F335385

General Info

Members Datasets Scaffolds Average Seq Length
223 168 178 199

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100231666|Ga0068854_1002316662
Length 220
Sequence VKAQIELSVKLIYETYAKWEVILAVKRRAETMKENRAKLIGAARKAFAALGFAEASMDELTAQVGLTRGALYHGFGDKKGLLAAVVAQVDGEMAVRAQEMAAAAATPWERLLAEGDAYIEMALDPEVRRIVLLDGPAFLGDPSRWPSQNACLNITKQAVSDLIAGGVMKPVDIEAASRLLSGAAFNAALWVAASDEPQIVLPKAIEAFRLMAEGFLVDRE

Samples

Sample ID Description Type Environment
1 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
2 2547132181 Kosakonia sacchari SP1 Isolate Stem
3 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
4 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
5 2561511199 Enterobacter sp. R4-368 Isolate Nodule
6 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
7 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
8 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
9 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
10 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
11 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
12 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
13 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
14 2643221557 Ensifer sp. Root558 Isolate Unclassified
15 2643221558 Rhizobium sp. Root149 Isolate Unclassified
16 2643221610 Ensifer sp. Root74 Isolate Unclassified
17 2643221668 Ensifer sp. Root423 Isolate Unclassified
18 2643221675 Ensifer sp. Root1298 Isolate Unclassified
19 2643221680 Ensifer sp. Root1312 Isolate Unclassified
20 2643221693 Rhizobium sp. Root491 Isolate Unclassified
21 2643221726 Ensifer sp. Root954 Isolate Unclassified
22 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
23 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
24 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
25 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
26 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
27 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
28 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
29 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
30 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
31 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
32 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
33 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
34 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
35 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
36 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
37 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
38 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
39 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
40 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
41 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
42 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
99 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
101 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
109 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
114 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
115 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
154 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
155 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
156 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
157 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
158 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
161 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
162 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
163 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
164 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
165 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
166 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
167 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
168 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.82
Metatranscriptomes 0
Isolates 20.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.39
Nodule 5.38
Rhizoplane 7.17
Rhizosphere 35.87
Stem 0.45
Stem Tuber 0
Unclassified 32.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001184 3300002773 Bacteria 12032
2 rootL2_10059571 3300003322 Bacteria 6338
