F334592

General Info

Members Datasets Scaffolds Average Seq Length
222 202 119 417

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10025786|Ga0268265_100257863
Length 381
Sequence MDADVHDKAIERDKVQAIVTRASPVAGDTSTRQVGEIDDVARSLPERDPGNKPIVSPSGKSVARRRGGALRTARLLLRKVATTWDHYNAGPWTRDGRVRVHVASVAPQISGQIRDLRIVDNQFVHKGDILYVVEPFDFEVALRAHKAALQQKIADLNVKQLQSDRRNRLSDLSASVEQKQVFEGSALQAKAAVDAAQEQVSQAEINLQRTAVRSPVNGIVTNLLLREGDYAHQGATNVSIIDADSYWVDGYFEETKLARLCVGDRAEAKLMGYSAPIIGHVATVTRGISVSNAAASTQGLPNVDPVYTWVRLAQRVPVRIAIDKVPSGVPLVSGLTATVTIREAKDETLLQRLHTELVTSFFGLIGEASARSGCIPGLPSP

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
5 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
6 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
7 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
8 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
9 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
10 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
11 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
12 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
13 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
14 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
15 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
16 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
17 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
18 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
19 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
20 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
21 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
22 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
23 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
24 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
25 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
26 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
27 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
28 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
29 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
30 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
31 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
32 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
33 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
34 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
35 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
36 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
37 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
38 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
39 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
40 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
41 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
42 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
43 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
44 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
45 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
46 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
47 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
48 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
49 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
50 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
51 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
52 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
53 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
54 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
55 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
56 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
57 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
58 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
59 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
60 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
61 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
62 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
63 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
64 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
65 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
66 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
67 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
