F334878

General Info

Members Datasets Scaffolds Average Seq Length
222 160 444 342

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0294264|Ga0496101_0294264_43_1041
Length 332
Sequence VSYAAAPERYDGMPYRQCGRSGLKLPAISLGLWQNFGADRPLDTAREIVRRAFDLGVTHFDLANNYGPPYGAAEETFGRLFASDLAPFRDELIVSTKAGWDMWPGPYGDGGSRKYMLASLDQSLARLGLDYVDIFYSHRRDHDTPLEETIGALDTAVRSGKALYAGISMYGADSTDTAFAIARELHLPLVIHQPVYSIFNRWIEREGVLDACERNGLGVIVFSPLAQGLLSDRYLNGIPEDSRAMHSRYFSRDDVTGEKLAKVRELNEIAKERGQSLAQMALAWTLRDARVTSALPGASSVEQLEANVAAVENLAFSDEELTAIDRIAPVSG

Samples

Sample ID Description Type Environment
1 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
45 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
49 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
59 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
60 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
61 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
62 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
73 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
74 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
155 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
158 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
159 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
160 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 12.16
Rhizosphere 79.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496101_0294264 3300048904 Bacteria 1271
2 JGI24737J22298_10004315 3300001990 Bacteria 4966
3 JGI25406J46586_10004313 3300003203 Bacteria 6636
4 Ga0070658_10036398 3300005327 Bacteria 3967
5 Ga0070683_100424807 3300005329 Bacteria 1268
6 Ga0070682_100067770 3300005337 Bacteria 2273
7 Ga0070691_10003514 3300005341 Bacteria 7062
8 Ga0070659_100057729 3300005366 Bacteria 3061
9 Ga0070705_100001370 3300005440 Bacteria 12976
10 Ga0070678_100112634 3300005456 Bacteria 2131
11 Ga0070662_100029515 3300005457 Bacteria 3828
12 Ga0070679_100076004 3300005530 Bacteria 3348
13 Ga0070679_100253392 3300005530 Bacteria 1716
14 Ga0070679_100358879 3300005530 Bacteria 1405
15 Ga0068853_100004403 3300005539 Bacteria 10908
16 Ga0068855_100205196 3300005563 Bacteria 2218
17 Ga0068854_100005845 3300005578 Bacteria 7790
18 Ga0068856_100031407 3300005614 Bacteria 5195
19 Ga0068861_100178234 3300005719 Bacteria 1767
20 Ga0081455_10010477 3300005937 Bacteria 9401
21 Ga0081455_10073850 3300005937 Bacteria 2818
22 Ga0081455_10151459 3300005937 Bacteria 1788
23 Ga0081538_10036098 3300005981 Bacteria 3233
24 Ga0070717_10010735 3300006028 Bacteria 6932
25 Ga0075366_10035120 3300006195 Bacteria 2956
26 Ga0075428_100029492 3300006844 Bacteria 6070
27 Ga0105248_10455153 3300009177 Bacteria 1442
28 Ga0157369_10000618 3300013105 Bacteria 46223
29 Ga0157369_10001231 3300013105 Bacteria 31905
30 Ga0157369_10020140 3300013105 Bacteria 7460
31 Ga0157374_10032901 3300013296 Bacteria 4726
32 Ga0157372_10196014 3300013307 Bacteria 2340
33 Ga0157380_10176885 3300014326 Bacteria 1871
34 Ga0157376_10162375 3300014969 Bacteria 2027
35 Ga0213876_10006892 3300021384 Bacteria 6195
