F335251

General Info

Members Datasets Scaffolds Average Seq Length
223 134 446 256

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100006188|Ga0070675_1000061883
Length 280
Sequence MSNPGQASTLSSATAGVGVATVHAVASSRSLKTKLRADHVNMVFGKGDQRVNVLDDISLEVGVGEFVCLLGPSGCGKSTMLNVVAGFLNPTSGQVKIDDQLVIGPDRRRVFVFQERGVFPWLTVEGNIGFGLFDLAESERNSRIKHYVELVGLQGFEKAYPRELSGGMKQRVEVARALSVNPDMLFLDEPFGALDSITRLIMRGELLRIWEAEKKTIIFVTHDIDEAVQLADRVIVMSARPAKIQKVVEIDVAHPRDISSPRYLALRDGILEAIGLAHKV

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 0.9
Rhizosphere 94.17
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100006188 3300005354 Bacteria 9179
2 Ga0070658_10022013 3300005327 Bacteria 5113
3 Ga0070658_10062373 3300005327 Bacteria 3038
4 Ga0070658_10084423 3300005327 Bacteria 2611
5 Ga0070658_10244489 3300005327 Bacteria 1521
6 Ga0070683_100000045 3300005329 Bacteria 97310
7 Ga0070683_100059473 3300005329 Bacteria 3550
8 Ga0070683_100098199 3300005329 Bacteria 2756
9 Ga0070670_100000341 3300005331 Bacteria 39086
10 Ga0070670_100277386 3300005331 Bacteria 1464
11 Ga0068869_100001268 3300005334 Bacteria 14937
12 Ga0070680_100003087 3300005336 Bacteria 12363
13 Ga0070680_100079425 3300005336 Bacteria 2704
14 Ga0070682_100555595 3300005337 Bacteria 899
15 Ga0068868_100003305 3300005338 Bacteria 11219
16 Ga0070660_100002730 3300005339 Bacteria 12125
17 Ga0070661_100066175 3300005344 Bacteria 2655
18 Ga0070659_100003107 3300005366 Bacteria 11812
19 Ga0070659_100022461 3300005366 Bacteria 4817
20 Ga0070708_100004123 3300005445 Bacteria 11408
21 Ga0070663_100000889 3300005455 Bacteria 16234
22 Ga0070663_100145417 3300005455 Bacteria 1814
23 Ga0070663_100204066 3300005455 Bacteria 1544
24 Ga0070681_10079497 3300005458 Bacteria 3236
25 Ga0070681_10090856 3300005458 Bacteria 3004
26 Ga0070681_10116585 3300005458 Bacteria 2607
27 Ga0070681_10678506 3300005458 Bacteria 946
28 Ga0070707_100105491 3300005468 Bacteria 2733
29 Ga0070698_100324416 3300005471 Bacteria 1471
30 Ga0070679_100017786 3300005530 Bacteria 6883
31 Ga0070679_100033907 3300005530 Bacteria 5056
32 Ga0070684_100000169 3300005535 Bacteria 44981
33 Ga0070684_100144342 3300005535 Bacteria 2154
34 Ga0068853_100000122 3300005539 Bacteria 52521
35 Ga0068853_100038500 3300005539 Bacteria 4073
36 Ga0068855_100336471 3300005563 Bacteria 1665
37 Ga0068855_100500939 3300005563 Bacteria 1320
38 Ga0068855_100714558 3300005563 Bacteria 1071
39 Ga0068857_100007480 3300005577 Bacteria 9403
40 Ga0068854_100000070 3300005578 Bacteria 73848
41 Ga0068854_100022745 3300005578 Bacteria 4276
42 Ga0068854_100065563 3300005578 Bacteria 2641
43 Ga0068856_100067184 3300005614 Bacteria 3543
44 Ga0068856_100071397 3300005614 Bacteria 3437
45 Ga0068852_100026405 3300005616 Bacteria 4720
46 Ga0068864_100232309 3300005618 Bacteria 1706
47 Ga0068860_100000612 3300005843 Bacteria 42345
48 Ga0070717_10012045 3300006028 Bacteria 6589
49 Ga0097621_100001248 3300006237 Bacteria 17586
50 Ga0068871_100000496 3300006358 Bacteria 26925
