F335407

General Info

Members Datasets Scaffolds Average Seq Length
223 143 446 161

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100110456|Ga0068860_1001104562
Length 178
Sequence MSRHHRGRDSHRRRLVGDVGMVPLHVVLVHPEIHWNAGNAGRSCLATGATLHLIQPLGFSLAERHLRRAGLDYWKHVDLKLWTDWNSFEQQLPDLGEAFFFSTRATRSLWAAPLATTKGAVLIFGSEGKGLPPELYERYRERLFGMPILSPEVRSLNLSTSVGIALYETLRQRKANGI

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
89 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
113 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
114 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
115 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.04
Rhizosphere 95.07
Stem 0
Stem Tuber 0
Unclassified 11.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100110456 3300005843 Unclassified 2628
2 Ga0065715_10012135 3300005293 Bacteria 2670
3 Ga0070658_10282337 3300005327 Bacteria 1413
4 Ga0070670_100001066 3300005331 Bacteria 21769
5 Ga0070666_10028514 3300005335 Bacteria 3664
6 Ga0070666_10486193 3300005335 Bacteria 894
7 Ga0070680_100021724 3300005336 Bacteria 5103
8 Ga0070682_100186653 3300005337 Bacteria 1453
9 Ga0070682_100883126 3300005337 Bacteria 733
10 Ga0068868_100036233 3300005338 Bacteria 3817
11 Ga0068868_100057376 3300005338 Bacteria 3076
12 Ga0068868_100407565 3300005338 Bacteria 1174
13 Ga0070689_100278768 3300005340 Bacteria 1386
14 Ga0070687_100149485 3300005343 Bacteria 1369
15 Ga0070661_100022518 3300005344 Bacteria 4512
16 Ga0070661_100162983 3300005344 Bacteria 1689
17 Ga0070675_100052508 3300005354 Bacteria 3351
18 Ga0070675_100078449 3300005354 Bacteria 2750
19 Ga0070671_100036698 3300005355 Bacteria 4065
20 Ga0070673_100003739 3300005364 Bacteria 9542
21 Ga0070673_100080502 3300005364 Bacteria 2639
22 Ga0070688_100007393 3300005365 Bacteria 5918
23 Ga0070688_100103389 3300005365 Bacteria 1882
24 Ga0070659_100048958 3300005366 Bacteria 3322
25 Ga0070667_100004960 3300005367 Bacteria 11150
26 Ga0070667_100535604 3300005367 Bacteria 1075
27 Ga0070701_10324150 3300005438 Unclassified 954
28 Ga0070706_100323910 3300005467 Bacteria 1437
29 Ga0070707_100217639 3300005468 Bacteria 1861
30 Ga0070679_100033934 3300005530 Bacteria 5055
31 Ga0070679_100112338 3300005530 Bacteria 2710
32 Ga0070679_100244464 3300005530 Bacteria 1751
33 Ga0070684_100098975 3300005535 Bacteria 2602
34 Ga0068853_100000574 3300005539 Bacteria 25106
35 Ga0070672_100011422 3300005543 Bacteria 6193
36 Ga0070672_100014940 3300005543 Bacteria 5514
37 Ga0070665_100253702 3300005548 Bacteria 1760
38 Ga0070665_100263957 3300005548 Bacteria 1723
39 Ga0070665_100313533 3300005548 Bacteria 1572
40 Ga0068855_100161301 3300005563 Bacteria 2544
41 Ga0068855_100329085 3300005563 Bacteria 1687
42 Ga0070664_100000389 3300005564 Bacteria 32754
43 Ga0070664_100008833 3300005564 Bacteria 8166
44 Ga0068857_100029345 3300005577 Bacteria 4854
45 Ga0068859_100002929 3300005617 Bacteria 17332
46 Ga0068859_100006504 3300005617 Bacteria 11861
47 Ga0068859_100034696 3300005617 Bacteria 5063
48 Ga0068859_101458926 3300005617 Unclassified 755