36 Ga0207647_10000470 3300025904 Bacteria 32686
37 Ga0207647_10006996 3300025904 Bacteria 8180
38 Ga0207671_10083441 3300025914 Bacteria 2399
39 Ga0207693_10071177 3300025915 Bacteria 2721
40 Ga0207652_10372190 3300025921 Bacteria 1289
41 Ga0207690_10039338 3300025932 Bacteria 3085
42 Ga0207706_10044557 3300025933 Bacteria 3932
43 Ga0207667_10018283 3300025949 Bacteria 7867
44 Ga0207677_10041094 3300026023 Bacteria 3055
45 Ga0207678_10208715 3300026067 Bacteria 1671
46 Ga0207702_10019332 3300026078 Bacteria 5637
47 Ga0207674_10019293 3300026116 Bacteria 7388
48 Ga0207683_10009585 3300026121 Bacteria 8257
49 Ga0207698_10079398 3300026142 Bacteria 2639
50 Ga0207428_10007856 3300027907 Bacteria 9701
51 Ga0265319_1022175 3300028563 Bacteria 2319
52 Ga0307517_10172315 3300028786 Bacteria 1419
53 Ga0265327_10044995 3300031251 Bacteria 2349
54 Ga0307513_10002872 3300031456 Bacteria 23596
55 Ga0316575_10075682 3300031665 Bacteria 1355
56 Ga0316578_10018335 3300031728 Bacteria 3833
57 Ga0307516_10002137 3300031730 Bacteria 26777
58 Ga0307405_10060066 3300031731 Bacteria 2398
59 Ga0307410_10181382 3300031852 Bacteria 1594
60 Ga0307406_10001600 3300031901 Bacteria 12450
61 Ga0307406_10092550 3300031901 Bacteria 2039
62 Ga0307412_10009676 3300031911 Bacteria 5535
63 Ga0307412_10224962 3300031911 Bacteria 1441
64 Ga0307412_10290748 3300031911 Bacteria 1287
65 Ga0307416_100010895 3300032002 Bacteria 6030
66 Ga0307416_100171911 3300032002 Bacteria 2018
67 Ga0307411_10015672 3300032005 Bacteria 4266
68 Ga0307415_100026135 3300032126 Bacteria 3677
69 Ga0307415_100453567 3300032126 Bacteria 1109
70 Ga0373956_0003771 3300035119 Bacteria 6098
71 Ga0373943_0003623 3300035170 Bacteria 7024
72 Ga0316574_0080282 3300035398 Bacteria 2070
73 Ga0373931_0103348 3300035691 Bacteria 1606
74 Ga0373933_0051056 3300035724 Bacteria 2470
75 Ga0373937_0005538 3300036401 Bacteria 10828
76 Ga0316582_0018472 3300036647 Bacteria 4059
77 Ga0316584_0012497 3300036712 Bacteria 5988
78 Ga0316584_0042431 3300036712 Bacteria 3392
79 Ga0316584_0278703 3300036712 Bacteria 1215
80 Ga0395899_0010707 3300037312 Bacteria 7028
81 Ga0395899_0028124 3300037312 Bacteria 4234
82 Ga0395900_0004418 3300037418 Bacteria 14911
83 Ga0395900_0015826 3300037418 Bacteria 7687
84 Ga0395900_0044690 3300037418 Bacteria 4563
85 Ga0395900_0129079 3300037418 Bacteria 2591
86 Ga0395900_0471667 3300037418 Bacteria 1209
87 Ga0395898_0005049 3300037466 Bacteria 14305
88 Ga0395898_0189308 3300037466 Bacteria 1966
89 Ga0395898_0229662 3300037466 Bacteria 1770
90 Ga0395898_0265930 3300037466 Bacteria 1635
91 Ga0395898_0362656 3300037466 Bacteria 1382
92 Ga0395905_0001710 3300037471 Bacteria 25774
93 Ga0395905_0055500 3300037471 Bacteria 3707
94 Ga0395905_0065794 3300037471 Bacteria 3394
95 Ga0395901_0004423 3300038443 Bacteria 14173
96 Ga0395901_0008407 3300038443 Bacteria 10430
97 Ga0395901_0108599 3300038443 Bacteria 2912
98 Ga0395901_0136907 3300038443 Bacteria 2573
99 Ga0395901_0221251 3300038443 Bacteria 1979
100 Ga0395901_0245940 3300038443 Bacteria 1864
101 Ga0436365_0750029 3300039437 Bacteria 12780