3 rootH1_10123313 3300003323 Bacteria 2698
4 JGI25160J50197_1065686 3300003354 Bacteria 708
5 Ga0055526_1000332 3300003771 Bacteria 39019
6 Ga0055537_1015176 3300003773 Bacteria 1364
7 Ga0055524_1000821 3300003775 Bacteria 20566
8 Ga0058692_1037003 3300003856 Bacteria 879
9 Ga0065704_10001692 3300005289 Bacteria 7507
10 Ga0070666_10024987 3300005335 Bacteria 3893
11 Ga0070660_100935664 3300005339 Bacteria 731
12 Ga0070675_100587667 3300005354 Bacteria 1009
13 Ga0070671_100117582 3300005355 Bacteria 2235
14 Ga0070663_100078877 3300005455 Bacteria 2415
15 Ga0068854_100043000 3300005578 Bacteria 3200
16 Ga0068854_100231666 3300005578 Bacteria 1466
17 Ga0075368_10000272 3300006042 Bacteria 14865
18 Ga0075364_10133802 3300006051 Bacteria 1665
19 Ga0075362_10041397 3300006177 Bacteria 2032
20 Ga0075367_10120672 3300006178 Bacteria 1615
21 Ga0075369_10200666 3300006186 Bacteria 920
22 Ga0075370_10316482 3300006353 Bacteria 929
23 Ga0079104_1001054 3300006946 Bacteria 20899
24 Ga0105251_10013687 3300009011 Bacteria 4524
25 Ga0105244_10060555 3300009036 Bacteria 1907
26 Ga0105244_10092495 3300009036 Bacteria 1486
27 Ga0105237_10000111 3300009545 Bacteria 114572
28 Ga0105238_10022944 3300009551 Bacteria 6361
29 Ga0105239_10000443 3300010375 Bacteria 60452
30 Ga0105239_10603557 3300010375 Bacteria 1252
31 Ga0157373_10095211 3300013100 Bacteria 2096
32 Ga0157371_10004379 3300013102 Bacteria 12347
33 Ga0157371_10005869 3300013102 Bacteria 10261
34 Ga0157370_10000635 3300013104 Bacteria 43790
35 Ga0157369_10001310 3300013105 Bacteria 30925
36 Ga0157372_10002538 3300013307 Bacteria 19804
37 Ga0163161_10071676 3300017792 Bacteria 2536
38 Ga0213876_10000136 3300021384 Bacteria 80323
39 Ga0207425_1037214 3300025245 Bacteria 940
40 Ga0209129_1000104 3300025258 Bacteria 161264
41 Ga0209565_1000062 3300025263 Bacteria 184007
42 Ga0209025_1066173 3300025294 Bacteria 1314
43 Ga0209564_1000484 3300025295 Bacteria 66127
44 Ga0209564_1004278 3300025295 Bacteria 8848
45 Ga0209758_1043291 3300025297 Bacteria 1660
46 Ga0209050_1003232 3300025298 Bacteria 12297
47 Ga0209256_1000042 3300025299 Bacteria 341821
48 Ga0207426_1028261 3300025302 Bacteria 1861
49 Ga0207713_1095195 3300025735 Bacteria 1038
50 Ga0207680_10019371 3300025903 Bacteria 3638
51 Ga0207647_10160965 3300025904 Bacteria 1309
52 Ga0207671_10000087 3300025914 Bacteria 141774
53 Ga0207649_10277782 3300025920 Bacteria 1217
54 Ga0207694_10031060 3300025924 Bacteria 4079
55 Ga0207659_10579294 3300025926 Bacteria 955
56 Ga0207644_10407325 3300025931 Bacteria 1112
57 Ga0207706_10034532 3300025933 Bacteria 4498
58 Ga0207679_10632430 3300025945 Bacteria 967
59 Ga0207667_10849935 3300025949 Bacteria 907
60 Ga0207678_10105695 3300026067 Bacteria 2402
61 Ga0207698_10061554 3300026142 Bacteria 2926
62 Ga0209281_1000402 3300027111 Bacteria 66243
63 Ga0209371_1000005 3300027312 Bacteria 1061740
64 Ga0209371_1000206 3300027312 Bacteria 84144
65 Ga0209371_1005101 3300027312 Bacteria 5380
66 Ga0209282_1244449 3300027666 Bacteria 796
67 Ga0268256_1000006 3300030500 Bacteria 1063991
68 Ga0268256_1000651 3300030500 Bacteria 26449
69 Ga0268256_1004139 3300030500 Bacteria 6165
70 Ga0307513_10050414 3300031456 Bacteria 4500
71 Ga0307408_100466957 3300031548 Bacteria 1098
72 Ga0307405_10921877 3300031731 Bacteria 740
73 Ga0307409_100798289 3300031995 Bacteria 951
74 Ga0439438_014260 3300041405 Bacteria 2369
75 Ga0451802_2055906 3300041460 Bacteria 4658
76 Ga0451806_098117 3300041462 Bacteria 2313
77 Ga0451804_0983100 3300041463 Bacteria 784
78 Ga0451807_1629692 3300041486 Bacteria 756
79 Ga0439448_0001271 3300042005 Bacteria 6456
80 Ga0439448_0015242 3300042005 Bacteria 2326
81 Ga0439432_001535 3300042006 Bacteria 8678
82 Ga0439455_0013522 3300042012 Bacteria 1849
83 Ga0450907_000205 3300042146 Bacteria 21389
84 Ga0439458_0003274 3300042157 Bacteria 3819
85 Ga0466957_0242700 3300044842 Bacteria 1196
86 Ga0466959_0865996 3300045049 Bacteria 603
87 Ga0495617_000051 3300046452 Bacteria 106590
88 Ga0495650_0016618 3300046471 Bacteria 3720
89 Ga0495650_0080636 3300046471 Bacteria 1255
90 Ga0495596_0007836 3300046500 Bacteria 4786
91 Ga0495606_0058794 3300046507 Bacteria 2469