49 Ga0068864_100001026 3300005618 Bacteria 23370
50 Ga0068864_100114781 3300005618 Bacteria 2402
51 Ga0068864_100184446 3300005618 Bacteria 1909
52 Ga0068864_101522594 3300005618 Bacteria 672
53 Ga0068861_100103087 3300005719 Bacteria 2273
54 Ga0068863_100003832 3300005841 Bacteria 14871
55 Ga0068863_100005751 3300005841 Bacteria 12165
56 Ga0068863_100084094 3300005841 Bacteria 3016
57 Ga0068858_100077876 3300005842 Bacteria 3080
58 Ga0068858_100334416 3300005842 Bacteria 1449
59 Ga0068858_101235497 3300005842 Bacteria 735
60 Ga0068860_100003372 3300005843 Bacteria 16429
61 Ga0068860_100190666 3300005843 Bacteria 1984
62 Ga0068860_101269554 3300005843 Bacteria 757
63 Ga0097621_100019421 3300006237 Bacteria 5215
64 Ga0068871_100213803 3300006358 Bacteria 1668
65 Ga0068871_100346430 3300006358 Bacteria 1313
66 Ga0075434_100078028 3300006871 Bacteria 3307
67 Ga0068865_100208875 3300006881 Bacteria 1520
68 Ga0097620_100002929 3300006931 Bacteria 17332
69 Ga0097620_100006504 3300006931 Bacteria 11861
70 Ga0097620_100034696 3300006931 Bacteria 5063
71 Ga0097620_101459120 3300006931 Unclassified 755
72 Ga0105240_10011515 3300009093 Bacteria 12311
73 Ga0111539_10608117 3300009094 Bacteria 1273
74 Ga0105245_10358902 3300009098 Bacteria 1446
75 Ga0105245_11400780 3300009098 Bacteria 749
76 Ga0105241_11485038 3300009174 Bacteria 652
77 Ga0105248_10001392 3300009177 Bacteria 26976
78 Ga0105248_10001746 3300009177 Bacteria 24183
79 Ga0105248_10142149 3300009177 Bacteria 2707
80 Ga0105248_11742992 3300009177 Unclassified 706
81 Ga0105248_12244685 3300009177 Unclassified 621
82 Ga0105248_12288360 3300009177 Bacteria 615
83 Ga0105248_12574865 3300009177 Bacteria 580
84 Ga0105237_10006159 3300009545 Bacteria 13409
85 Ga0105237_11165618 3300009545 Bacteria 777
86 Ga0105238_10004832 3300009551 Bacteria 13332
87 Ga0105238_10021723 3300009551 Bacteria 6537
88 Ga0105239_10893694 3300010375 Bacteria 1019
89 Ga0157374_10196472 3300013296 Bacteria 1974
90 Ga0157374_10299747 3300013296 Bacteria 1590
91 Ga0163162_10002996 3300013306 Bacteria 16138
92 Ga0163162_10005330 3300013306 Bacteria 12409
93 Ga0163162_10067205 3300013306 Bacteria 3634
94 Ga0157375_10006527 3300013308 Bacteria 10154
95 Ga0157375_10006861 3300013308 Bacteria 9929
96 Ga0157375_10525955 3300013308 Unclassified 1346
97 Ga0163163_10001890 3300014325 Bacteria 17718
98 Ga0163163_10002892 3300014325 Bacteria 14516
99 Ga0163163_10504533 3300014325 Bacteria 1272
100 Ga0163163_10581465 3300014325 Bacteria 1183
101 Ga0157377_10103778 3300014745 Bacteria 1698
102 Ga0157379_10022097 3300014968 Bacteria 5638
103 Ga0207680_10002183 3300025903 Bacteria 9170
104 Ga0207705_10030267 3300025909 Bacteria 3862
105 Ga0207695_10009129 3300025913 Bacteria 12309
106 Ga0207671_10001769 3300025914 Bacteria 24275
107 Ga0207660_10127686 3300025917 Bacteria 1932
108 Ga0207649_10019253 3300025920 Bacteria 3899
109 Ga0207652_10009294 3300025921 Bacteria 7903
110 Ga0207652_10016551 3300025921 Bacteria 6022
111 Ga0207652_10154870 3300025921 Bacteria 2053
112 Ga0207646_10274091 3300025922 Bacteria 1525