102 Ga0451791_0344323 3300041451 Bacteria 8136
103 Ga0451797_1483424 3300041453 Bacteria 4257
104 Ga0451843_0622533 3300041509 Bacteria 1119
105 Ga0451853_0956283 3300041512 Bacteria 3652
106 Ga0466961_0115420 3300044693 Bacteria 1688
107 Ga0466961_0263653 3300044693 Bacteria 1056
108 Ga0466963_0023409 3300044694 Bacteria 3923
109 Ga0466964_0054071 3300044706 Bacteria 1654
110 Ga0466968_0021445 3300044735 Bacteria 2617
111 Ga0466957_0002154 3300044842 Bacteria 10542
112 Ga0466957_0269206 3300044842 Bacteria 1137
113 Ga0466960_0000058 3300044901 Bacteria 36894
114 Ga0466959_0113401 3300045049 Bacteria 1933
115 Ga0466958_0018518 3300045836 Bacteria 4042
116 Ga0466967_0041248 3300045976 Bacteria 3978
117 Ga0466967_0087615 3300045976 Bacteria 2823
118 Ga0495592_0051948 3300046454 Bacteria 3044
119 Ga0495629_0060349 3300046459 Bacteria 2651
120 Ga0495629_0155330 3300046459 Bacteria 1590
121 Ga0495641_0043543 3300046461 Bacteria 2076
122 Ga0495651_0169787 3300046462 Bacteria 1554
123 Ga0495582_0056092 3300046473 Bacteria 2171
124 Ga0495662_0009923 3300046476 Bacteria 4677
125 Ga0495664_0058175 3300046477 Bacteria 2299
126 Ga0495608_0084248 3300046511 Bacteria 2062
127 Ga0495618_0167342 3300046514 Bacteria 1399
128 Ga0495587_0004221 3300046536 Bacteria 9508
129 Ga0495645_0133776 3300046543 Bacteria 1735
130 Ga0495634_0011977 3300046642 Bacteria 6291
131 Ga0495634_0017309 3300046642 Bacteria 5145
132 Ga0495634_0199598 3300046642 Bacteria 1243
133 Ga0495657_0009978 3300046675 Bacteria 7165
134 Ga0495599_0036809 3300046678 Bacteria 3074
135 Ga0495623_0008145 3300046679 Bacteria 6814
136 Ga0495658_0020157 3300046683 Bacteria 3495
137 Ga0495613_0023056 3300046689 Bacteria 4639
138 Ga0495613_0041270 3300046689 Bacteria 3417
139 Ga0495613_0111650 3300046689 Bacteria 1969
140 Ga0495624_0148615 3300046690 Bacteria 1434
141 Ga0495600_0009194 3300046809 Bacteria 6096
142 Ga0495604_0012999 3300047317 Bacteria 6633
143 Ga0495604_0106002 3300047317 Bacteria 2056
144 Ga0495604_0145190 3300047317 Bacteria 1691
145 Ga0495676_0218333 3300047321 Bacteria 1315
146 Ga0495680_0007311 3300047322 Bacteria 10161
147 Ga0495675_0051055 3300047444 Bacteria 2627
148 Ga0495602_0025339 3300048088 Bacteria 5741
149 Ga0496100_0174987 3300048903 Bacteria 1549
150 Ga0496104_0020369 3300048907 Bacteria 6080
151 Ga0496104_0059177 3300048907 Bacteria 3627
152 Ga0496105_0007662 3300048908 Bacteria 8369
153 Ga0496105_0015255 3300048908 Bacteria 6120
154 Ga0496107_0039958 3300048910 Bacteria 3367
155 Ga0496107_0181990 3300048910 Bacteria 1561
156 Ga0496107_0354462 3300048910 Bacteria 1092
157 Ga0496108_0123749 3300048911 Bacteria 2219
158 Ga0496108_0128076 3300048911 Bacteria 2181
159 Ga0496108_0397113 3300048911 Bacteria 1204
160 Ga0496109_0026209 3300048912 Bacteria 5197
161 Ga0496109_0035786 3300048912 Bacteria 4482
162 Ga0496109_0063010 3300048912 Bacteria 3391
163 Ga0496109_0301390 3300048912 Bacteria 1511
164 Ga0496109_0421413 3300048912 Bacteria 1261
165 Ga0496109_0537785 3300048912 Bacteria 1102
166 Ga0496110_0064716 3300048913 Bacteria 3232
