F335086

General Info

Members Datasets Scaffolds Average Seq Length
222 172 444 269

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006486233|3006493810
Length 294
Sequence TAVFLGIAAASGLLSAGEDALPGQPSAGGGPGGGPGAGTVGAGGGAGPAGGAAGPGGIRAVRPQSPGRTAYRLSPMTAEAPLRPPVARPTVRTRPILELPPAASTAGAMVLTFDDGPDPRYTPAILDTLARYEVPALFFVCGERADENRDLLRRMADEGHVIGNHTWSHPRIPRLSRPGLAHEIASTSELVEKTVGAAPVWFRAPYGAWNRAAFEIGAELGMEPLAWTVDSLDWTEPGTSVIVSRVLQGAAPGVIVLNHDAGGDRSQSVRGLDTYLPQLLARGYRMTLPVLPPR

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
4 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
5 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
6 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
7 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
8 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
9 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
10 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
11 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
12 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
13 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
14 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
15 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
16 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
17 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
18 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
19 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
20 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
21 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
22 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
23 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
24 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
25 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
26 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
27 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
28 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
29 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
30 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
31 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
32 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
33 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
34 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
35 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
36 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
37 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
38 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
39 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
40 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
41 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
42 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
43 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
44 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
45 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
46 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
49 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
50 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
51 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
52 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
53 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
54 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
55 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
56 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
57 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
58 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
59 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
60 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
61 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
65 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
66 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
67 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
68 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
69 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
72 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
73 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