92 Ga0495610_0003575 3300046512 Bacteria 12011
93 Ga0495620_0000223 3300046515 Bacteria 42640
94 Ga0495632_0012052 3300046519 Bacteria 5006
95 Ga0495597_0000067 3300046542 Bacteria 90183
96 Ga0495625_0211048 3300046660 Bacteria 1276
97 Ga0495671_0280302 3300046692 Bacteria 803
98 Ga0495604_0547256 3300047317 Bacteria 747
99 Ga0495673_0027728 3300047469 Bacteria 2691
100 Ga0495686_0000115 3300047472 Bacteria 166876
101 Ga0495686_0191147 3300047472 Bacteria 1180
102 Ga0496100_0004643 3300048903 Bacteria 7311
103 Ga0496101_0004148 3300048904 Bacteria 9077
104 Ga0496102_0120512 3300048905 Bacteria 2450
105 Ga0496102_0164609 3300048905 Bacteria 2087
106 Ga0496102_0312407 3300048905 Bacteria 1481
107 Ga0496106_0000591 3300048909 Bacteria 25938
108 Ga0496106_0320979 3300048909 Bacteria 1243
109 Ga0496109_0650696 3300048912 Bacteria 991
110 Ga0496116_0000393 3300048919 Bacteria 63922
111 Ga0496116_0050350 3300048919 Bacteria 2776
112 Ga0496117_0000002 3300048920 Bacteria 2483758
113 Ga0496117_0001158 3300048920 Bacteria 39630
114 Ga0496117_0001709 3300048920 Bacteria 30456
115 Ga0496117_0105526 3300048920 Bacteria 1770
116 Ga0496118_0000707 3300048921 Bacteria 53851
117 Ga0496118_0000836 3300048921 Bacteria 48947
118 Ga0496118_0001024 3300048921 Bacteria 43494
119 Ga0496118_0063632 3300048921 Bacteria 2712
120 Ga0496118_0096252 3300048921 Bacteria 2018
121 Ga0496119_0000005 3300048922 Bacteria 529799
122 Ga0496119_0000187 3300048922 Bacteria 87651
123 Ga0496119_0000408 3300048922 Bacteria 58851
124 Ga0496119_0037278 3300048922 Bacteria 3161
125 Ga0496120_0000005 3300048923 Bacteria 529797
126 Ga0496120_0000114 3300048923 Bacteria 136671
127 Ga0496120_0000140 3300048923 Bacteria 120103
128 Ga0496120_0000358 3300048923 Bacteria 74781
129 Ga0496120_0000647 3300048923 Bacteria 51285
130 Ga0496121_0000055 3300048924 Bacteria 304572
131 Ga0496121_0000339 3300048924 Bacteria 97504
132 Ga0496121_0001697 3300048924 Bacteria 36188
133 Ga0496121_0084475 3300048924 Bacteria 2503
134 Ga0496121_0234405 3300048924 Bacteria 1283
135 Ga0496122_0000001 3300048925 Bacteria 1827766
136 Ga0496122_0000187 3300048925 Bacteria 143921
137 Ga0496122_0003725 3300048925 Bacteria 19675
138 Ga0496122_0038615 3300048925 Bacteria 3821
139 Ga0496123_0000001 3300048926 Bacteria 1831497
140 Ga0496123_0000095 3300048926 Bacteria 176621
141 Ga0496123_0006272 3300048926 Bacteria 11580
142 Ga0496123_0028873 3300048926 Bacteria 4096
143 Ga0496124_0000060 3300048927 Bacteria 239933
144 Ga0496124_0001072 3300048927 Bacteria 43248
145 Ga0496124_0001462 3300048927 Bacteria 34873
146 Ga0496124_0003547 3300048927 Bacteria 18973
147 Ga0496124_0005163 3300048927 Bacteria 14858
148 Ga0496124_0016262 3300048927 Bacteria 7084
149 Ga0496124_0063471 3300048927 Bacteria 3086
150 Ga0496124_0181297 3300048927 Bacteria 1620
151 Ga0496124_0545880 3300048927 Bacteria 766
152 Ga0496125_0000419 3300048928 Bacteria 78983
153 Ga0496125_0134170 3300048928 Bacteria 1735
154 Ga0496126_0004325 3300048929 Bacteria 17040
155 Ga0496126_0010483 3300048929 Bacteria 9708
156 Ga0496126_0080804 3300048929 Bacteria 2875
157 Ga0496126_0159470 3300048929 Bacteria 1928
158 Ga0496126_0367491 3300048929 Bacteria 1174
159 nmdc:mga03683_106576_c1 3300050489 Bacteria 1236
160 nmdc:mga03n38_139461_c1 3300050490 Bacteria 1210
161 nmdc:mga00v17_331081_c1 3300050491 Bacteria 990
162 nmdc:mga0yw44_175524_c1 3300050492 Bacteria 1409
163 nmdc:mga0k408_89970_c1 3300050493 Bacteria 1803
164 nmdc:mga06z11_109017_c1 3300050494 Bacteria 1531
165 nmdc:mga07m45_295262_c1 3300050496 Bacteria 943
166 nmdc:mga0sz30_150987_c1 3300050516 Bacteria 1028
167 Ga0500643_002857 3300053087 Bacteria 8606
168 Ga0500643_010712 3300053087 Bacteria 3393
169 Ga0500572_000449 3300053111 Bacteria 14311
170 Ga0500608_097499 3300053122 Bacteria 1366
171 Ga0500658_0001732 3300053134 Bacteria 8611
172 Ga0500559_0001169 3300053136 Bacteria 15735
173 Ga0500561_0000191 3300053137 Bacteria 11098
174 Ga0500590_009126 3300053148 Bacteria 4979
175 Ga0500590_070170 3300053148 Bacteria 1743
176 Ga0500638_049188 3300053162 Bacteria 2040
177 Ga0500636_0057440 3300053177 Bacteria 2278
178 Ga0500596_007022 3300053735 Bacteria 1865

