F335469

General Info

Members Datasets Scaffolds Average Seq Length
223 161 446 58

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_102551207|Ga0075428_1025512072
Length 67
Sequence MLLKRMEIRMPRQLIEPHKGDKRYVRRKKGKFTTKQVKVGRSLAADRRSKSKTVVKKGEGDRGDQRR

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 1.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.62
Nodule 0
Rhizoplane 5.38
Rhizosphere 84.3
Stem 0
Stem Tuber 0
Unclassified 20.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_102551207 3300006844 Unclassified 523
2 JGI24752J21851_1023279 3300001976 Bacteria 810
3 Ga0055530_10007393 3300003791 Bacteria 4639
4 Ga0058859_11018729 3300004798 Bacteria 525
5 Ga0070683_101241309 3300005329 Bacteria 716
6 Ga0070690_100169205 3300005330 Bacteria 1503
7 Ga0070677_10362222 3300005333 Unclassified 754
8 Ga0070680_100073240 3300005336 Bacteria 2816
9 Ga0070682_100784342 3300005337 Bacteria 773
10 Ga0070689_100166971 3300005340 Bacteria 1782
11 Ga0070689_101151602 3300005340 Bacteria 695
12 Ga0070689_101158210 3300005340 Bacteria 693
13 Ga0070687_100316224 3300005343 Unclassified 996
14 Ga0070692_10951062 3300005345 Unclassified 597
15 Ga0070692_11417222 3300005345 Bacteria 502
16 Ga0070668_100067576 3300005347 Bacteria 2777
17 Ga0070669_100065688 3300005353 Bacteria 2673
18 Ga0070675_100054812 3300005354 Bacteria 3281
19 Ga0070675_101266202 3300005354 Bacteria 679
20 Ga0070671_100152496 3300005355 Bacteria 1951
21 Ga0070671_101180158 3300005355 Unclassified 673
22 Ga0070673_100197036 3300005364 Bacteria 1733
23 Ga0070688_100039734 3300005365 Unclassified 2881
24 Ga0070667_100162070 3300005367 Bacteria 1970
25 Ga0070701_10304160 3300005438 Unclassified 981
26 Ga0070700_100182586 3300005441 Bacteria 1461
27 Ga0070663_100326709 3300005455 Bacteria 1235
28 Ga0070678_100022914 3300005456 Bacteria 4151
29 Ga0070662_100311624 3300005457 Bacteria 1281
30 Ga0070681_10058211 3300005458 Bacteria 3844
31 Ga0070681_11336388 3300005458 Bacteria 640
32 Ga0068867_101011141 3300005459 Unclassified 754
33 Ga0070685_11246614 3300005466 Bacteria 566
34 Ga0070679_100619559 3300005530 Bacteria 1025
35 Ga0070679_100666997 3300005530 Unclassified 983
36 Ga0068853_100263777 3300005539 Bacteria 1584
37 Ga0070672_100185024 3300005543 Bacteria 1737
38 Ga0070672_101439569 3300005543 Bacteria 617
39 Ga0070686_100001601 3300005544 Bacteria 12729
40 Ga0070686_100101336 3300005544 Bacteria 1946
41 Ga0068857_100383587 3300005577 Bacteria 1305
42 Ga0068854_101443829 3300005578 Unclassified 623
43 Ga0068856_102074048 3300005614 Unclassified 578
44 Ga0070702_100331607 3300005615 Bacteria 1064
45 Ga0068852_100167027 3300005616 Unclassified 2059
46 Ga0068852_100387856 3300005616 Bacteria 1371
47 Ga0068859_100311380 3300005617 Bacteria 1668