74 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
78 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
79 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
80 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
81 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
84 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
85 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
86 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
87 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
97 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
100 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
113 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
114 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
115 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
117 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
118 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
119 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
120 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
121 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
122 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
123 2643221548 Streptomyces sp. Root55 Isolate Unclassified
124 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
125 2643221647 Streptomyces sp. Root369 Isolate Unclassified
126 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
127 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
128 2643221714 Streptomyces sp. Root264 Isolate Unclassified
129 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
130 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
131 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
132 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
133 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
134 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
135 2808606448 Streptomyces sp. 193411 Isolate Unclassified
136 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
137 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
138 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
139 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
140 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
141 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
142 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
143 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
144 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
145 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
146 2867428634 Streptomyces sp. RP5T Isolate Unclassified
147 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
148 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
149 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
150 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
151 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
152 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
153 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
154 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
155 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
156 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
157 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
158 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
159 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
160 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
161 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
162 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
163 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
164 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
165 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
166 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
167 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
168 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
169 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
170 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
171 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
172 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.32
Metatranscriptomes 0.45
Isolates 25.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0.9
Rhizoplane 0.45
Rhizosphere 76.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10010712 3300003323 Bacteria 2712
2 Ga0006562J51391_1073137 3300003578 Bacteria 2710
3 Ga0068855_100247737 3300005563 Bacteria 1988
4 Ga0075367_10004436 3300006178 Bacteria 6860
5 Ga0105251_10138986 3300009011 Bacteria 1099
6 Ga0157369_10182107 3300013105 Bacteria 2210
7 Ga0182008_10000552 3300014497 Bacteria 27794
8 Ga0182007_10000554 3300015262 Bacteria 22069
9 Ga0183367_1016 3300015688 Bacteria 290198
10 Ga0307517_10005394 3300028786 Bacteria 19304
11 Ga0307515_10000325 3300028794 Bacteria 118141
12 Ga0307511_10000010 3300030521 Bacteria 146716
13 Ga0307512_10000801 3300030522 Bacteria 46484
14 Ga0307512_10112590 3300030522 Bacteria 1785
15 Ga0307508_10005832 3300031616 Bacteria 11635
16 Ga0307508_10026171 3300031616 Bacteria 5288
17 Ga0307514_10020921 3300031649 Bacteria 5332
18 Ga0307516_10031050 3300031730 Bacteria 5388
19 Ga0307516_10045073 3300031730 Bacteria 4358
20 Ga0307516_10393001 3300031730 Bacteria 1047
21 Ga0307518_10263205 3300031838 Bacteria 1084
22 Ga0307507_10013365 3300033179 Bacteria 9977
23 Ga0307507_10065623 3300033179 Bacteria 3336
24 Ga0307507_10106560 3300033179 Bacteria 2314
25 Ga0307510_10016326 3300033180 Bacteria 8764
26 Ga0307510_10030785 3300033180 Bacteria 6077
27 Ga0307510_10189251 3300033180 Bacteria 1608
28 Ga0395900_0208881 3300037418 Bacteria 1972
29 Ga0395900_0334581 3300037418 Bacteria 1491
30 Ga0395898_0021891 3300037466 Bacteria 6476
31 Ga0395898_0039486 3300037466 Bacteria 4672
32 Ga0395901_0642572 3300038443 Bacteria 1065
33 Ga0439436_0004042 3300041404 Bacteria 4496
34 Ga0439439_0007878 3300041406 Bacteria 2503
35 Ga0451853_0544897 3300041512 Bacteria 3148
36 Ga0439442_004678 3300042002 Bacteria 2721
37 Ga0439449_0000106 3300042007 Bacteria 27038
38 Ga0439449_0050634 3300042007 Bacteria 1536
39 Ga0439457_001556 3300042014 Bacteria 6875
40 Ga0439457_003310 3300042014 Bacteria 4404
41 Ga0439462_0016118 3300042015 Bacteria 1929
42 Ga0450894_001379 3300042131 Bacteria 3510
43 Ga0450899_000477 3300042135 Bacteria 4508
44 Ga0450899_009647 3300042135 Bacteria 1065
45 Ga0450903_000617 3300042138 Bacteria 7187
46 Ga0450906_000375 3300042145 Bacteria 9076
47 Ga0439458_0001299 3300042157 Bacteria 6307
48 Ga0466972_0009805 3300044658 Bacteria 4809
49 Ga0466965_0008781 3300044683 Bacteria 4683
50 Ga0466965_0034405 3300044683 Bacteria 2479
51 Ga0466966_0001844 3300044684 Bacteria 13744
52 Ga0466961_0016348 3300044693 Bacteria 4765
53 Ga0466963_0001334 3300044694 Bacteria 13143
54 Ga0466964_0007955 3300044706 Bacteria 3969
55 Ga0466971_0016176 3300044719 Bacteria 3286
56 Ga0466970_0000948 3300044765 Bacteria 14008
57 Ga0466957_0002114 3300044842 Bacteria 10631
58 Ga0466960_0008314 3300044901 Bacteria 4246
59 Ga0466959_0000302 3300045049 Bacteria 29272
60 Ga0466958_0006558 3300045836 Bacteria 6343
61 Ga0466967_0010987 3300045976 Bacteria 6828
62 Ga0466967_0035868 3300045976 Bacteria 4226
63 Ga0495627_038793 3300046453 Bacteria 1471
64 Ga0495592_0003512 3300046454 Bacteria 11243
65 Ga0495592_0031713 3300046454 Bacteria 3992
66 Ga0495629_0027948 3300046459 Bacteria 4006
67 Ga0495629_0084872 3300046459 Bacteria 2209
68 Ga0495651_0024797 3300046462 Bacteria 4665
69 Ga0495651_0074302 3300046462 Bacteria 2579
70 Ga0495605_0007059 3300046474 Bacteria 6403
71 Ga0495662_0002543 3300046476 Bacteria 9207
72 Ga0495664_0002442 3300046477 Bacteria 9997
73 Ga0495594_0036366 3300046499 Bacteria 2685
74 Ga0495596_0088216 3300046500 Bacteria 1204
75 Ga0495596_0101213 3300046500 Bacteria 1118
76 Ga0495583_0161964 3300046506 Bacteria 922
77 Ga0495606_0007987 3300046507 Bacteria 9306
78 Ga0495616_0005451 3300046513 Bacteria 7825
79 Ga0495618_0159157 3300046514 Bacteria 1440
80 Ga0495620_0006968 3300046515 Bacteria 6168
81 Ga0495620_0008315 3300046515 Bacteria 5578
82 Ga0495628_0282040 3300046516 Bacteria 1233
83 Ga0495630_0119250 3300046517 Bacteria 2001
84 Ga0495631_0046678 3300046518 Bacteria 1903
85 Ga0495643_0044523 3300046522 Bacteria 2411
86 Ga0495648_0022100 3300046524 Bacteria 4389