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0000067 Ga0495597_0000067_27489_28076 161
2 iso_pu_bacteria 2899845264 2899850176 185
3 3300045049 Ga0466959_0865996 Ga0466959_0865996_17_580 187
4 3300048924 Ga0496121_0234405 Ga0496121_0234405_319_882 187
5 3300053177 Ga0500636_0057440 Ga0500636_0057440_136_699 187
6 3300009036 Ga0105244_10092495 Ga0105244_100924951 188
7 3300048925 Ga0496122_0038615 Ga0496122_0038615_2478_3044 188
8 3300048928 Ga0496125_0000419 Ga0496125_0000419_2049_2615 188
9 3300003354 JGI25160J50197_1065686 JGI25160J50197_10656861 189
10 3300009551 Ga0105238_10022944 Ga0105238_100229444 189
11 3300010375 Ga0105239_10603557 Ga0105239_106035572 189
12 3300025297 Ga0209758_1043291 Ga0209758_10432912 189
13 3300041460 Ga0451802_2055906 Ga0451802_2055906_696_1265 189
14 3300041462 Ga0451806_098117 Ga0451806_098117_1690_2259 189
15 3300041463 Ga0451804_0983100 Ga0451804_0983100_71_640 189
16 3300041486 Ga0451807_1629692 Ga0451807_1629692_156_725 189
17 3300046507 Ga0495606_0058794 Ga0495606_0058794_1528_2097 189
18 3300047317 Ga0495604_0547256 Ga0495604_0547256_35_604 189
19 3300047472 Ga0495686_0191147 Ga0495686_0191147_183_752 189
20 3300048905 Ga0496102_0312407 Ga0496102_0312407_546_1115 189
21 3300048927 Ga0496124_0001462 Ga0496124_0001462_8794_9363 189
22 3300048927 Ga0496124_0545880 Ga0496124_0545880_71_640 189
23 3300048929 Ga0496126_0367491 Ga0496126_0367491_190_759 189
24 3300053111 Ga0500572_000449 Ga0500572_000449_10290_10859 189
25 3300053122 Ga0500608_097499 Ga0500608_097499_251_820 189
26 3300053134 Ga0500658_0001732 Ga0500658_0001732_7549_8118 189
27 3300053136 Ga0500559_0001169 Ga0500559_0001169_14282_14851 189
28 3300053148 Ga0500590_009126 Ga0500590_009126_3796_4365 189
29 3300053148 Ga0500590_070170 Ga0500590_070170_1086_1655 189
30 3300053735 Ga0500596_007022 Ga0500596_007022_587_1156 189
31 3300046471 Ga0495650_0080636 Ga0495650_0080636_259_834 191
32 3300048927 Ga0496124_0005163 Ga0496124_0005163_4340_4915 191
33 iso_pu_bacteria 2818991448 2819610381 191
34 iso_pu_bacteria 8005645114 8005646192 191
35 iso_pu_bacteria 8006984368 8006986097 191
36 iso_pu_bacteria 8054302542 8054307746 191
37 3300013100 Ga0157373_10095211 Ga0157373_100952113 192
38 3300031456 Ga0307513_10050414 Ga0307513_100504144 192
39 3300042005 Ga0439448_0001271 Ga0439448_0001271_5436_6017 192
40 3300042012 Ga0439455_0013522 Ga0439455_0013522_27_608 192
41 iso_pu_bacteria 2643221557 2643803361 192
42 iso_pu_bacteria 2643221610 2644063728 192
43 iso_pu_bacteria 2643221668 2644375005 192
44 iso_pu_bacteria 2643221675 2644414491 192
45 iso_pu_bacteria 2643221680 2644448019 192
46 iso_pu_bacteria 2643221726 2644690492 192
47 iso_pu_bacteria 2513237146 2513924713 193
48 iso_pu_bacteria 2554235003 2554247541 193
49 iso_pu_bacteria 2558860242 2559294672 193
50 iso_pu_bacteria 2599185156 2599334418 193
51 iso_pu_bacteria 2599185170 2599416269 193
52 iso_pu_bacteria 2643221693 2644518343 193
53 iso_pu_bacteria 2739367756 2739790667 193
54 iso_pu_bacteria 2838035591 2838036391 193
55 iso_pu_bacteria 2842482326 2842487106 193
56 iso_pu_bacteria 2926760298 2926760649 193
57 iso_pu_bacteria 2979089926 2979094074 193
58 iso_pu_bacteria 2979095461 2979098544 193
59 iso_pu_bacteria 650716007 650739876 193
60 iso_pu_bacteria 2599185359 2600225838 194