48 Ga0068864_100270646 3300005618 Bacteria 1583
49 Ga0068861_101213959 3300005719 Unclassified 730
50 Ga0068861_102107394 3300005719 Unclassified 564
51 Ga0068870_10020141 3300005840 Bacteria 3244
52 Ga0068870_10790049 3300005840 Bacteria 662
53 Ga0068858_102317737 3300005842 Unclassified 531
54 Ga0068862_100153005 3300005844 Bacteria 2054
55 Ga0081455_10024945 3300005937 Bacteria 5526
56 Ga0081455_10057948 3300005937 Bacteria 3281
57 Ga0081455_10207334 3300005937 Bacteria 1463
58 Ga0081538_10026416 3300005981 Bacteria 4061
59 Ga0081540_1000145 3300005983 Bacteria 73458
60 Ga0081540_1020650 3300005983 Bacteria 3952
61 Ga0075365_10084131 3300006038 Bacteria 2159
62 Ga0075365_10322719 3300006038 Bacteria 1087
63 Ga0075365_11214336 3300006038 Unclassified 530
64 Ga0075363_100367791 3300006048 Unclassified 841
65 Ga0075364_10070590 3300006051 Bacteria 2300
66 Ga0070712_100610127 3300006175 Bacteria 924
67 Ga0075428_100048879 3300006844 Bacteria 4641
68 Ga0075430_100346518 3300006846 Bacteria 1227
69 Ga0075431_100081247 3300006847 Bacteria 3347
70 Ga0075431_101417064 3300006847 Unclassified 654
71 Ga0097620_100311390 3300006931 Bacteria 1668
72 Ga0075435_100392909 3300007076 Bacteria 1192
73 Ga0105240_10046284 3300009093 Bacteria 5513
74 Ga0105240_10251750 3300009093 Bacteria 2042
75 Ga0105240_11374990 3300009093 Bacteria 743
76 Ga0111539_11421616 3300009094 Bacteria 805
77 Ga0111539_12735976 3300009094 Bacteria 572
78 Ga0105245_11767599 3300009098 Bacteria 671
79 Ga0105247_10616030 3300009101 Bacteria 807
80 Ga0114129_10813792 3300009147 Bacteria 1191
81 Ga0114129_11129774 3300009147 Bacteria 979
82 Ga0105243_10103649 3300009148 Unclassified 2366
83 Ga0105242_10551270 3300009176 Bacteria 1105
84 Ga0105248_10718285 3300009177 Bacteria 1127
85 Ga0105248_10739255 3300009177 Bacteria 1110
86 Ga0105248_12452705 3300009177 Bacteria 594
87 Ga0105237_10011491 3300009545 Bacteria 9367
88 Ga0105238_10335010 3300009551 Bacteria 1501
89 Ga0105238_11664487 3300009551 Bacteria 669
90 Ga0105249_10254534 3300009553 Bacteria 1742
91 Ga0105249_10990393 3300009553 Bacteria 909
92 Ga0105239_11191290 3300010375 Bacteria 878
93 Ga0105239_11710649 3300010375 Bacteria 728
94 Ga0105246_10053602 3300011119 Bacteria 2776
95 Ga0105246_11966360 3300011119 Unclassified 563
96 Ga0157373_10474775 3300013100 Bacteria 902
97 Ga0157370_10033998 3300013104 Bacteria 4967
98 Ga0157370_10263805 3300013104 Bacteria 1592
99 Ga0157369_10556236 3300013105 Unclassified 1186
100 Ga0157369_11285863 3300013105 Bacteria 746
101 Ga0157369_11504942 3300013105 Unclassified 685
102 Ga0157374_10809903 3300013296 Bacteria 953
103 Ga0157374_11517347 3300013296 Bacteria 693
104 Ga0157378_10363681 3300013297 Bacteria 1416
105 Ga0163162_10343070 3300013306 Bacteria 1626