167 Ga0496110_0449181 3300048913 Bacteria 1175
168 Ga0496111_0036337 3300048914 Bacteria 3522
169 Ga0496111_0104108 3300048914 Bacteria 2088
170 Ga0496112_0052981 3300048915 Bacteria 3984
171 Ga0496114_0021474 3300048917 Bacteria 5253
172 Ga0496115_0257124 3300048918 Bacteria 1437
173 Ga0496117_0027070 3300048920 Bacteria 4474
174 Ga0496118_0006134 3300048921 Bacteria 13345
175 Ga0496126_0188559 3300048929 Bacteria 1748
176 Ga0501031_0004775 3300049568 Bacteria 8801
177 Ga0501031_0039685 3300049568 Bacteria 3073
178 Ga0501031_0142787 3300049568 Bacteria 1565
179 Ga0501032_0000001 3300049569 Bacteria 422097
180 Ga0501033_0000092 3300049570 Bacteria 85398
181 Ga0501034_0000036 3300049571 Bacteria 239274
182 Ga0501036_0000180 3300049572 Bacteria 41669
183 Ga0501036_0015336 3300049572 Bacteria 6400
184 Ga0501037_0000017 3300049573 Bacteria 157276
185 Ga0501038_0000036 3300049574 Bacteria 124766
186 Ga0501038_0108480 3300049574 Bacteria 2302
187 Ga0501039_0000011 3300049575 Bacteria 245124
188 Ga0501040_0220782 3300049576 Bacteria 1348
189 Ga0501041_0034492 3300049577 Bacteria 3064
190 Ga0501042_0000296 3300049578 Bacteria 24701
191 Ga0501042_0096190 3300049578 Bacteria 2127
192 Ga0501043_0000105 3300049579 Bacteria 78189
193 Ga0501046_0065682 3300049580 Bacteria 2830
194 Ga0501048_0090376 3300049582 Bacteria 2160
195 Ga0501071_0080399 3300049587 Bacteria 2383
196 Ga0501072_0056458 3300049588 Bacteria 3094
197 Ga0501072_0093271 3300049588 Bacteria 2391
198 Ga0501075_0023425 3300049591 Bacteria 4521
199 Ga0501075_0031224 3300049591 Bacteria 3953
200 Ga0501076_0007814 3300049592 Bacteria 7796
201 Ga0501077_0071073 3300049593 Bacteria 2206
202 Ga0501202_015558 3300049652 Bacteria 1467
203 Ga0501079_0275525 3300049741 Bacteria 1315
204 Ga0501081_0191983 3300049743 Bacteria 1479
205 Ga0501083_0000059 3300049744 Bacteria 78374
206 Ga0501035_0000028 3300049822 Bacteria 179195
207 Ga0501044_0006376 3300049823 Bacteria 13044
208 Ga0501045_0010883 3300049824 Bacteria 6375
209 Ga0501045_0229021 3300049824 Bacteria 1383
210 nmdc:mga0k408_37564_c1 3300050493 Bacteria 2780
211 nmdc:mga0qj67_64543_c1 3300050509 Bacteria 2913
212 nmdc:mga06r32_141681_c1 3300050510 Bacteria 2381
213 Ga0495619_0028869 3300053085 Bacteria 3580
214 Ga0500556_0000920 3300053104 Bacteria 16109
215 Ga0500593_002618 3300053117 Bacteria 6643
216 Ga0500561_0011703 3300053137 Bacteria 1852
217 Ga0501084_0030968 3300054114 Bacteria 4473
218 Ga0530510_0008304 3300061734 Bacteria 7241
219 Ga0530510_0047215 3300061734 Bacteria 3111
220 2644019647 2643221601 Bacteria 7493239
221 2644180467 2643221631 Bacteria 8168043
222 2867347788 2867346516 Bacteria 7608576
223 Ga0496101_0294264
224 JGI24737J22298_10004315
225 JGI25406J46586_10004313
226 Ga0070658_10036398
227 Ga0070683_100424807
228 Ga0070682_100067770
229 Ga0070691_10003514
230 Ga0070659_100057729
231 Ga0070705_100001370
232 Ga0070678_100112634
233 Ga0070662_100029515
234 Ga0070679_100076004
235 Ga0070679_100253392
236 Ga0070679_100358879
237 Ga0068853_100004403
238 Ga0068855_100205196