61 iso_pu_bacteria 2643221558 2643811509 194
62 iso_pu_bacteria 2718218334 2721027398 194
63 iso_pu_bacteria 2844528606 2844529741 194
64 iso_pu_bacteria 2945951305 2945955841 194
65 3300003322 rootL2_10059571 rootL2_100595713 195
66 3300003323 rootH1_10123313 rootH1_101233133 195
67 3300044842 Ga0466957_0242700 Ga0466957_0242700_528_1121 195
68 iso_pu_bacteria 2885383462 2885389925 195
69 iso_pu_bacteria 2935810662 2935816352 195
70 iso_pu_bacteria 2936037263 2936042695 195
71 3300003775 Ga0055524_1000821 Ga0055524_100082113 196
72 3300005289 Ga0065704_10001692 Ga0065704_100016925 196
73 3300006946 Ga0079104_1001054 Ga0079104_100105412 196
74 3300013102 Ga0157371_10005869 Ga0157371_1000586910 196
75 3300025294 Ga0209025_1066173 Ga0209025_10661732 196
76 3300025299 Ga0209256_1000042 Ga0209256_1000042269 196
77 3300025735 Ga0207713_1095195 Ga0207713_10951951 196
78 3300027111 Ga0209281_1000402 Ga0209281_100040231 196
79 3300031995 Ga0307409_100798289 Ga0307409_1007982892 196
80 3300042006 Ga0439432_001535 Ga0439432_001535_1067_1657 196
81 3300048921 Ga0496118_0096252 Ga0496118_0096252_156_746 196
82 3300048924 Ga0496121_0001697 Ga0496121_0001697_9357_9947 196
83 3300048925 Ga0496122_0003725 Ga0496122_0003725_9607_10197 196
84 3300048926 Ga0496123_0006272 Ga0496123_0006272_1525_2115 196
85 3300048927 Ga0496124_0001072 Ga0496124_0001072_32367_32957 196
86 3300048929 Ga0496126_0004325 Ga0496126_0004325_13654_14244 196
87 iso_pu_bacteria 2602042109 2603867179 196
88 iso_pu_bacteria 2935675223 2935677346 196
89 3300005339 Ga0070660_100935664 Ga0070660_1009356641 197
90 3300006042 Ga0075368_10000272 Ga0075368_1000027217 197
91 3300006051 Ga0075364_10133802 Ga0075364_101338023 197
92 3300006177 Ga0075362_10041397 Ga0075362_100413973 197
93 3300006178 Ga0075367_10120672 Ga0075367_101206723 197
94 3300006186 Ga0075369_10200666 Ga0075369_102006662 197
95 3300006353 Ga0075370_10316482 Ga0075370_103164822 197
96 3300013102 Ga0157371_10004379 Ga0157371_100043795 197
97 3300013104 Ga0157370_10000635 Ga0157370_1000063515 197
98 3300025245 Ga0207425_1037214 Ga0207425_10372141 197
99 3300025904 Ga0207647_10160965 Ga0207647_101609652 197
100 3300027312 Ga0209371_1000005 Ga0209371_1000005241 197
101 3300030500 Ga0268256_1000006 Ga0268256_1000006815 197
102 3300031548 Ga0307408_100466957 Ga0307408_1004669571 197
103 3300031731 Ga0307405_10921877 Ga0307405_109218771 197
104 3300046500 Ga0495596_0007836 Ga0495596_0007836_1167_1760 197
105 3300048919 Ga0496116_0050350 Ga0496116_0050350_925_1518 197
106 3300048920 Ga0496117_0000002 Ga0496117_0000002_1143586_1144179 197
107 3300048921 Ga0496118_0000707 Ga0496118_0000707_10624_11217 197
108 3300048922 Ga0496119_0037278 Ga0496119_0037278_966_1559 197
109 3300048923 Ga0496120_0000358 Ga0496120_0000358_10627_11220 197
110 3300048925 Ga0496122_0000001 Ga0496122_0000001_460698_461291 197
111 3300048926 Ga0496123_0000001 Ga0496123_0000001_464429_465022 197
112 3300048927 Ga0496124_0016262 Ga0496124_0016262_5908_6501 197
113 3300048928 Ga0496125_0134170 Ga0496125_0134170_352_945 197
114 3300048929 Ga0496126_0080804 Ga0496126_0080804_359_952 197
115 3300050489 nmdc:mga03683_106576_c1 nmdc:mga03683_106576_c1_10_603 197
116 3300050490 nmdc:mga03n38_139461_c1 nmdc:mga03n38_139461_c1_598_1191 197
