207676_10029483 Ga0207676_100294833 171
167 3300026095 Ga0207676_10058271 Ga0207676_100582712 171
168 3300026095 Ga0207676_10098012 Ga0207676_100980123 171
169 3300026095 Ga0207676_10118463 Ga0207676_101184632 171
170 3300026116 Ga0207674_10272168 Ga0207674_102721682 171
171 3300026116 Ga0207674_10396571 Ga0207674_103965712 171
172 3300026118 Ga0207675_100095902 Ga0207675_1000959023 171
173 3300026121 Ga0207683_10131739 Ga0207683_101317392 171
174 3300026142 Ga0207698_10081677 Ga0207698_100816773 171
175 3300028379 Ga0268266_10000068 Ga0268266_1000006870 171
176 3300028381 Ga0268264_10226467 Ga0268264_102264672 171
177 3300028381 Ga0268264_10276720 Ga0268264_102767203 171
178 3300031507 Ga0307509_10353776 Ga0307509_103537762 171
179 3300031548 Ga0307408_100002945 Ga0307408_1000029458 171
180 3300031548 Ga0307408_100005195 Ga0307408_1000051956 171
181 3300031995 Ga0307409_100541780 Ga0307409_1005417802 171
182 3300032002 Ga0307416_100108728 Ga0307416_1001087283 171
183 3300035398 Ga0316574_0196704 Ga0316574_0196704_454_972 171
184 3300036712 Ga0316584_0309005 Ga0316584_0309005_233_751 171
185 3300039437 Ga0436365_1899890 Ga0436365_1899890_321_863 171
186 3300041460 Ga0451802_1785986 Ga0451802_1785986_123_662 171
187 3300041512 Ga0451853_2716109 Ga0451853_2716109_116_661 171
188 3300041997 Ga0439431_0001199 Ga0439431_0001199_1808_2353 171
189 3300042004 Ga0439445_0009239 Ga0439445_0009239_43_588 171
190 3300044683 Ga0466965_0244004 Ga0466965_0244004_40_585 171
191 3300046460 Ga0495638_0147439 Ga0495638_0147439_730_1257 171
192 3300046499 Ga0495594_0116487 Ga0495594_0116487_57_605 171
193 3300046512 Ga0495610_0002019 Ga0495610_0002019_1922_2464 171
194 3300046539 Ga0495621_0099176 Ga0495621_0099176_108_659 171
195 3300046683 Ga0495658_0189361 Ga0495658_0189361_708_1256 171
196 3300046809 Ga0495600_0500474 Ga0495600_0500474_79_627 171
197 3300047318 Ga0495636_0484687 Ga0495636_0484687_19_570 171
198 3300047320 Ga0495672_0032233 Ga0495672_0032233_1006_1533 171
199 3300047321 Ga0495676_0224012 Ga0495676_0224012_341_889 171
200 3300049568 Ga0501031_0405336 Ga0501031_0405336_45_572 171
201 3300049569 Ga0501032_0087782 Ga0501032_0087782_652_1179 171
202 3300049570 Ga0501033_0011190 Ga0501033_0011190_1856_2383 171
203 3300049571 Ga0501034_0002811 Ga0501034_0002811_11176_11703 171
204 3300049572 Ga0501036_0324215 Ga0501036_0324215_114_641 171
205 3300049573 Ga0501037_0040768 Ga0501037_0040768_2298_2825 171
206 3300049575 Ga0501039_0044073 Ga0501039_0044073_133_660 171
207 3300049579 Ga0501043_0017830 Ga0501043_0017830_1008_1535 171
208 3300049579 Ga0501043_0020117 Ga0501043_0020117_509_1063 171
209 3300049581 Ga0501047_0751066 Ga0501047_0751066_200_727 171
210 3300049675 Ga0501243_009959 Ga0501243_009959_393_923 171
211 3300049703 Ga0501219_000110 Ga0501219_000110_2701_3246 171
212 3300049705 Ga0501225_0021770 Ga0501225_0021770_1143_1688 171
213 3300049822 Ga0501035_0096479 Ga0501035_0096479_1956_2477 171
214 3300049822 Ga0501035_0121919 Ga0501035_0121919_1326_1853 171
215 3300049823 Ga0501044_0028603 Ga0501044_0028603_5095_5622 171
216 3300050005 Ga0501284_00054 Ga0501284_00054_39800_40345 171
217 3300050507 nmdc:mga05p37_385602_c1 nmdc:mga05p37_385602_c1_125_676 171
218 3300050508 nmdc:mga09592_243747_c1 nmdc:mga09592_243747_c1_857_1408 171
219 3300050509 nmdc:mga0qj67_82018_c1 nmdc:mga0qj67_82018_c1_1596_2147 171
220 3300050511 nmdc:mga08y16_1188365_c1 nmdc:mga08y16_1188365_c1_77_625 171
221 3300050512 nmdc:mga0n895_26949_c1 nmdc:mga0n895_26949_c1_4725_5258 171
222 3300053153 Ga0500616_0003349 Ga0500616_0003349_4267_4818 171
223 3300053727 Ga0500611_000155 Ga0500611_000155_975_1502 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

70

200

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nfz-assembly1.cif.gz_B structure and mechanism of action of isopentenylpyrophosphate-dimethylallylpyrophosphate isomerase: complex with eipp 0.927 4 160
1hzt-assembly1.cif.gz_A crystal structure of metal-free isopentenyl diphosphate:dimethylallyl diphosphate isomerase 0.9215 29 160
2fkb-assembly2.cif.gz_B crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12 0.9177 1 168
2g74-assembly1.cif.gz_A y104f mutant of type 1 isopentenylpyrophosphate-dimethylallylpyrophosphate isomerase 0.9169 4 160
1q54-assembly1.cif.gz_A structure and mechanism of action of isopentenylpyrophosphate-dimethylallylpyrophosphate isomerase: complex with the bromohydrine of ipp 0.915 4 160
ID Description Score Start End Superfamily
af_Q55D56_1_193_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9401 1 155 3.90.79.10
af_P9WKK5_11_180_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9375 3 166 3.90.79.10
af_G5EFQ1_4_235_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9268 1 160 3.90.79.10
af_Q9VDC2_18_256_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9128 2 163 3.90.79.10
1i9aB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9074 4 159 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A4Q3SVI0-F1-model_v4 Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2) 0.9989 18 170 GO:0004452
GO:0005737
GO:0009240
GO:0046872
GO:0050992
AF-A0A1V2B1R0-F1-model_v4 Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2) 0.9987 1 171 GO:0004452
GO:0005737
GO:0009240
GO:0046872
GO:0050992
AF-A0A561IF82-F1-model_v4 deleted 0.9975 1 171
AF-A0A837INU8-F1-model_v4 Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2) 0.9964 1 170 GO:0004452
GO:0005737
GO:0009240
GO:0046872
GO:0050992
AF-A0A4Q3BY32-F1-model_v4 isopentenyl-diphosphate Delta-isomerase (EC 5.3.3.2) 0.9959 36 170 GO:0004452
GO:0005737
GO:0009240
GO:0046872
GO:0050992

Feature Viewer

pLDDT pTM Quality
96.25 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map