106 Ga0157372_10210836 3300013307 Bacteria 2251
107 Ga0157372_10482601 3300013307 Bacteria 1445
108 Ga0157372_13176827 3300013307 Bacteria 524
109 Ga0157375_10676559 3300013308 Bacteria 1187
110 Ga0157375_10807783 3300013308 Unclassified 1086
111 Ga0163163_10080018 3300014325 Bacteria 3267
112 Ga0163163_10142647 3300014325 Bacteria 2438
113 Ga0157380_12083489 3300014326 Bacteria 630
114 Ga0157379_10920870 3300014968 Bacteria 830
115 Ga0206356_10233871 3300020070 Bacteria 1141
116 Ga0206356_10993509 3300020070 Bacteria 537
117 Ga0209148_1051326 3300025254 Bacteria 530
118 Ga0209758_1000331 3300025297 Bacteria 88922
119 Ga0207710_10059824 3300025900 Bacteria 1725
120 Ga0207643_10685953 3300025908 Bacteria 662
121 Ga0207707_10109956 3300025912 Unclassified 2409
122 Ga0207695_10014872 3300025913 Bacteria 9188
123 Ga0207695_11238080 3300025913 Unclassified 627
124 Ga0207695_11349757 3300025913 Unclassified 593
125 Ga0207671_10012008 3300025914 Bacteria 6999
126 Ga0207660_10395683 3300025917 Bacteria 1112
127 Ga0207660_11007648 3300025917 Bacteria 679
128 Ga0207662_10183110 3300025918 Bacteria 1349
129 Ga0207652_10686216 3300025921 Bacteria 914
130 Ga0207652_11526647 3300025921 Bacteria 572
131 Ga0207694_11283508 3300025924 Bacteria 619
132 Ga0207659_10347014 3300025926 Bacteria 1231
133 Ga0207644_10036263 3300025931 Bacteria 3461
134 Ga0207706_10375309 3300025933 Bacteria 1234
135 Ga0207686_10629534 3300025934 Bacteria 847
136 Ga0207670_10003801 3300025936 Bacteria 8029
137 Ga0207670_10896295 3300025936 Bacteria 743
138 Ga0207669_10271007 3300025937 Bacteria 1275
139 Ga0207691_10408575 3300025940 Bacteria 1157
140 Ga0207711_11738307 3300025941 Bacteria 567
141 Ga0207689_10212164 3300025942 Bacteria 1600
142 Ga0207661_11109638 3300025944 Bacteria 728
143 Ga0207667_10029944 3300025949 Bacteria 5896
144 Ga0207667_10327160 3300025949 Bacteria 1565
145 Ga0207651_11339708 3300025960 Bacteria 644
146 Ga0207668_10047694 3300025972 Bacteria 2935
147 Ga0207668_11534934 3300025972 Unclassified 601
148 Ga0207658_10137710 3300025986 Bacteria 1971
149 Ga0207703_10072614 3300026035 Bacteria 2845
150 Ga0207639_10057660 3300026041 Bacteria 2983
151 Ga0207678_10744883 3300026067 Bacteria 864
152 Ga0207708_10263294 3300026075 Bacteria 1392
153 Ga0207648_10305354 3300026089 Bacteria 1428
154 Ga0207648_10713466 3300026089 Bacteria 930
155 Ga0207648_11187107 3300026089 Bacteria 717
156 Ga0207676_10253435 3300026095 Bacteria 1585
157 Ga0207674_11147414 3300026116 Unclassified 746
158 Ga0207675_101620016 3300026118 Bacteria 668
159 Ga0207683_10099865 3300026121 Bacteria 2591
160 Ga0207698_10076763 3300026142 Bacteria 2676
161 Ga0207698_10785191 3300026142 Bacteria 953
162 Ga0268265_10090872 3300028380 Bacteria 2440