117 3300050491 nmdc:mga00v17_331081_c1 nmdc:mga00v17_331081_c1_173_766 197
118 3300050492 nmdc:mga0yw44_175524_c1 nmdc:mga0yw44_175524_c1_174_767 197
119 3300050493 nmdc:mga0k408_89970_c1 nmdc:mga0k408_89970_c1_680_1273 197
120 3300050494 nmdc:mga06z11_109017_c1 nmdc:mga06z11_109017_c1_177_770 197
121 3300050496 nmdc:mga07m45_295262_c1 nmdc:mga07m45_295262_c1_177_770 197
122 3300050516 nmdc:mga0sz30_150987_c1 nmdc:mga0sz30_150987_c1_161_754 197
123 3300053137 Ga0500561_0000191 Ga0500561_0000191_683_1276 197
124 iso_pu_bacteria 2547132181 2547695689 197
125 iso_pu_bacteria 2561511199 2562462360 197
126 iso_pu_bacteria 2609459761 2609910436 197
127 iso_pu_bacteria 2791355010 2792310696 197
128 iso_pu_bacteria 2852387548 2852390074 197
129 iso_pu_bacteria 2894817345 2894821969 197
130 iso_pu_bacteria 2945874760 2945878340 197
131 3300003771 Ga0055526_1000332 Ga0055526_100033213 198
132 3300003773 Ga0055537_1015176 Ga0055537_10151762 198
133 3300005578 Ga0068854_100043000 Ga0068854_1000430005 198
134 3300005578 Ga0068854_100231666 Ga0068854_1002316662 198
135 3300009011 Ga0105251_10013687 Ga0105251_100136874 198
136 3300009545 Ga0105237_10000111 Ga0105237_1000011120 198
137 3300010375 Ga0105239_10000443 Ga0105239_1000044356 198
138 3300017792 Ga0163161_10071676 Ga0163161_100716764 198
139 3300025263 Ga0209565_1000062 Ga0209565_1000062106 198
140 3300025295 Ga0209564_1000484 Ga0209564_100048419 198
141 3300025295 Ga0209564_1004278 Ga0209564_10042788 198
142 3300025298 Ga0209050_1003232 Ga0209050_10032327 198
143 3300025302 Ga0207426_1028261 Ga0207426_10282611 198
144 3300025914 Ga0207671_10000087 Ga0207671_1000008757 198
145 3300025924 Ga0207694_10031060 Ga0207694_100310603 198
146 3300025949 Ga0207667_10849935 Ga0207667_108499351 198
147 3300026142 Ga0207698_10061554 Ga0207698_100615542 198
148 3300027312 Ga0209371_1000206 Ga0209371_100020624 198
149 3300030500 Ga0268256_1000651 Ga0268256_10006515 198
150 3300042146 Ga0450907_000205 Ga0450907_000205_8961_9557 198
151 3300046452 Ga0495617_000051 Ga0495617_000051_10112_10708 198
152 3300046471 Ga0495650_0016618 Ga0495650_0016618_993_1589 198
153 3300046512 Ga0495610_0003575 Ga0495610_0003575_9771_10367 198
154 3300046515 Ga0495620_0000223 Ga0495620_0000223_31984_32580 198
155 3300046519 Ga0495632_0012052 Ga0495632_0012052_1309_1905 198
156 3300046660 Ga0495625_0211048 Ga0495625_0211048_245_841 198
157 3300046692 Ga0495671_0280302 Ga0495671_0280302_154_768 198
158 3300047469 Ga0495673_0027728 Ga0495673_0027728_1422_2018 198
159 3300047472 Ga0495686_0000115 Ga0495686_0000115_158854_159450 198
160 3300048903 Ga0496100_0004643 Ga0496100_0004643_410_1072 198
161 3300048904 Ga0496101_0004148 Ga0496101_0004148_4712_5374 198
162 3300048905 Ga0496102_0120512 Ga0496102_0120512_631_1227 198
163 3300048905 Ga0496102_0164609 Ga0496102_0164609_219_881 198
164 3300048909 Ga0496106_0000591 Ga0496106_0000591_21076_21672 198
165 3300048909 Ga0496106_0320979 Ga0496106_0320979_315_977 198
166 3300048912 Ga0496109_0650696 Ga0496109_0650696_321_932 198
167 3300048919 Ga0496116_0000393 Ga0496116_0000393_42073_42735 198
168 3300048920 Ga0496117_0001158 Ga0496117_0001158_19760_20422 198
169 3300048920 Ga0496117_0105526 Ga0496117_0105526_961_1752 198
170 3300048921 Ga0496118_0001024 Ga0496118_0001024_23204_23866 198