68 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
69 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
70 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
71 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
72 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
73 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
74 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
75 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
76 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
77 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
78 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
79 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
80 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
81 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
82 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
83 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
90 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
91 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
92 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
93 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
94 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
98 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
99 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
140 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
141 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
173 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
174 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
175 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
176 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
179 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
182 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
183 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
184 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
185 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
186 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
187 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
188 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
189 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
190 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
191 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
192 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
193 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
194 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
195 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
196 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
197 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
198 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
199 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
200 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
201 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
202 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.6
Metatranscriptomes 0
Isolates 46.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.81
Nodule 36.94
Rhizoplane 2.7
Rhizosphere 36.04
Stem 0
Stem Tuber 0
Unclassified 13.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10166156 3300003322 Bacteria 4292
2 rootH1_10029805 3300003323 Bacteria 3879
3 JGI25404J52841_10016287 3300003659 Bacteria 1613
4 Ga0070658_10027446 3300005327 Bacteria 4569
5 Ga0068869_100007901 3300005334 Bacteria 6830
6 Ga0070668_100045882 3300005347 Bacteria 3353
7 Ga0070669_100031584 3300005353 Bacteria 3826
8 Ga0070667_100022148 3300005367 Bacteria 5272
9 Ga0070667_100052299 3300005367 Bacteria 3446
10 Ga0070667_100292021 3300005367 Bacteria 1466
11 Ga0070709_10036722 3300005434 Bacteria 2987
12 Ga0070714_100058653 3300005435 Bacteria 3299
13 Ga0070713_100055738 3300005436 Bacteria 3286
14 Ga0070710_10035295 3300005437 Bacteria 2726
15 Ga0070711_100074374 3300005439 Bacteria 2403
16 Ga0070700_100012251 3300005441 Bacteria 4779
17 Ga0070663_100040235 3300005455 Bacteria 3271
18 Ga0070662_100012312 3300005457 Bacteria 5669
19 Ga0070662_100017768 3300005457 Bacteria 4799
20 Ga0070706_100390063 3300005467 Bacteria 1296
21 Ga0070698_100015349 3300005471 Bacteria 8095
22 Ga0070698_100095757 3300005471 Bacteria 2946