87 Ga0495648_0072267 3300046524 Bacteria 1997
88 Ga0495666_0013036 3300046526 Bacteria 4142
89 Ga0495652_0008129 3300046529 Bacteria 9598
90 Ga0495652_0294546 3300046529 Bacteria 1182
91 Ga0495654_0027546 3300046530 Bacteria 2913
92 Ga0495640_0120040 3300046533 Bacteria 1710
93 Ga0495640_0137395 3300046533 Bacteria 1577
94 Ga0495587_0008540 3300046536 Bacteria 6579
95 Ga0495597_0023729 3300046542 Bacteria 2836
96 Ga0495633_0026168 3300046558 Bacteria 2865
97 Ga0495668_0029210 3300046616 Bacteria 3115
98 Ga0495634_0004450 3300046642 Bacteria 10998
99 Ga0495625_0003742 3300046660 Bacteria 14795
100 Ga0495625_0061414 3300046660 Bacteria 2659
101 Ga0495625_0342493 3300046660 Bacteria 947
102 Ga0495635_0000315 3300046663 Bacteria 31453
103 Ga0495635_0128264 3300046663 Bacteria 1729
104 Ga0495588_0005982 3300046674 Bacteria 5456
105 Ga0495588_0138008 3300046674 Bacteria 1287
106 Ga0495657_0000740 3300046675 Bacteria 29071
107 Ga0495657_0004713 3300046675 Bacteria 10869
108 Ga0495623_0035895 3300046679 Bacteria 3177
109 Ga0495646_0000431 3300046680 Bacteria 22193
110 Ga0495646_0067266 3300046680 Bacteria 2118
111 Ga0495613_0001084 3300046689 Bacteria 20762
112 Ga0495613_0008050 3300046689 Bacteria 7839
113 Ga0495613_0159361 3300046689 Bacteria 1606
114 Ga0495613_0195610 3300046689 Bacteria 1427
115 Ga0495671_0020771 3300046692 Bacteria 3457
116 Ga0495671_0089648 3300046692 Bacteria 1506
117 Ga0495649_0041218 3300046694 Bacteria 2526
118 Ga0495589_0003863 3300046794 Bacteria 8055
119 Ga0495600_0007950 3300046809 Bacteria 6499
120 Ga0495660_0118494 3300046810 Bacteria 1342
121 Ga0495581_0085585 3300047315 Bacteria 1827
122 Ga0495604_0002064 3300047317 Bacteria 16211
123 Ga0495604_0025020 3300047317 Bacteria 4759
124 Ga0495636_0012331 3300047318 Bacteria 3384
125 Ga0495636_0155400 3300047318 Bacteria 1028
126 Ga0495674_0126136 3300047319 Bacteria 2160
127 Ga0495676_0002471 3300047321 Bacteria 16438
128 Ga0495676_0061233 3300047321 Bacteria 2944
129 Ga0495676_0080763 3300047321 Bacteria 2467
130 Ga0495683_0102884 3300047323 Bacteria 1371
131 Ga0495687_002478 3300047443 Bacteria 14733
132 Ga0495687_022133 3300047443 Bacteria 3058
133 Ga0495687_051178 3300047443 Bacteria 1754
134 Ga0495675_0001748 3300047444 Bacteria 13005
135 Ga0495675_0091846 3300047444 Bacteria 1905
136 Ga0495675_0212313 3300047444 Bacteria 1174
137 Ga0495685_008972 3300047447 Bacteria 3333
138 Ga0495685_016905 3300047447 Bacteria 2494
139 Ga0495681_0010032 3300047470 Bacteria 5766
140 Ga0495686_0032538 3300047472 Bacteria 3375
141 Ga0495593_0009828 3300047673 Bacteria 5551
142 Ga0495614_0031345 3300048089 Bacteria 2288
143 Ga0495614_0050740 3300048089 Bacteria 1777
144 Ga0495614_0075998 3300048089 Bacteria 1451
145 Ga0495614_0155139 3300048089 Bacteria 1022
146 Ga0496109_0128690 3300048912 Bacteria 2362
147 Ga0501033_0006124 3300049570 Bacteria 9438
148 Ga0501033_0078428 3300049570 Bacteria 2424
149 Ga0501034_0055969 3300049571 Bacteria 3969
150 Ga0501034_0286188 3300049571 Bacteria 1587
151 Ga0501036_0007405 3300049572 Bacteria 8944
152 Ga0501036_0417464 3300049572 Bacteria 1119
153 Ga0501038_0004105 3300049574 Bacteria 13543
154 Ga0501038_0124941 3300049574 Bacteria 2118
155 Ga0501043_0352336 3300049579 Bacteria 1118
156 Ga0501048_0128416 3300049582 Bacteria 1793
157 Ga0501070_0123481 3300049586 Bacteria 2140
158 Ga0501035_0211913 3300049822 Bacteria 1657
159 Ga0501044_0030229 3300049823 Bacteria 5709
160 Ga0501044_0288945 3300049823 Bacteria 1571
161 nmdc:mga06z11_1524_c1 3300050494 Bacteria 8593
162 Ga0495655_0033868 3300053083 Bacteria 1260
163 Ga0500578_0109340 3300053086 Bacteria 1744
164 Ga0500640_002485 3300053095 Bacteria 6117
165 Ga0500560_067933 3300053107 Bacteria 1171
166 Ga0466962_0003104 3300061719 Bacteria 7893
167 3006493810 3006486233 Bacteria 8157040
168 2547412225 2547132111 Bacteria 8013147
169 2554261001 2554235005 Bacteria 6457341
170 2585304340 2582581313 Bacteria 10042643
171 2585314972 2582581314 Bacteria 11452267
172 2616698779 2616644814 Bacteria 11555299
173 2643765991 2643221548 Bacteria 8053412
174 2643945787 2643221587 Bacteria 7586415