171 3300048922 Ga0496119_0000005 Ga0496119_0000005_402001_402597 198
172 3300048922 Ga0496119_0000187 Ga0496119_0000187_70736_71332 198
173 3300048922 Ga0496119_0000408 Ga0496119_0000408_16105_16767 198
174 3300048923 Ga0496120_0000005 Ga0496120_0000005_340706_341302 198
175 3300048923 Ga0496120_0000140 Ga0496120_0000140_14245_14841 198
176 3300048923 Ga0496120_0000647 Ga0496120_0000647_1502_2164 198
177 3300048924 Ga0496121_0000055 Ga0496121_0000055_233367_233963 198
178 3300048924 Ga0496121_0000339 Ga0496121_0000339_42157_42819 198
179 3300048924 Ga0496121_0084475 Ga0496121_0084475_619_1281 198
180 3300048926 Ga0496123_0028873 Ga0496123_0028873_182_844 198
181 3300048927 Ga0496124_0003547 Ga0496124_0003547_1016_1678 198
182 3300048927 Ga0496124_0063471 Ga0496124_0063471_2410_3066 198
183 3300048927 Ga0496124_0181297 Ga0496124_0181297_82_684 198
184 3300048929 Ga0496126_0010483 Ga0496126_0010483_8803_9405 198
185 3300048929 Ga0496126_0159470 Ga0496126_0159470_271_933 198
186 3300053162 Ga0500638_049188 Ga0500638_049188_1273_1935 198
187 iso_pu_bacteria 2582581308 2585281834 198
188 iso_pu_bacteria 2585427527 2585535248 198
189 iso_pu_bacteria 2615840626 2616312210 198
190 iso_pu_bacteria 2974435778 2974439523 198
191 3300042005 Ga0439448_0015242 Ga0439448_0015242_903_1541 199
192 3300042157 Ga0439458_0003274 Ga0439458_0003274_1383_2021 199
193 3300053087 Ga0500643_002857 Ga0500643_002857_4378_4977 199
194 3300053087 Ga0500643_010712 Ga0500643_010712_848_1447 199
195 3300009036 Ga0105244_10060555 Ga0105244_100605553 200
196 3300013307 Ga0157372_10002538 Ga0157372_100025385 200
197 3300027666 Ga0209282_1244449 Ga0209282_12444491 200
198 3300041405 Ga0439438_014260 Ga0439438_014260_859_1461 200
199 3300048923 Ga0496120_0000114 Ga0496120_0000114_18096_18698 200
200 3300002773 JGI25152J39213_1001184 JGI25152J39213_100118410 201
201 3300003856 Ga0058692_1037003 Ga0058692_10370032 201
202 3300005335 Ga0070666_10024987 Ga0070666_100249874 201
203 3300005354 Ga0070675_100587667 Ga0070675_1005876672 201
204 3300005355 Ga0070671_100117582 Ga0070671_1001175823 201
205 3300005455 Ga0070663_100078877 Ga0070663_1000788774 201
206 3300013105 Ga0157369_10001310 Ga0157369_100013105 201
207 3300021384 Ga0213876_10000136 Ga0213876_1000013656 201
208 3300025258 Ga0209129_1000104 Ga0209129_1000104113 201
209 3300025903 Ga0207680_10019371 Ga0207680_100193712 201
210 3300025920 Ga0207649_10277782 Ga0207649_102777822 201
211 3300025926 Ga0207659_10579294 Ga0207659_105792941 201
212 3300025931 Ga0207644_10407325 Ga0207644_104073252 201
213 3300025933 Ga0207706_10034532 Ga0207706_100345323 201
214 3300025945 Ga0207679_10632430 Ga0207679_106324302 201
215 3300026067 Ga0207678_10105695 Ga0207678_101056952 201
216 3300027312 Ga0209371_1005101 Ga0209371_10051014 201
217 3300030500 Ga0268256_1004139 Ga0268256_10041394 201
218 3300048920 Ga0496117_0001709 Ga0496117_0001709_20023_20631 201
219 3300048921 Ga0496118_0000836 Ga0496118_0000836_12711_13319 201
220 3300048921 Ga0496118_0063632 Ga0496118_0063632_44_652 201
221 3300048925 Ga0496122_0000187 Ga0496122_0000187_136415_137020 201
222 3300048926 Ga0496123_0000095 Ga0496123_0000095_7506_8111 201
223 3300048927 Ga0496124_0000060 Ga0496124_0000060_198602_199210 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21351