51 Ga0068871_100363052 3300006358 Bacteria 1283
52 Ga0075431_100020849 3300006847 Bacteria 6697
53 Ga0105240_10017058 3300009093 Bacteria 9805
54 Ga0105240_10018698 3300009093 Bacteria 9285
55 Ga0105240_10134912 3300009093 Bacteria 2957
56 Ga0105247_10022904 3300009101 Bacteria 3761
57 Ga0114129_10001157 3300009147 Bacteria 34946
58 Ga0114129_10214018 3300009147 Bacteria 2603
59 Ga0114129_10408346 3300009147 Bacteria 1789
60 Ga0114129_10574092 3300009147 Bacteria 1464
61 Ga0114129_10714128 3300009147 Bacteria 1287
62 Ga0105241_10269639 3300009174 Bacteria 1450
63 Ga0105248_10383275 3300009177 Bacteria 1583
64 Ga0105237_10012040 3300009545 Bacteria 9136
65 Ga0105237_10021975 3300009545 Bacteria 6550
66 Ga0105237_10053264 3300009545 Bacteria 4059
67 Ga0105238_10000001 3300009551 Bacteria 2036163
68 Ga0105238_10137482 3300009551 Bacteria 2421
69 Ga0099796_10013411 3300010159 Bacteria 2340
70 Ga0105246_10057983 3300011119 Bacteria 2682
71 Ga0105246_10375469 3300011119 Bacteria 1173
72 Ga0157370_10006236 3300013104 Bacteria 13207
73 Ga0157370_10009902 3300013104 Bacteria 10101
74 Ga0157370_10025905 3300013104 Bacteria 5798
75 Ga0157370_10057972 3300013104 Bacteria 3680
76 Ga0157369_10004088 3300013105 Bacteria 17277
77 Ga0157369_10038324 3300013105 Bacteria 5241
78 Ga0157369_10039125 3300013105 Bacteria 5184
79 Ga0157369_10045507 3300013105 Bacteria 4772
80 Ga0157369_10079826 3300013105 Bacteria 3504
81 Ga0157374_10000022 3300013296 Bacteria 270307
82 Ga0157378_10002929 3300013297 Bacteria 15182
83 Ga0157372_10022558 3300013307 Bacteria 6813
84 Ga0157372_10044969 3300013307 Bacteria 4895
85 Ga0157372_10060677 3300013307 Bacteria 4231
86 Ga0157375_10000054 3300013308 Bacteria 126807
87 Ga0157375_10000329 3300013308 Bacteria 42630
88 Ga0157377_10000009 3300014745 Bacteria 385287
89 Ga0157376_10000024 3300014969 Bacteria 220018
90 Ga0213873_10013694 3300021358 Bacteria 1783
91 Ga0213872_10042089 3300021361 Bacteria 2083
92 Ga0213876_10000375 3300021384 Bacteria 38082
93 Ga0213875_10018176 3300021388 Bacteria 3391
94 Ga0213871_10008099 3300021441 Bacteria 2302
95 Ga0207710_10156624 3300025900 Bacteria 1107
96 Ga0207647_10058213 3300025904 Bacteria 2367
97 Ga0207643_10110540 3300025908 Bacteria 1619
98 Ga0207705_10003487 3300025909 Bacteria 11967
99 Ga0207705_10033924 3300025909 Bacteria 3647
100 Ga0207705_10085944 3300025909 Bacteria 2298
101 Ga0207705_10138222 3300025909 Bacteria 1818
102 Ga0207707_10072211 3300025912 Bacteria 3008
103 Ga0207695_10179467 3300025913 Bacteria 2039
104 Ga0207671_10277706 3300025914 Bacteria 1321
105 Ga0207660_10028852 3300025917 Bacteria 3801
106 Ga0207660_10030093 3300025917 Bacteria 3730
107 Ga0207660_10056168 3300025917 Bacteria 2816
108 Ga0207662_10030799 3300025918 Bacteria 3115
109 Ga0207657_10001389 3300025919 Bacteria 25831
110 Ga0207652_10004486 3300025921 Bacteria 11352
111 Ga0207652_10265299 3300025921 Bacteria 1549
112 Ga0207694_10000001 3300025924 Bacteria 4078485