175 2644270559 2643221647 Bacteria 10741251
176 2644432576 2643221677 Bacteria 7584031
177 2644440764 2643221678 Bacteria 9540101
178 2644630279 2643221714 Bacteria 9015452
179 2784592097 2784132148 Bacteria 8627943
180 2785339647 2784746763 Bacteria 9783172
181 2785373406 2784746768 Bacteria 10036182
182 2786674589 2786546132 Bacteria 10419719
183 2808845518 2808606359 Bacteria 9866990
184 2808915226 2808606375 Bacteria 9466072
185 2809235781 2808606448 Bacteria 8656184
186 2811843099 2808606982 Bacteria 7791042
187 2812354171 2811994879 Bacteria 9313447
188 2812482970 2811994917 Bacteria 7761064
189 2819695869 2818991463 Bacteria 7948711
190 2852635849 2852635781 Bacteria 8251373
191 2862282881 2862281513 Bacteria 9621493
192 2862296785 2862290372 Bacteria 7471434
193 2862392614 2862382967 Bacteria 10317375
194 2862511874 2862507626 Bacteria 9425308
195 2863410453 2863404153 Bacteria 9672205
196 2867432355 2867428634 Bacteria 9590268
197 2877677511 2877676314 Bacteria 9512378
198 2912715756 2912715099 Bacteria 9460473
199 2912728686 2912723979 Bacteria 8557534
200 2918508019 2918501144 Bacteria 8668083
201 2919472867 2919468124 Bacteria 9133025
202 2946071529 2946064051 Bacteria 8957905
203 2947225251 2947224130 Bacteria 9938529
204 2954382243 2954380949 Bacteria 10050426
205 2954680814 2954673503 Bacteria 9685905
206 2954683341 2954682443 Bacteria 9862841
207 2954693070 2954691527 Bacteria 10720516
208 2954712743 2954711539 Bacteria 10867210
209 2954722702 2954721474 Bacteria 10456478
210 2954739158 2954731030 Bacteria 10243860
211 2954741582 2954740390 Bacteria 10229294
212 2954757987 2954749733 Bacteria 10366972
213 2954760593 2954759201 Bacteria 9358192
214 2966599157 2966598605 Bacteria 7676064
215 2990065056 2990059506 Bacteria 9321252
216 3006394237 3006393351 Bacteria 6615579
217 3006494445 3006493962 Bacteria 8825450
218 8008564367 8008558824 Bacteria 10610750
219 8008575705 8008574985 Bacteria 7815457
220 8023630216 8023623736 Bacteria 8593882
221 8048408565 8048406513 Bacteria 8936924
222 8056836337 8056829672 Bacteria 9045328
223 rootH1_10010712
224 Ga0006562J51391_1073137
225 Ga0068855_100247737
226 Ga0075367_10004436
227 Ga0105251_10138986
228 Ga0157369_10182107
229 Ga0182008_10000552
230 Ga0182007_10000554
231 Ga0183367_1016
232 Ga0307517_10005394
233 Ga0307515_10000325
234 Ga0307511_10000010
235 Ga0307512_10000801
236 Ga0307512_10112590
237 Ga0307508_10005832
238 Ga0307508_10026171
239 Ga0307514_10020921
240 Ga0307516_10031050
241 Ga0307516_10045073
242 Ga0307516_10393001
243 Ga0307518_10263205
244 Ga0307507_10013365
245 Ga0307507_10065623
246 Ga0307507_10106560
247 Ga0307510_10016326
248 Ga0307510_10030785
249 Ga0307510_10189251
250 Ga0395900_0208881
251 Ga0395900_0334581
252 Ga0395898_0021891
253 Ga0395898_0039486
254 Ga0395901_0642572
255 Ga0439436_0004042
256 Ga0439439_0007878
257 Ga0451853_0544897
258 Ga0439442_004678
259 Ga0439449_0000106
260 Ga0439449_0050634
261 Ga0439457_001556
262 Ga0439457_003310
263 Ga0439462_0016118
264 Ga0450894_001379
265 Ga0450899_000477
266 Ga0450899_009647
267 Ga0450903_000617
268 Ga0450906_000375
269 Ga0439458_0001299
270 Ga0466972_0009805
271 Ga0466965_0008781
272 Ga0466965_0034405
273 Ga0466966_0001844
274 Ga0466961_0016348
275 Ga0466963_0001334
276 Ga0466964_0007955
277 Ga0466971_0016176
278 Ga0466970_0000948
279 Ga0466957_0002114
280 Ga0466960_0008314
281 Ga0466959_0000302
282 Ga0466958_0006558
283 Ga0466967_0010987
284 Ga0466967_0035868
285 Ga0495627_038793
286 Ga0495592_0003512
287 Ga0495592_0031713
288 Ga0495629_0027948
289 Ga0495629_0084872
290 Ga0495651_0024797
291 Ga0495651_0074302
292 Ga0495605_0007059
293 Ga0495662_0002543
294 Ga0495664_0002442
295 Ga0495594_0036366
296 Ga0495596_0088216
297 Ga0495596_0101213
298 Ga0495583_0161964
299 Ga0495606_0007987
300 Ga0495616_0005451
301 Ga0495618_0159157
302 Ga0495620_0006968
303 Ga0495620_0008315
304 Ga0495628_0282040
305 Ga0495630_0119250
306 Ga0495631_0046678
307 Ga0495643_0044523
308 Ga0495648_0022100
309 Ga0495648_0072267
310 Ga0495666_0013036
311 Ga0495652_0008129
312 Ga0495652_0294546
313 Ga0495654_0027546