TetR_C_41

Tetracyclin repressor-like, C-terminal domain

108

215

0.99

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

39

85

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wm9-assembly2.cif.gz_C crystal structure of tetr family regulator rv0078 from mycobacterium tuberculosis 0.9231 7 195
2hyt-assembly1.cif.gz_A-2 crystal structure of a tetr-family transcriptional regulator (eca1819) from pectobacterium atrosepticum at 1.64 a resolution 0.922 8 195
6hs1-assembly1.cif.gz_B ethr2 in complex with compound 9 (bdm76060) 0.9181 10 196
5n1c-assembly1.cif.gz_B iodinated form of the mycobacterium tuberculosis repressor ethr2 0.9096 10 196
5icj-assembly1.cif.gz_B crystal structure of the mycobacterium tuberculosis transcriptional repressor ethr2 in complex with bdm41420 0.9091 13 196
ID Description Score Start End Superfamily
3bqzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9861 13 59 1.10.10.60
3bt9D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9816 14 59 1.10.10.60
3br3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9799 14 59 1.10.10.60
1jusE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9773 13 59 1.10.10.60
1rpwC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9772 13 59 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A318BGK7-F1-model_v4 deleted 0.9928 6 196
AF-A0A3S3Y8B7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.989 6 197 GO:0003677
AF-A0A5B2TED6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9888 6 196 GO:0000976
GO:0003700
AF-A0A3E0CBG7-F1-model_v4 deleted 0.982 6 195
AF-A0A418ZPF6-F1-model_v4 TetR family transcriptional regulator 0.9802 6 196 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
92.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map