113 Ga0207694_10021288 3300025924 Bacteria 4913
114 Ga0207694_10092255 3300025924 Bacteria 2390
115 Ga0207650_10002112 3300025925 Bacteria 13883
116 Ga0207659_10197770 3300025926 Bacteria 1603
117 Ga0207687_10930698 3300025927 Bacteria 744
118 Ga0207644_10022768 3300025931 Bacteria 4283
119 Ga0207686_11340729 3300025934 Bacteria 588
120 Ga0207669_10154942 3300025937 Bacteria 1610
121 Ga0207704_10373396 3300025938 Bacteria 1117
122 Ga0207704_11266410 3300025938 Unclassified 630
123 Ga0207691_10024057 3300025940 Bacteria 5729
124 Ga0207691_10072728 3300025940 Bacteria 3101
125 Ga0207711_10059023 3300025941 Bacteria 3302
126 Ga0207711_10089322 3300025941 Bacteria 2707
127 Ga0207711_10469205 3300025941 Bacteria 1172
128 Ga0207689_10723169 3300025942 Unclassified 840
129 Ga0207679_10002816 3300025945 Bacteria 10792
130 Ga0207679_10007888 3300025945 Bacteria 6765
131 Ga0207667_10114771 3300025949 Bacteria 2776
132 Ga0207667_10472050 3300025949 Bacteria 1274
133 Ga0207651_10058451 3300025960 Bacteria 2665
134 Ga0207658_10012606 3300025986 Bacteria 5772
135 Ga0207658_10081854 3300025986 Bacteria 2477
136 Ga0207677_10023192 3300026023 Bacteria 3828
137 Ga0207677_10915634 3300026023 Bacteria 791
138 Ga0207703_10034897 3300026035 Bacteria 3994
139 Ga0207703_10075753 3300026035 Bacteria 2789
140 Ga0207703_10822693 3300026035 Bacteria 887
141 Ga0207639_10004320 3300026041 Bacteria 9578
142 Ga0207678_10191749 3300026067 Bacteria 1747
143 Ga0207702_10140532 3300026078 Bacteria 2184
144 Ga0207641_10008833 3300026088 Bacteria 8321
145 Ga0207641_10040240 3300026088 Bacteria 3912
146 Ga0207641_10267696 3300026088 Bacteria 1602
147 Ga0207676_10614705 3300026095 Bacteria 1045
148 Ga0207676_11780446 3300026095 Unclassified 614
149 Ga0207676_12140642 3300026095 Unclassified 558
150 Ga0207674_10074181 3300026116 Bacteria 3414
151 Ga0207675_100169046 3300026118 Bacteria 2089
152 Ga0268266_10340130 3300028379 Bacteria 1408
153 Ga0268265_11370091 3300028380 Bacteria 709
154 Ga0268264_10095559 3300028381 Bacteria 2572
155 Ga0268264_10234277 3300028381 Bacteria 1697
156 Ga0268264_10741259 3300028381 Unclassified 978
157 Ga0265319_1012311 3300028563 Bacteria 3464
158 Ga0265319_1038475 3300028563 Bacteria 1626
159 Ga0265334_10013462 3300028573 Bacteria 3423
160 Ga0265318_10000224 3300028577 Bacteria 48801
161 Ga0265318_10082853 3300028577 Bacteria 1184
162 Ga0265336_10089977 3300028666 Bacteria 915
163 Ga0265330_10001256 3300031235 Bacteria 14851
164 Ga0265332_10000354 3300031238 Bacteria 34321
165 Ga0265328_10000328 3300031239 Bacteria 22160
166 Ga0265320_10001711 3300031240 Bacteria 15588
167 Ga0265329_10000176 3300031242 Bacteria 32304
168 Ga0265339_10054713 3300031249 Bacteria 2167
169 Ga0265331_10000375 3300031250 Bacteria 46599
170 Ga0265316_10000010 3300031344 Bacteria 230553
171 Ga0265316_10002211 3300031344 Bacteria 20448
172 Ga0265313_10005208 3300031595 Bacteria 9641
173 Ga0265313_10013426 3300031595 Bacteria 4917
174 Ga0265314_10004177 3300031711 Bacteria 13575
175 Ga0265342_10000368 3300031712 Bacteria 49570
176 Ga0265342_10125876 3300031712 Bacteria 1439