163 Ga0307408_100059154 3300031548 Bacteria 2789
164 Ga0307405_10015442 3300031731 Bacteria 4138
165 Ga0307405_11008702 3300031731 Bacteria 711
166 Ga0307413_10793820 3300031824 Bacteria 795
167 Ga0307410_10854500 3300031852 Bacteria 777
168 Ga0307406_10033895 3300031901 Bacteria 3129
169 Ga0307409_100359940 3300031995 Unclassified 1376
170 Ga0307416_102129655 3300032002 Unclassified 663
171 Ga0307415_100174981 3300032126 Bacteria 1678
172 Ga0373938_0169648 3300034957 Bacteria 590
173 Ga0373929_0007365 3300035085 Unclassified 2007
174 Ga0373939_0169104 3300035114 Bacteria 808
175 Ga0373942_0082678 3300035207 Bacteria 956
176 Ga0373931_0058622 3300035691 Bacteria 2068
177 Ga0373927_0967710 3300035695 Unclassified 562
178 Ga0395900_1107674 3300037418 Unclassified 709
179 Ga0436364_0410469 3300037853 Bacteria 748
180 Ga0395901_0725274 3300038443 Unclassified 989
181 Ga0436365_1527178 3300039437 Unclassified 508
182 Ga0436365_1567528 3300039437 Bacteria 1575
183 Ga0436360_0844138 3300039438 Bacteria 760
184 Ga0436363_0870717 3300039450 Bacteria 1279
185 Ga0451851_0461329 3300041507 Unclassified 511
186 Ga0466957_0812299 3300044842 Bacteria 665
187 Ga0495594_0304016 3300046499 Bacteria 909
188 Ga0496102_0934934 3300048905 Unclassified 788
189 Ga0496104_0025825 3300048907 Bacteria 5417
190 Ga0496106_0614157 3300048909 Bacteria 870
191 Ga0496107_1258070 3300048910 Unclassified 530
192 Ga0496108_0282852 3300048911 Bacteria 1444
193 Ga0496109_0207566 3300048912 Bacteria 1842
194 Ga0496110_0736359 3300048913 Unclassified 889
195 Ga0496111_0687696 3300048914 Bacteria 745
196 Ga0496112_0132246 3300048915 Bacteria 2466
197 Ga0496112_0310192 3300048915 Unclassified 1523
198 Ga0496112_1556666 3300048915 Bacteria 575
199 Ga0496115_0810594 3300048918 Bacteria 728
200 Ga0501070_0482555 3300049586 Bacteria 997
201 Ga0501241_007175 3300049758 Bacteria 2043
202 Ga0501241_143771 3300049758 Bacteria 545
203 Ga0501044_0988973 3300049823 Bacteria 713
204 nmdc:mga03683_168588_c1 3300050489 Bacteria 604
205 nmdc:mga03683_553896_c1 3300050489 Unclassified 560
206 nmdc:mga00v17_87134_c1 3300050491 Bacteria 1957
207 nmdc:mga0yw44_1126800_c1 3300050492 Unclassified 530
208 nmdc:mga0yw44_24471_c1 3300050492 Bacteria 3417
209 nmdc:mga0yw44_25017_c1 3300050492 Bacteria 3388
210 nmdc:mga0yw44_355596_c1 3300050492 Unclassified 986
211 nmdc:mga05p37_1182116_c1 3300050507 Bacteria 792
212 nmdc:mga05p37_1945403_c1 3300050507 Bacteria 559
213 nmdc:mga0qj67_443431_c1 3300050509 Bacteria 1046
214 nmdc:mga06r32_1081108_c1 3300050510 Unclassified 752
215 nmdc:mga06r32_207002_c1 3300050510 Unclassified 1950
216 nmdc:mga06r32_75232_c1 3300050510 Bacteria 3276
217 nmdc:mga08y16_1129361_c1 3300050511 Unclassified 757
218 nmdc:mga08y16_568952_c1 3300050511 Bacteria 1145