113 Ga0207650_10000060 3300025925 Bacteria 150844
114 Ga0207650_10022693 3300025925 Bacteria 4445
115 Ga0207659_10000003 3300025926 Bacteria 523949
116 Ga0207659_10001267 3300025926 Bacteria 15127
117 Ga0207687_10379721 3300025927 Bacteria 1157
118 Ga0207700_10026585 3300025928 Bacteria 4037
119 Ga0207690_10000909 3300025932 Bacteria 18882
120 Ga0207690_10024631 3300025932 Bacteria 3770
121 Ga0207711_10000028 3300025941 Bacteria 214107
122 Ga0207689_10008534 3300025942 Bacteria 8932
123 Ga0207661_10000007 3300025944 Bacteria 471636
124 Ga0207661_10088660 3300025944 Bacteria 2572
125 Ga0207661_10118869 3300025944 Bacteria 2247
126 Ga0207661_10273498 3300025944 Bacteria 1508
127 Ga0207679_10064459 3300025945 Bacteria 2739
128 Ga0207667_10067347 3300025949 Bacteria 3730
129 Ga0207667_10223879 3300025949 Bacteria 1927
130 Ga0207667_10438100 3300025949 Bacteria 1329
131 Ga0207640_10000080 3300025981 Bacteria 75177
132 Ga0207640_10016832 3300025981 Bacteria 4263
133 Ga0207640_10053504 3300025981 Bacteria 2635
134 Ga0207677_10000433 3300026023 Bacteria 28244
135 Ga0207639_10000082 3300026041 Bacteria 82368
136 Ga0207639_10161852 3300026041 Bacteria 1886
137 Ga0207678_10000156 3300026067 Bacteria 56308
138 Ga0207678_10008106 3300026067 Bacteria 9264
139 Ga0207678_10019659 3300026067 Bacteria 5938
140 Ga0207678_10323587 3300026067 Bacteria 1327
141 Ga0207678_10429716 3300026067 Bacteria 1146
142 Ga0207708_10000056 3300026075 Bacteria 97382
143 Ga0207674_10004180 3300026116 Bacteria 17446
144 Ga0207674_10042163 3300026116 Bacteria 4716
145 Ga0207698_10075753 3300026142 Bacteria 2690
146 Ga0268264_10003493 3300028381 Bacteria 13542
147 Ga0307511_10041532 3300030521 Bacteria 3882
148 Ga0265770_1002439 3300030878 Bacteria 2521
149 Ga0265331_10018404 3300031250 Bacteria 3624
150 Ga0265316_10027542 3300031344 Bacteria 4704
151 Ga0265316_10180316 3300031344 Bacteria 1573
152 Ga0265342_10004288 3300031712 Bacteria 11297
153 Ga0265342_10067548 3300031712 Bacteria 2092
154 Ga0373926_0000524 3300035083 Bacteria 10243
155 Ga0373932_0003733 3300035112 Bacteria 3635
156 Ga0373945_0000491 3300035116 Bacteria 11240
157 Ga0373943_0063849 3300035170 Bacteria 1847
158 Ga0373946_0011963 3300035171 Bacteria 3244
159 Ga0373955_0195338 3300035172 Bacteria 1204
160 Ga0373924_0000031 3300035410 Bacteria 36591
161 Ga0373935_0002384 3300035692 Bacteria 10741
162 Ga0373935_0025993 3300035692 Bacteria 3609
163 Ga0373927_0000520 3300035695 Bacteria 29223
164 Ga0373927_0052213 3300035695 Bacteria 2644
165 Ga0373927_0381066 3300035695 Bacteria 930
166 Ga0373947_0009856 3300035725 Bacteria 5483
167 Ga0373937_0097846 3300036401 Bacteria 2722
168 Ga0373925_0000382 3300037068 Bacteria 45731
169 Ga0395900_0141187 3300037418 Bacteria 2467
170 Ga0395898_0226271 3300037466 Bacteria 1784
171 Ga0436364_1386291 3300037853 Bacteria 20302
172 Ga0436365_0047633 3300039437 Bacteria 3344
173 Ga0436365_0123999 3300039437 Bacteria 1804
174 Ga0436365_0571939 3300039437 Bacteria 16163