314 Ga0495640_0120040
315 Ga0495640_0137395
316 Ga0495587_0008540
317 Ga0495597_0023729
318 Ga0495633_0026168
319 Ga0495668_0029210
320 Ga0495634_0004450
321 Ga0495625_0003742
322 Ga0495625_0061414
323 Ga0495625_0342493
324 Ga0495635_0000315
325 Ga0495635_0128264
326 Ga0495588_0005982
327 Ga0495588_0138008
328 Ga0495657_0000740
329 Ga0495657_0004713
330 Ga0495623_0035895
331 Ga0495646_0000431
332 Ga0495646_0067266
333 Ga0495613_0001084
334 Ga0495613_0008050
335 Ga0495613_0159361
336 Ga0495613_0195610
337 Ga0495671_0020771
338 Ga0495671_0089648
339 Ga0495649_0041218
340 Ga0495589_0003863
341 Ga0495600_0007950
342 Ga0495660_0118494
343 Ga0495581_0085585
344 Ga0495604_0002064
345 Ga0495604_0025020
346 Ga0495636_0012331
347 Ga0495636_0155400
348 Ga0495674_0126136
349 Ga0495676_0002471
350 Ga0495676_0061233
351 Ga0495676_0080763
352 Ga0495683_0102884
353 Ga0495687_002478
354 Ga0495687_022133
355 Ga0495687_051178
356 Ga0495675_0001748
357 Ga0495675_0091846
358 Ga0495675_0212313
359 Ga0495685_008972
360 Ga0495685_016905
361 Ga0495681_0010032
362 Ga0495686_0032538
363 Ga0495593_0009828
364 Ga0495614_0031345
365 Ga0495614_0050740
366 Ga0495614_0075998
367 Ga0495614_0155139
368 Ga0496109_0128690
369 Ga0501033_0006124
370 Ga0501033_0078428
371 Ga0501034_0055969
372 Ga0501034_0286188
373 Ga0501036_0007405
374 Ga0501036_0417464
375 Ga0501038_0004105
376 Ga0501038_0124941
377 Ga0501043_0352336
378 Ga0501048_0128416
379 Ga0501070_0123481
380 Ga0501035_0211913
381 Ga0501044_0030229
382 Ga0501044_0288945
383 nmdc:mga06z11_1524_c1
384 Ga0495655_0033868
385 Ga0500578_0109340
386 Ga0500640_002485
387 Ga0500560_067933
388 Ga0466962_0003104
389 3006493810
390 2547412225
391 2554261001
392 2585304340
393 2585314972
394 2616698779
395 2643765991
396 2643945787
397 2644270559
398 2644432576
399 2644440764
400 2644630279
401 2784592097
402 2785339647
403 2785373406
404 2786674589
405 2808845518
406 2808915226
407 2809235781
408 2811843099
409 2812354171
410 2812482970
411 2819695869
412 2852635849
413 2862282881
414 2862296785
415 2862392614
416 2862511874
417 2863410453
418 2867432355
419 2877677511
420 2912715756
421 2912728686
422 2918508019
423 2919472867
424 2946071529
425 2947225251
426 2954382243
427 2954680814
428 2954683341
429 2954693070
430 2954712743
431 2954722702
432 2954739158
433 2954741582
434 2954757987
435 2954760593
436 2966599157
437 2990065056
438 3006394237
439 3006494445
440 8008564367
441 8008575705
442 8023630216
443 8048408565
444 8056836337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

102

225

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dq3-assembly2.cif.gz_B streptococcus pyogenes deacetylase ppld in complex with acetate 0.8711 77 188
3vus-assembly2.cif.gz_B escherichia coli pgab n-terminal domain 0.8548 77 190
4u10-assembly2.cif.gz_B probing the structure and mechanism of de-n-acetylase from aggregatibacter actinomycetemcomitans 0.842 77 189
3vus-assembly1.cif.gz_A escherichia coli pgab n-terminal domain 0.8418 77 189
4wcj-assembly1.cif.gz_A structure of icab from ammonifex degensii 0.8209 77 189
ID Description Score Start End Superfamily
af_Q9VPI3_1693_1928_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.834 101 189 3.20.20.370
4f9dB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8222 77 189 3.20.20.370
4wcjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8209 77 189 3.20.20.370
af_A0A4V0ILL1_1394_1685_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8113 74 187 3.20.20.370
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8068 74 255 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A060BV43-F1-model_v4 Polysacc_deac_1 0.9586 76 172 GO:0005975
GO:0016020
GO:0016810
AF-A0A7K2N4T9-F1-model_v4 Polysaccharide deacetylase family protein 0.9422 76 174 GO:0005975
GO:0016810
AF-A0A6B3GHX8-F1-model_v4 Polysaccharide deacetylase family protein 0.9191 68 191 GO:0005975
GO:0016810
AF-A0A3M1CSG9-F1-model_v4 DUF3473 domain-containing protein 0.916 87 190 GO:0005975
GO:0016810
AF-A0A7V5DA36-F1-model_v4 Polysaccharide deacetylase family protein 0.9145 68 170 GO:0005975
GO:0016810

Map