219 nmdc:mga08y16_727534_c1 3300050511 Bacteria 990
220 nmdc:mga0rr50_13848_c1 3300050513 Bacteria 5268
221 Ga0500562_008206 3300053108 Bacteria 2637
222 Ga0500616_0004733 3300053153 Bacteria 9573
223 Ga0530510_1369837 3300061734 Bacteria 543
224 Ga0075428_102551207
225 JGI24752J21851_1023279
226 Ga0055530_10007393
227 Ga0058859_11018729
228 Ga0070683_101241309
229 Ga0070690_100169205
230 Ga0070677_10362222
231 Ga0070680_100073240
232 Ga0070682_100784342
233 Ga0070689_100166971
234 Ga0070689_101151602
235 Ga0070689_101158210
236 Ga0070687_100316224
237 Ga0070692_10951062
238 Ga0070692_11417222
239 Ga0070668_100067576
240 Ga0070669_100065688
241 Ga0070675_100054812
242 Ga0070675_101266202
243 Ga0070671_100152496
244 Ga0070671_101180158
245 Ga0070673_100197036
246 Ga0070688_100039734
247 Ga0070667_100162070
248 Ga0070701_10304160
249 Ga0070700_100182586
250 Ga0070663_100326709
251 Ga0070678_100022914
252 Ga0070662_100311624
253 Ga0070681_10058211
254 Ga0070681_11336388
255 Ga0068867_101011141
256 Ga0070685_11246614
257 Ga0070679_100619559
258 Ga0070679_100666997
259 Ga0068853_100263777
260 Ga0070672_100185024
261 Ga0070672_101439569
262 Ga0070686_100001601
263 Ga0070686_100101336
264 Ga0068857_100383587
265 Ga0068854_101443829
266 Ga0068856_102074048
267 Ga0070702_100331607
268 Ga0068852_100167027
269 Ga0068852_100387856
270 Ga0068859_100311380
271 Ga0068864_100270646
272 Ga0068861_101213959
273 Ga0068861_102107394
274 Ga0068870_10020141
275 Ga0068870_10790049
276 Ga0068858_102317737
277 Ga0068862_100153005
278 Ga0081455_10024945
279 Ga0081455_10057948
280 Ga0081455_10207334
281 Ga0081538_10026416
282 Ga0081540_1000145
283 Ga0081540_1020650
284 Ga0075365_10084131
285 Ga0075365_10322719
286 Ga0075365_11214336
287 Ga0075363_100367791
288 Ga0075364_10070590
289 Ga0070712_100610127
290 Ga0075428_100048879
291 Ga0075430_100346518
292 Ga0075431_100081247
293 Ga0075431_101417064
294 Ga0097620_100311390
295 Ga0075435_100392909
296 Ga0105240_10046284
297 Ga0105240_10251750
298 Ga0105240_11374990
299 Ga0111539_11421616
300 Ga0111539_12735976
301 Ga0105245_11767599
302 Ga0105247_10616030
303 Ga0114129_10813792
304 Ga0114129_11129774
305 Ga0105243_10103649
306 Ga0105242_10551270
307 Ga0105248_10718285
308 Ga0105248_10739255
309 Ga0105248_12452705
310 Ga0105237_10011491
311 Ga0105238_10335010
312 Ga0105238_11664487
313 Ga0105249_10254534
314 Ga0105249_10990393
315 Ga0105239_11191290
316 Ga0105239_11710649
317 Ga0105246_10053602
318 Ga0105246_11966360
319 Ga0157373_10474775
320 Ga0157370_10033998
321 Ga0157370_10263805
322 Ga0157369_10556236
323 Ga0157369_11285863
324 Ga0157369_11504942
325 Ga0157374_10809903
326 Ga0157374_11517347
327 Ga0157378_10363681
328 Ga0163162_10343070
329 Ga0157372_10210836
330 Ga0157372_10482601
331 Ga0157372_13176827