239 Ga0068854_100005845
240 Ga0068856_100031407
241 Ga0068861_100178234
242 Ga0081455_10010477
243 Ga0081455_10073850
244 Ga0081455_10151459
245 Ga0081538_10036098
246 Ga0070717_10010735
247 Ga0075366_10035120
248 Ga0075428_100029492
249 Ga0105248_10455153
250 Ga0157369_10000618
251 Ga0157369_10001231
252 Ga0157369_10020140
253 Ga0157374_10032901
254 Ga0157372_10196014
255 Ga0157380_10176885
256 Ga0157376_10162375
257 Ga0213876_10006892
258 Ga0207647_10000470
259 Ga0207647_10006996
260 Ga0207671_10083441
261 Ga0207693_10071177
262 Ga0207652_10372190
263 Ga0207690_10039338
264 Ga0207706_10044557
265 Ga0207667_10018283
266 Ga0207677_10041094
267 Ga0207678_10208715
268 Ga0207702_10019332
269 Ga0207674_10019293
270 Ga0207683_10009585
271 Ga0207698_10079398
272 Ga0207428_10007856
273 Ga0265319_1022175
274 Ga0307517_10172315
275 Ga0265327_10044995
276 Ga0307513_10002872
277 Ga0316575_10075682
278 Ga0316578_10018335
279 Ga0307516_10002137
280 Ga0307405_10060066
281 Ga0307410_10181382
282 Ga0307406_10001600
283 Ga0307406_10092550
284 Ga0307412_10009676
285 Ga0307412_10224962
286 Ga0307412_10290748
287 Ga0307416_100010895
288 Ga0307416_100171911
289 Ga0307411_10015672
290 Ga0307415_100026135
291 Ga0307415_100453567
292 Ga0373956_0003771
293 Ga0373943_0003623
294 Ga0316574_0080282
295 Ga0373931_0103348
296 Ga0373933_0051056
297 Ga0373937_0005538
298 Ga0316582_0018472
299 Ga0316584_0012497
300 Ga0316584_0042431
301 Ga0316584_0278703
302 Ga0395899_0010707
303 Ga0395899_0028124
304 Ga0395900_0004418
305 Ga0395900_0015826
306 Ga0395900_0044690
307 Ga0395900_0129079
308 Ga0395900_0471667
309 Ga0395898_0005049
310 Ga0395898_0189308
311 Ga0395898_0229662
312 Ga0395898_0265930
313 Ga0395898_0362656
314 Ga0395905_0001710
315 Ga0395905_0055500
316 Ga0395905_0065794
317 Ga0395901_0004423
318 Ga0395901_0008407
319 Ga0395901_0108599
320 Ga0395901_0136907
321 Ga0395901_0221251
322 Ga0395901_0245940
323 Ga0436365_0750029
324 Ga0451791_0344323
325 Ga0451797_1483424
326 Ga0451843_0622533
327 Ga0451853_0956283
328 Ga0466961_0115420
329 Ga0466961_0263653
330 Ga0466963_0023409
331 Ga0466964_0054071
332 Ga0466968_0021445
333 Ga0466957_0002154
334 Ga0466957_0269206
335 Ga0466960_0000058
336 Ga0466959_0113401
337 Ga0466958_0018518
338 Ga0466967_0041248
339 Ga0466967_0087615
340 Ga0495592_0051948
341 Ga0495629_0060349
342 Ga0495629_0155330
343 Ga0495641_0043543
344 Ga0495651_0169787
345 Ga0495582_0056092
346 Ga0495662_0009923
347 Ga0495664_0058175
348 Ga0495608_0084248
349 Ga0495618_0167342
350 Ga0495587_0004221
351 Ga0495645_0133776
352 Ga0495634_0011977
353 Ga0495634_0017309
354 Ga0495634_0199598
355 Ga0495657_0009978
356 Ga0495599_0036809
357 Ga0495623_0008145
358 Ga0495658_0020157
359 Ga0495613_0023056
360 Ga0495613_0041270
361 Ga0495613_0111650
362 Ga0495624_0148615
363 Ga0495600_0009194
364 Ga0495604_0012999
365 Ga0495604_0106002
366 Ga0495604_0145190
367 Ga0495676_0218333
368 Ga0495680_0007311
369 Ga0495675_0051055
370 Ga0495602_0025339
371 Ga0496100_0174987
372 Ga0496104_0020369
373 Ga0496104_0059177
374 Ga0496105_0007662