177 Ga0316576_10775127 3300031727 Bacteria 691
178 Ga0316578_10202078 3300031728 Bacteria 1196
179 Ga0316578_10232838 3300031728 Unclassified 1106
180 Ga0307405_11164526 3300031731 Bacteria 665
181 Ga0316577_10034531 3300031733 Unclassified 2826
182 Ga0373956_0258045 3300035119 Unclassified 829
183 Ga0373955_0453096 3300035172 Bacteria 782
184 Ga0316574_0282586 3300035398 Bacteria 1057
185 Ga0373937_0099097 3300036401 Unclassified 2703
186 Ga0316584_0055795 3300036712 Bacteria 2958
187 Ga0316584_0257316 3300036712 Bacteria 1274
188 Ga0400490_25321 3300038726 Bacteria 32753
189 Ga0400489_94710 3300039093 Bacteria 1521
190 Ga0451789_0608977 3300041443 Bacteria 750
191 Ga0451800_1248009 3300041459 Bacteria 574
192 Ga0451577_0158920 3300042876 Bacteria 2035
193 Ga0453684_0000116 3300044712 Bacteria 352304
194 Ga0453684_1148418 3300044712 Bacteria 818
195 Ga0453684_1233399 3300044712 Unclassified 783
196 Ga0466957_0113895 3300044842 Bacteria 1718
197 Ga0466967_2559521 3300045976 Unclassified 505
198 Ga0495629_0433073 3300046459 Bacteria 892
199 Ga0495639_0237332 3300046475 Bacteria 899
200 Ga0495608_0049715 3300046511 Bacteria 2783
201 Ga0495618_0072904 3300046514 Unclassified 2185
202 Ga0495630_0513481 3300046517 Bacteria 919
203 Ga0495667_0000235 3300046559 Bacteria 36357
204 Ga0495634_0304993 3300046642 Unclassified 962
205 Ga0495657_0048039 3300046675 Bacteria 2880
206 Ga0495613_0013013 3300046689 Bacteria 6183
207 Ga0495613_0659734 3300046689 Bacteria 691
208 Ga0495674_0132257 3300047319 Unclassified 2101
209 Ga0495672_0024694 3300047320 Bacteria 3866
210 Ga0495675_0342852 3300047444 Unclassified 880
211 Ga0495684_0421531 3300047471 Unclassified 933
212 Ga0495684_0801888 3300047471 Bacteria 615
213 Ga0496100_0590021 3300048903 Bacteria 862
214 Ga0496102_0169479 3300048905 Bacteria 2055
215 Ga0496107_0080808 3300048910 Bacteria 2371
216 Ga0496108_0416634 3300048911 Bacteria 1173
217 Ga0496111_0418805 3300048914 Bacteria 989
218 Ga0496113_0289078 3300048916 Bacteria 1311
219 Ga0496114_0733428 3300048917 Unclassified 865
220 Ga0501039_0486375 3300049575 Bacteria 969
221 nmdc:mga0n895_530045_c1 3300050512 Bacteria 1185
222 nmdc:mga0rr50_272061_c1 3300050513 Bacteria 1412
223 Ga0495619_0087878 3300053085 Unclassified 2102
224 Ga0068860_100110456
225 Ga0065715_10012135
226 Ga0070658_10282337
227 Ga0070670_100001066
228 Ga0070666_10028514
229 Ga0070666_10486193
230 Ga0070680_100021724
231 Ga0070682_100186653
232 Ga0070682_100883126
233 Ga0068868_100036233
234 Ga0068868_100057376
235 Ga0068868_100407565
236 Ga0070689_100278768
237 Ga0070687_100149485
238 Ga0070661_100022518
239 Ga0070661_100162983
240 Ga0070675_100052508
241 Ga0070675_100078449
242 Ga0070671_100036698
243 Ga0070673_100003739
244 Ga0070673_100080502
245 Ga0070688_100007393
246 Ga0070688_100103389
247 Ga0070659_100048958
248 Ga0070667_100004960
249 Ga0070667_100535604
250 Ga0070701_10324150
251 Ga0070706_100323910
252 Ga0070707_100217639
253 Ga0070679_100033934
254 Ga0070679_100112338
255 Ga0070679_100244464
256 Ga0070684_100098975