175 Ga0436365_0896572 3300039437 Bacteria 5987
176 Ga0436365_1058737 3300039437 Bacteria 1333
177 Ga0436360_0655222 3300039438 Bacteria 7050
178 Ga0436363_0529063 3300039450 Bacteria 3630
179 Ga0436362_0933591 3300039453 Bacteria 8162
180 Ga0466970_0394644 3300044765 Bacteria 789
181 Ga0495651_0457380 3300046462 Bacteria 824
182 Ga0495580_0006715 3300046472 Bacteria 9340
183 Ga0495580_0052387 3300046472 Bacteria 2882
184 Ga0495580_0196913 3300046472 Bacteria 1389
185 Ga0495630_0011825 3300046517 Bacteria 6324
186 Ga0495665_0026931 3300046531 Bacteria 3086
187 Ga0495635_0024871 3300046663 Bacteria 4173
188 Ga0495657_0088529 3300046675 Bacteria 1990
189 Ga0495657_0102191 3300046675 Bacteria 1825
190 Ga0495674_0060577 3300047319 Bacteria 3302
191 Ga0495674_0144454 3300047319 Bacteria 1998
192 Ga0495679_006408 3300047446 Bacteria 5071
193 Ga0495602_0018526 3300048088 Bacteria 6950
194 Ga0496102_0566715 3300048905 Bacteria 1058
195 Ga0496113_0413884 3300048916 Bacteria 1083
196 Ga0501033_0111405 3300049570 Bacteria 1992
197 Ga0501033_0154870 3300049570 Bacteria 1652
198 Ga0501034_0009825 3300049571 Bacteria 10005
199 Ga0501037_0084619 3300049573 Bacteria 2297
200 Ga0501038_0324208 3300049574 Bacteria 1204
201 Ga0501039_0374409 3300049575 Bacteria 1119
202 Ga0501043_0155458 3300049579 Bacteria 1789
203 Ga0501047_0078495 3300049581 Bacteria 3175
204 Ga0501047_0084690 3300049581 Bacteria 3047
205 Ga0501047_0252002 3300049581 Bacteria 1614
206 Ga0501047_0255840 3300049581 Bacteria 1599
207 Ga0501069_0099553 3300049585 Bacteria 1650
208 Ga0501070_0284329 3300049586 Bacteria 1349
209 Ga0501070_0316932 3300049586 Bacteria 1269
210 Ga0501073_0206956 3300049589 Bacteria 1356
211 Ga0501035_0159297 3300049822 Bacteria 1955
212 Ga0501035_0191457 3300049822 Bacteria 1758
213 Ga0501044_0001670 3300049823 Bacteria 26059
214 Ga0501044_0002476 3300049823 Bacteria 21067
215 Ga0501044_0052950 3300049823 Bacteria 4178
216 Ga0501044_0096969 3300049823 Bacteria 2970
217 nmdc:mga05p37_103576_c1 3300050507 Bacteria 3502
218 nmdc:mga05p37_126660_c1 3300050507 Bacteria 3136
219 nmdc:mga05p37_146473_c1 3300050507 Unclassified 2891
220 nmdc:mga05p37_79713_c1 3300050507 Bacteria 4032
221 nmdc:mga06r32_25179_c1 3300050510 Bacteria 5532
222 nmdc:mga0n895_383261_c1 3300050512 Bacteria 1422
223 Ga0500595_033315 3300053119 Bacteria 1710
224 Ga0070675_100006188
225 Ga0070658_10022013
226 Ga0070658_10062373
227 Ga0070658_10084423
228 Ga0070658_10244489
229 Ga0070683_100000045
230 Ga0070683_100059473
231 Ga0070683_100098199
232 Ga0070670_100000341
233 Ga0070670_100277386
234 Ga0068869_100001268
235 Ga0070680_100003087
236 Ga0070680_100079425
237 Ga0070682_100555595
238 Ga0068868_100003305
239 Ga0070660_100002730
240 Ga0070661_100066175
241 Ga0070659_100003107
242 Ga0070659_100022461
243 Ga0070708_100004123
244 Ga0070663_100000889
245 Ga0070663_100145417
246 Ga0070663_100204066
247 Ga0070681_10079497
248 Ga0070681_10090856
249 Ga0070681_10116585