375 Ga0496105_0015255
376 Ga0496107_0039958
377 Ga0496107_0181990
378 Ga0496107_0354462
379 Ga0496108_0123749
380 Ga0496108_0128076
381 Ga0496108_0397113
382 Ga0496109_0026209
383 Ga0496109_0035786
384 Ga0496109_0063010
385 Ga0496109_0301390
386 Ga0496109_0421413
387 Ga0496109_0537785
388 Ga0496110_0064716
389 Ga0496110_0449181
390 Ga0496111_0036337
391 Ga0496111_0104108
392 Ga0496112_0052981
393 Ga0496114_0021474
394 Ga0496115_0257124
395 Ga0496117_0027070
396 Ga0496118_0006134
397 Ga0496126_0188559
398 Ga0501031_0004775
399 Ga0501031_0039685
400 Ga0501031_0142787
401 Ga0501032_0000001
402 Ga0501033_0000092
403 Ga0501034_0000036
404 Ga0501036_0000180
405 Ga0501036_0015336
406 Ga0501037_0000017
407 Ga0501038_0000036
408 Ga0501038_0108480
409 Ga0501039_0000011
410 Ga0501040_0220782
411 Ga0501041_0034492
412 Ga0501042_0000296
413 Ga0501042_0096190
414 Ga0501043_0000105
415 Ga0501046_0065682
416 Ga0501048_0090376
417 Ga0501071_0080399
418 Ga0501072_0056458
419 Ga0501072_0093271
420 Ga0501075_0023425
421 Ga0501075_0031224
422 Ga0501076_0007814
423 Ga0501077_0071073
424 Ga0501202_015558
425 Ga0501079_0275525
426 Ga0501081_0191983
427 Ga0501083_0000059
428 Ga0501035_0000028
429 Ga0501044_0006376
430 Ga0501045_0010883
431 Ga0501045_0229021
432 nmdc:mga0k408_37564_c1
433 nmdc:mga0qj67_64543_c1
434 nmdc:mga06r32_141681_c1
435 Ga0495619_0028869
436 Ga0500556_0000920
437 Ga0500593_002618
438 Ga0500561_0011703
439 Ga0501084_0030968
440 Ga0530510_0008304
441 Ga0530510_0047215
442 2644019647
443 2644180467
444 2867347788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

27

329

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t79-assembly1.cif.gz_A x-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol 0.9617 5 306
3erp-assembly1.cif.gz_B-5 structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium 0.959 6 306
6hg6-assembly1.cif.gz_A clostridium beijerinckii aldo-keto reductase cbei_3974 with nadph 0.9514 5 306
3erp-assembly1.cif.gz_A structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium 0.9488 6 306
3n6q-assembly1.cif.gz_D crystal structure of yghz from e. coli 0.9361 6 315
ID Description Score Start End Superfamily
3n6qB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9279 19 315 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8897 17 316 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.883 17 316 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8704 18 232 3.20.20.100
af_P97382_23_247_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8683 124 316 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A530ZNY9-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.9926 125 209 GO:0016491
GO:0051596
AF-A0A527TLU3-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.9893 128 201 GO:0016491
GO:0051596
AF-A0A527TLU3-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.9763 128 201 GO:0016491
GO:0051596
AF-A0A447TYR4-F1-model_v4 Ion-channel protein 0.968 132 254 GO:0016491
GO:0051596
AF-A0A7X7EED2-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.9647 4 104 GO:0016491
GO:0051596

Map