257 Ga0068853_100000574
258 Ga0070672_100011422
259 Ga0070672_100014940
260 Ga0070665_100253702
261 Ga0070665_100263957
262 Ga0070665_100313533
263 Ga0068855_100161301
264 Ga0068855_100329085
265 Ga0070664_100000389
266 Ga0070664_100008833
267 Ga0068857_100029345
268 Ga0068859_100002929
269 Ga0068859_100006504
270 Ga0068859_100034696
271 Ga0068859_101458926
272 Ga0068864_100001026
273 Ga0068864_100114781
274 Ga0068864_100184446
275 Ga0068864_101522594
276 Ga0068861_100103087
277 Ga0068863_100003832
278 Ga0068863_100005751
279 Ga0068863_100084094
280 Ga0068858_100077876
281 Ga0068858_100334416
282 Ga0068858_101235497
283 Ga0068860_100003372
284 Ga0068860_100190666
285 Ga0068860_101269554
286 Ga0097621_100019421
287 Ga0068871_100213803
288 Ga0068871_100346430
289 Ga0075434_100078028
290 Ga0068865_100208875
291 Ga0097620_100002929
292 Ga0097620_100006504
293 Ga0097620_100034696
294 Ga0097620_101459120
295 Ga0105240_10011515
296 Ga0111539_10608117
297 Ga0105245_10358902
298 Ga0105245_11400780
299 Ga0105241_11485038
300 Ga0105248_10001392
301 Ga0105248_10001746
302 Ga0105248_10142149
303 Ga0105248_11742992
304 Ga0105248_12244685
305 Ga0105248_12288360
306 Ga0105248_12574865
307 Ga0105237_10006159
308 Ga0105237_11165618
309 Ga0105238_10004832
310 Ga0105238_10021723
311 Ga0105239_10893694
312 Ga0157374_10196472
313 Ga0157374_10299747
314 Ga0163162_10002996
315 Ga0163162_10005330
316 Ga0163162_10067205
317 Ga0157375_10006527
318 Ga0157375_10006861
319 Ga0157375_10525955
320 Ga0163163_10001890
321 Ga0163163_10002892
322 Ga0163163_10504533
323 Ga0163163_10581465
324 Ga0157377_10103778
325 Ga0157379_10022097
326 Ga0207680_10002183
327 Ga0207705_10030267
328 Ga0207695_10009129
329 Ga0207671_10001769
330 Ga0207660_10127686
331 Ga0207649_10019253
332 Ga0207652_10009294
333 Ga0207652_10016551
334 Ga0207652_10154870
335 Ga0207646_10274091
336 Ga0207694_10021288
337 Ga0207694_10092255
338 Ga0207650_10002112
339 Ga0207659_10197770
340 Ga0207687_10930698
341 Ga0207644_10022768
342 Ga0207686_11340729
343 Ga0207669_10154942
344 Ga0207704_10373396
345 Ga0207704_11266410
346 Ga0207691_10024057
347 Ga0207691_10072728
348 Ga0207711_10059023
349 Ga0207711_10089322
350 Ga0207711_10469205
351 Ga0207689_10723169
352 Ga0207679_10002816
353 Ga0207679_10007888
354 Ga0207667_10114771
355 Ga0207667_10472050
356 Ga0207651_10058451
357 Ga0207658_10012606
358 Ga0207658_10081854
359 Ga0207677_10023192
360 Ga0207677_10915634
361 Ga0207703_10034897
362 Ga0207703_10075753
363 Ga0207703_10822693
364 Ga0207639_10004320
365 Ga0207678_10191749
366 Ga0207702_10140532
367 Ga0207641_10008833
368 Ga0207641_10040240
369 Ga0207641_10267696
370 Ga0207676_10614705
371 Ga0207676_11780446
372 Ga0207676_12140642
373 Ga0207674_10074181
374 Ga0207675_100169046
375 Ga0268266_10340130
376 Ga0268265_11370091
377 Ga0268264_10095559
378 Ga0268264_10234277
379 Ga0268264_10741259
380 Ga0265319_1012311
381 Ga0265319_1038475
382 Ga0265334_10013462
383 Ga0265318_10000224
384 Ga0265318_10082853
385 Ga0265336_10089977
386 Ga0265330_10001256
387 Ga0265332_10000354
388 Ga0265328_10000328