23 Ga0070696_100061223 3300005546 Bacteria 2633
24 Ga0070665_100080394 3300005548 Bacteria 3265
25 Ga0070665_100192260 3300005548 Bacteria 2041
26 Ga0070704_100062636 3300005549 Bacteria 2667
27 Ga0068852_100226008 3300005616 Bacteria 1782
28 Ga0068860_100019390 3300005843 Bacteria 6596
29 Ga0081540_1000653 3300005983 Bacteria 32747
30 Ga0081540_1001429 3300005983 Bacteria 20644
31 Ga0081540_1002873 3300005983 Bacteria 13919
32 Ga0081540_1011510 3300005983 Bacteria 5911
33 Ga0081540_1013383 3300005983 Bacteria 5335
34 Ga0081540_1016608 3300005983 Bacteria 4596
35 Ga0081540_1024767 3300005983 Bacteria 3474
36 Ga0075365_10007043 3300006038 Bacteria 6261
37 Ga0070716_100024782 3300006173 Bacteria 3196
38 Ga0070712_100006325 3300006175 Bacteria 7342
39 Ga0075367_10028849 3300006178 Bacteria 3169
40 Ga0099823_1000409 3300006944 Bacteria 27729
41 Ga0105245_10159390 3300009098 Bacteria 2140
42 Ga0105243_10066152 3300009148 Bacteria 2906
43 Ga0105248_10151826 3300009177 Bacteria 2613
44 Ga0105249_10161484 3300009553 Bacteria 2166
45 Ga0105239_10017992 3300010375 Bacteria 7815
46 Ga0105239_10026464 3300010375 Bacteria 6383
47 Ga0105239_10186403 3300010375 Bacteria 2322
48 Ga0157375_10068127 3300013308 Bacteria 3559
49 Ga0163163_10087641 3300014325 Bacteria 3123
50 Ga0209677_101774 3300025253 Bacteria 8921
51 Ga0209025_1019258 3300025294 Bacteria 3805
52 Ga0209564_1008190 3300025295 Bacteria 5219
53 Ga0209758_1002841 3300025297 Bacteria 16832
54 Ga0209758_1004616 3300025297 Bacteria 11306
55 Ga0207426_1000237 3300025302 Bacteria 124707
56 Ga0207699_10001088 3300025906 Bacteria 12830
57 Ga0207684_10108080 3300025910 Bacteria 2380
58 Ga0207671_10056430 3300025914 Bacteria 2910
59 Ga0207693_10001127 3300025915 Bacteria 23971
60 Ga0207663_10018014 3300025916 Bacteria 3946
61 Ga0207681_10029964 3300025923 Bacteria 3543
62 Ga0207700_10072031 3300025928 Bacteria 2663
63 Ga0207664_10020925 3300025929 Bacteria 4855
64 Ga0207706_10119635 3300025933 Bacteria 2316
65 Ga0207665_10034187 3300025939 Bacteria 3373
66 Ga0207711_10286481 3300025941 Bacteria 1518
67 Ga0207689_10002319 3300025942 Bacteria 17836
68 Ga0207668_10114721 3300025972 Bacteria 2028
69 Ga0207639_10297219 3300026041 Bacteria 1426
70 Ga0207678_10007805 3300026067 Bacteria 9447
71 Ga0207678_10035523 3300026067 Bacteria 4339
72 Ga0207678_10221614 3300026067 Bacteria 1619
73 Ga0207708_10026915 3300026075 Bacteria 4354
74 Ga0207675_100000292 3300026118 Bacteria 48260
75 Ga0209389_1000111 3300027296 Bacteria 72517
76 Ga0209489_100220 3300027361 Bacteria 95167
77 Ga0209700_100041 3300027363 Bacteria 168380
78 Ga0268266_10118498 3300028379 Bacteria 2353
79 Ga0268265_10025786 3300028380 Bacteria 4176
80 Ga0307413_10115215 3300031824 Bacteria 1808
81 Ga0307406_10023908 3300031901 Bacteria 3643
82 Ga0395905_0119259 3300037471 Bacteria 2479
83 Ga0495606_0029681 3300046507 Bacteria 3834
84 Ga0495616_0032598 3300046513 Bacteria 2720
85 Ga0495620_0026005 3300046515 Bacteria 2759
86 Ga0495632_0108774 3300046519 Bacteria 1302
87 Ga0495643_0068732 3300046522 Bacteria 1864
88 Ga0495648_0088554 3300046524 Bacteria 1740
89 Ga0495661_0091229 3300046665 Bacteria 1733
90 Ga0495588_0016197 3300046674 Bacteria 3600
91 Ga0495649_0031210 3300046694 Bacteria 2939
92 Ga0495672_0056059 3300047320 Bacteria 2296
93 Ga0496101_0116470 3300048904 Bacteria 2016
94 Ga0496103_0147614 3300048906 Bacteria 1506
95 Ga0496107_0053262 3300048910 Bacteria 2919
96 Ga0496112_0138740 3300048915 Bacteria 2401
97 Ga0496114_0116132 3300048917 Bacteria 2297
98 Ga0496115_0039781 3300048918 Bacteria 3735
99 Ga0496118_0020399 3300048921 Bacteria 5877
100 Ga0496119_0096153 3300048922 Bacteria 1672
101 Ga0496121_0028380 3300048924 Bacteria 5210
102 Ga0496121_0035562 3300048924 Bacteria 4462
103 Ga0496125_0009470 3300048928 Bacteria 9999
104 nmdc:mga03683_110567_c1 3300050489 Bacteria 1214
105 nmdc:mga06z11_12407_c1 3300050494 Bacteria 3705
106 Ga0500578_0029278 3300053086 Bacteria 3537
107 Ga0500651_0034756 3300053093 Bacteria 3177
108 Ga0500566_0000029 3300053094 Bacteria 75384
109 Ga0500572_002739 3300053111 Bacteria 4159
110 Ga0500595_005354 3300053119 Bacteria 5612
111 Ga0500608_011211 3300053122 Bacteria 3884
112 Ga0500614_004419 3300053123 Bacteria 2971