250 Ga0070681_10678506
251 Ga0070707_100105491
252 Ga0070698_100324416
253 Ga0070679_100017786
254 Ga0070679_100033907
255 Ga0070684_100000169
256 Ga0070684_100144342
257 Ga0068853_100000122
258 Ga0068853_100038500
259 Ga0068855_100336471
260 Ga0068855_100500939
261 Ga0068855_100714558
262 Ga0068857_100007480
263 Ga0068854_100000070
264 Ga0068854_100022745
265 Ga0068854_100065563
266 Ga0068856_100067184
267 Ga0068856_100071397
268 Ga0068852_100026405
269 Ga0068864_100232309
270 Ga0068860_100000612
271 Ga0070717_10012045
272 Ga0097621_100001248
273 Ga0068871_100000496
274 Ga0068871_100363052
275 Ga0075431_100020849
276 Ga0105240_10017058
277 Ga0105240_10018698
278 Ga0105240_10134912
279 Ga0105247_10022904
280 Ga0114129_10001157
281 Ga0114129_10214018
282 Ga0114129_10408346
283 Ga0114129_10574092
284 Ga0114129_10714128
285 Ga0105241_10269639
286 Ga0105248_10383275
287 Ga0105237_10012040
288 Ga0105237_10021975
289 Ga0105237_10053264
290 Ga0105238_10000001
291 Ga0105238_10137482
292 Ga0099796_10013411
293 Ga0105246_10057983
294 Ga0105246_10375469
295 Ga0157370_10006236
296 Ga0157370_10009902
297 Ga0157370_10025905
298 Ga0157370_10057972
299 Ga0157369_10004088
300 Ga0157369_10038324
301 Ga0157369_10039125
302 Ga0157369_10045507
303 Ga0157369_10079826
304 Ga0157374_10000022
305 Ga0157378_10002929
306 Ga0157372_10022558
307 Ga0157372_10044969
308 Ga0157372_10060677
309 Ga0157375_10000054
310 Ga0157375_10000329
311 Ga0157377_10000009
312 Ga0157376_10000024
313 Ga0213873_10013694
314 Ga0213872_10042089
315 Ga0213876_10000375
316 Ga0213875_10018176
317 Ga0213871_10008099
318 Ga0207710_10156624
319 Ga0207647_10058213
320 Ga0207643_10110540
321 Ga0207705_10003487
322 Ga0207705_10033924
323 Ga0207705_10085944
324 Ga0207705_10138222
325 Ga0207707_10072211
326 Ga0207695_10179467
327 Ga0207671_10277706
328 Ga0207660_10028852
329 Ga0207660_10030093
330 Ga0207660_10056168
331 Ga0207662_10030799
332 Ga0207657_10001389
333 Ga0207652_10004486
334 Ga0207652_10265299
335 Ga0207694_10000001
336 Ga0207650_10000060
337 Ga0207650_10022693
338 Ga0207659_10000003
339 Ga0207659_10001267
340 Ga0207687_10379721
341 Ga0207700_10026585
342 Ga0207690_10000909
343 Ga0207690_10024631
344 Ga0207711_10000028
345 Ga0207689_10008534
346 Ga0207661_10000007
347 Ga0207661_10088660
348 Ga0207661_10118869
349 Ga0207661_10273498
350 Ga0207679_10064459
351 Ga0207667_10067347
352 Ga0207667_10223879
353 Ga0207667_10438100
354 Ga0207640_10000080
355 Ga0207640_10016832
356 Ga0207640_10053504
357 Ga0207677_10000433
358 Ga0207639_10000082
359 Ga0207639_10161852
360 Ga0207678_10000156
361 Ga0207678_10008106
362 Ga0207678_10019659
363 Ga0207678_10323587
364 Ga0207678_10429716
365 Ga0207708_10000056
366 Ga0207674_10004180
367 Ga0207674_10042163
368 Ga0207698_10075753
369 Ga0268264_10003493
370 Ga0307511_10041532
371 Ga0265770_1002439
372 Ga0265331_10018404
373 Ga0265316_10027542
374 Ga0265316_10180316
375 Ga0265342_10004288
376 Ga0265342_10067548
377 Ga0373926_0000524