389 Ga0265320_10001711
390 Ga0265329_10000176
391 Ga0265339_10054713
392 Ga0265331_10000375
393 Ga0265316_10000010
394 Ga0265316_10002211
395 Ga0265313_10005208
396 Ga0265313_10013426
397 Ga0265314_10004177
398 Ga0265342_10000368
399 Ga0265342_10125876
400 Ga0316576_10775127
401 Ga0316578_10202078
402 Ga0316578_10232838
403 Ga0307405_11164526
404 Ga0316577_10034531
405 Ga0373956_0258045
406 Ga0373955_0453096
407 Ga0316574_0282586
408 Ga0373937_0099097
409 Ga0316584_0055795
410 Ga0316584_0257316
411 Ga0400490_25321
412 Ga0400489_94710
413 Ga0451789_0608977
414 Ga0451800_1248009
415 Ga0451577_0158920
416 Ga0453684_0000116
417 Ga0453684_1148418
418 Ga0453684_1233399
419 Ga0466957_0113895
420 Ga0466967_2559521
421 Ga0495629_0433073
422 Ga0495639_0237332
423 Ga0495608_0049715
424 Ga0495618_0072904
425 Ga0495630_0513481
426 Ga0495667_0000235
427 Ga0495634_0304993
428 Ga0495657_0048039
429 Ga0495613_0013013
430 Ga0495613_0659734
431 Ga0495674_0132257
432 Ga0495672_0024694
433 Ga0495675_0342852
434 Ga0495684_0421531
435 Ga0495684_0801888
436 Ga0496100_0590021
437 Ga0496102_0169479
438 Ga0496107_0080808
439 Ga0496108_0416634
440 Ga0496111_0418805
441 Ga0496113_0289078
442 Ga0496114_0733428
443 Ga0501039_0486375
444 nmdc:mga0n895_530045_c1
445 nmdc:mga0rr50_272061_c1
446 Ga0495619_0087878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

23

167

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l8u-assembly1.cif.gz_A crystal structure of smu.1707c, a putative rrna methyltransferase from streptococcus mutans ua159 0.9498 4 156
3l8u-assembly1.cif.gz_B crystal structure of smu.1707c, a putative rrna methyltransferase from streptococcus mutans ua159 0.9458 4 156
5co4-assembly1.cif.gz_B structural insights into the 2-oh methylation of c/u34 on trna 0.9151 1 157
4pzk-assembly1.cif.gz_B crystal strucrure of putative rna methyltransferase from bacillus anthracis. 0.9102 5 160
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9079 3 157
ID Description Score Start End Superfamily
3l8uA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9498 4 156 3.40.1280.10
4pzkB00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9102 5 160 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9079 3 157 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.891 3 157 3.40.1280.10
3l8uA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8846 4 156 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A7V4L968-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9673 4 158 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757
AF-A0A257V5N0-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9572 1 161 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A2V6Y9R2-F1-model_v4 tRNA (Cytidine(34)-2'-O)-methyltransferase 0.9555 34 139 GO:0002130
GO:0003723
GO:0008173
AF-A0A844G4I2-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9543 4 159 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757
AF-A0A1E3Y7K4-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9531 3 162 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102

Map