332 Ga0157375_10676559
333 Ga0157375_10807783
334 Ga0163163_10080018
335 Ga0163163_10142647
336 Ga0157380_12083489
337 Ga0157379_10920870
338 Ga0206356_10233871
339 Ga0206356_10993509
340 Ga0209148_1051326
341 Ga0209758_1000331
342 Ga0207710_10059824
343 Ga0207643_10685953
344 Ga0207707_10109956
345 Ga0207695_10014872
346 Ga0207695_11238080
347 Ga0207695_11349757
348 Ga0207671_10012008
349 Ga0207660_10395683
350 Ga0207660_11007648
351 Ga0207662_10183110
352 Ga0207652_10686216
353 Ga0207652_11526647
354 Ga0207694_11283508
355 Ga0207659_10347014
356 Ga0207644_10036263
357 Ga0207706_10375309
358 Ga0207686_10629534
359 Ga0207670_10003801
360 Ga0207670_10896295
361 Ga0207669_10271007
362 Ga0207691_10408575
363 Ga0207711_11738307
364 Ga0207689_10212164
365 Ga0207661_11109638
366 Ga0207667_10029944
367 Ga0207667_10327160
368 Ga0207651_11339708
369 Ga0207668_10047694
370 Ga0207668_11534934
371 Ga0207658_10137710
372 Ga0207703_10072614
373 Ga0207639_10057660
374 Ga0207678_10744883
375 Ga0207708_10263294
376 Ga0207648_10305354
377 Ga0207648_10713466
378 Ga0207648_11187107
379 Ga0207676_10253435
380 Ga0207674_11147414
381 Ga0207675_101620016
382 Ga0207683_10099865
383 Ga0207698_10076763
384 Ga0207698_10785191
385 Ga0268265_10090872
386 Ga0307408_100059154
387 Ga0307405_10015442
388 Ga0307405_11008702
389 Ga0307413_10793820
390 Ga0307410_10854500
391 Ga0307406_10033895
392 Ga0307409_100359940
393 Ga0307416_102129655
394 Ga0307415_100174981
395 Ga0373938_0169648
396 Ga0373929_0007365
397 Ga0373939_0169104
398 Ga0373942_0082678
399 Ga0373931_0058622
400 Ga0373927_0967710
401 Ga0395900_1107674
402 Ga0436364_0410469
403 Ga0395901_0725274
404 Ga0436365_1527178
405 Ga0436365_1567528
406 Ga0436360_0844138
407 Ga0436363_0870717
408 Ga0451851_0461329
409 Ga0466957_0812299
410 Ga0495594_0304016
411 Ga0496102_0934934
412 Ga0496104_0025825
413 Ga0496106_0614157
414 Ga0496107_1258070
415 Ga0496108_0282852
416 Ga0496109_0207566
417 Ga0496110_0736359
418 Ga0496111_0687696
419 Ga0496112_0132246
420 Ga0496112_0310192
421 Ga0496112_1556666
422 Ga0496115_0810594
423 Ga0501070_0482555
424 Ga0501241_007175
425 Ga0501241_143771
426 Ga0501044_0988973
427 nmdc:mga03683_168588_c1
428 nmdc:mga03683_553896_c1
429 nmdc:mga00v17_87134_c1
430 nmdc:mga0yw44_1126800_c1
431 nmdc:mga0yw44_24471_c1
432 nmdc:mga0yw44_25017_c1
433 nmdc:mga0yw44_355596_c1
434 nmdc:mga05p37_1182116_c1
435 nmdc:mga05p37_1945403_c1
436 nmdc:mga0qj67_443431_c1
437 nmdc:mga06r32_1081108_c1
438 nmdc:mga06r32_207002_c1
439 nmdc:mga06r32_75232_c1
440 nmdc:mga08y16_1129361_c1
441 nmdc:mga08y16_568952_c1
442 nmdc:mga08y16_727534_c1
443 nmdc:mga0rr50_13848_c1
444 Ga0500562_008206
445 Ga0500616_0004733
446 Ga0530510_1369837

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map