378 Ga0373932_0003733
379 Ga0373945_0000491
380 Ga0373943_0063849
381 Ga0373946_0011963
382 Ga0373955_0195338
383 Ga0373924_0000031
384 Ga0373935_0002384
385 Ga0373935_0025993
386 Ga0373927_0000520
387 Ga0373927_0052213
388 Ga0373927_0381066
389 Ga0373947_0009856
390 Ga0373937_0097846
391 Ga0373925_0000382
392 Ga0395900_0141187
393 Ga0395898_0226271
394 Ga0436364_1386291
395 Ga0436365_0047633
396 Ga0436365_0123999
397 Ga0436365_0571939
398 Ga0436365_0896572
399 Ga0436365_1058737
400 Ga0436360_0655222
401 Ga0436363_0529063
402 Ga0436362_0933591
403 Ga0466970_0394644
404 Ga0495651_0457380
405 Ga0495580_0006715
406 Ga0495580_0052387
407 Ga0495580_0196913
408 Ga0495630_0011825
409 Ga0495665_0026931
410 Ga0495635_0024871
411 Ga0495657_0088529
412 Ga0495657_0102191
413 Ga0495674_0060577
414 Ga0495674_0144454
415 Ga0495679_006408
416 Ga0495602_0018526
417 Ga0496102_0566715
418 Ga0496113_0413884
419 Ga0501033_0111405
420 Ga0501033_0154870
421 Ga0501034_0009825
422 Ga0501037_0084619
423 Ga0501038_0324208
424 Ga0501039_0374409
425 Ga0501043_0155458
426 Ga0501047_0078495
427 Ga0501047_0084690
428 Ga0501047_0252002
429 Ga0501047_0255840
430 Ga0501069_0099553
431 Ga0501070_0284329
432 Ga0501070_0316932
433 Ga0501073_0206956
434 Ga0501035_0159297
435 Ga0501035_0191457
436 Ga0501044_0001670
437 Ga0501044_0002476
438 Ga0501044_0052950
439 Ga0501044_0096969
440 nmdc:mga05p37_103576_c1
441 nmdc:mga05p37_126660_c1
442 nmdc:mga05p37_146473_c1
443 nmdc:mga05p37_79713_c1
444 nmdc:mga06r32_25179_c1
445 nmdc:mga0n895_383261_c1
446 Ga0500595_033315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

54

192

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hps-assembly1.cif.gz_D lpqy-sugabc in state 5 0.9306 13 230
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.93 13 228
1l2t-assembly1.cif.gz_B dimeric structure of mj0796, a bacterial abc transporter cassette 0.9262 14 229
7cag-assembly1.cif.gz_D mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state 0.926 13 230
2r6g-assembly1.cif.gz_A the crystal structure of the e. coli maltose transporter 0.9257 13 228
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9492 13 250 3.40.50.300
af_Q2G1I6_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9468 14 259 3.40.50.300
af_Q2G1I6_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9391 14 259 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9304 13 250 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9271 12 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1W9VND7-F1-model_v4 ABC transporter domain-containing protein 0.9873 11 86 GO:0005524
GO:0016887
AF-A0A7C6CYV5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9476 17 227 GO:0005524
GO:0016887
AF-A0A7C6CYV5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9338 17 227 GO:0005524
GO:0016887
AF-A0A101DVR9-F1-model_v4 deleted 0.9309 11 215
AF-A0A6B9GGZ8-F1-model_v4 Nitrate ABC transporter ATP-binding protein 0.9268 12 255 GO:0005524
GO:0016887

Map