113 Ga0500564_019170 3300053138 Bacteria 3124
114 Ga0500568_0000082 3300053139 Bacteria 92308
115 Ga0500590_026676 3300053148 Bacteria 2996
116 Ga0500620_007257 3300053155 Bacteria 2726
117 Ga0500622_0003040 3300053156 Bacteria 11589
118 Ga0500636_0000420 3300053177 Bacteria 23339
119 Ga0500601_000316 3300053737 Bacteria 9001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016511872 8016521330 343
2 3300005983 Ga0081540_1013383 Ga0081540_10133836 360
3 iso_pu_bacteria 8019586578 8019591449 360
4 3300005983 Ga0081540_1011510 Ga0081540_10115104 366
5 3300025294 Ga0209025_1019258 Ga0209025_10192582 369
6 3300005367 Ga0070667_100052299 Ga0070667_1000522992 370
7 3300037471 Ga0395905_0119259 Ga0395905_0119259_772_1884 370
8 3300026041 Ga0207639_10297219 Ga0207639_102972191 371
9 3300028380 Ga0268265_10025786 Ga0268265_100257863 371
10 3300047320 Ga0495672_0056059 Ga0495672_0056059_381_1658 372
11 3300048924 Ga0496121_0028380 Ga0496121_0028380_3696_4814 372
12 3300050489 nmdc:mga03683_110567_c1 nmdc:mga03683_110567_c1_30_1148 372
13 3300005983 Ga0081540_1016608 Ga0081540_10166086 373
14 3300025933 Ga0207706_10119635 Ga0207706_101196353 374
15 3300046519 Ga0495632_0108774 Ga0495632_0108774_66_1190 374
16 3300003659 JGI25404J52841_10016287 JGI25404J52841_100162872 375
17 3300005983 Ga0081540_1001429 Ga0081540_10014299 375
18 iso_pu_bacteria 2824661429 2824663939 376
19 3300005471 Ga0070698_100015349 Ga0070698_10001534912 378
20 3300005983 Ga0081540_1024767 Ga0081540_10247676 378
21 3300025910 Ga0207684_10108080 Ga0207684_101080802 378
22 iso_pu_bacteria 2876761206 2876768129 379
23 iso_pu_bacteria 2903748898 2903756660 379
24 3300005467 Ga0070706_100390063 Ga0070706_1003900631 380
25 iso_pu_bacteria 2903748898 2903752876 380
26 iso_pu_bacteria 2935916978 2935923725 380
27 iso_pu_bacteria 8056681323 8056685909 380
28 3300003323 rootH1_10029805 rootH1_100298051 381
29 3300048921 Ga0496118_0020399 Ga0496118_0020399_3644_4789 381
30 3300048924 Ga0496121_0035562 Ga0496121_0035562_833_1978 381
31 3300053111 Ga0500572_002739 Ga0500572_002739_239_1384 381
32 3300053122 Ga0500608_011211 Ga0500608_011211_238_1383 381
33 3300053123 Ga0500614_004419 Ga0500614_004419_417_1562 381
34 3300053138 Ga0500564_019170 Ga0500564_019170_1548_2693 381
35 3300053148 Ga0500590_026676 Ga0500590_026676_1458_2603 381
36 3300053155 Ga0500620_007257 Ga0500620_007257_787_1932 381
37 3300053177 Ga0500636_0000420 Ga0500636_0000420_14140_15285 381
38 iso_pu_bacteria 2881665667 2881667090 381
39 iso_pu_bacteria 2904690495 2904695355 381
40 3300005983 Ga0081540_1000653 Ga0081540_100065326 383
41 iso_pu_bacteria 2513237104 2513722216 383
42 3300006944 Ga0099823_1000409 Ga0099823_100040910 385
43 3300027296 Ga0209389_1000111 Ga0209389_100011128 385
44 3300027361 Ga0209489_100220 Ga0209489_10022068 385
45 3300027363 Ga0209700_100041 Ga0209700_100041146 385
46 3300048915 Ga0496112_0138740 Ga0496112_0138740_971_2266 385
47 3300053119 Ga0500595_005354 Ga0500595_005354_3968_5128 386
48 iso_pu_bacteria 2919450847 2919455786 387
49 3300053139 Ga0500568_0000082 Ga0500568_0000082_19736_20947 394
50 3300005983 Ga0081540_1002873 Ga0081540_10028733 399
51 3300025297 Ga0209758_1002841 Ga0209758_100284110 399
52 iso_pu_bacteria 2904578770 2904582785 399
53 3300053086 Ga0500578_0029278 Ga0500578_0029278_163_1368 401
54 3300009177 Ga0105248_10151826 Ga0105248_101518262 403
55 iso_pu_bacteria 2919450847 2919455701 404
56 3300010375 Ga0105239_10186403 Ga0105239_101864032 405
57 3300025941 Ga0207711_10286481 Ga0207711_102864811 407
58 3300009553 Ga0105249_10161484 Ga0105249_101614841 408
59 3300026067 Ga0207678_10221614 Ga0207678_102216142 409
60 3300053094 Ga0500566_0000029 Ga0500566_0000029_59410_60702 411
61 3300005434 Ga0070709_10036722 Ga0070709_100367222 414
62 3300005435 Ga0070714_100058653 Ga0070714_1000586531 414
63 3300005436 Ga0070713_100055738 Ga0070713_1000557383 414
64 3300005437 Ga0070710_10035295 Ga0070710_100352952 414
65 3300005439 Ga0070711_100074374 Ga0070711_1000743743 414
66 3300006173 Ga0070716_100024782 Ga0070716_1000247823 414
67 3300006175 Ga0070712_100006325 Ga0070712_1000063257 414
68 3300025906 Ga0207699_10001088 Ga0207699_100010886 414
69 3300025915 Ga0207693_10001127 Ga0207693_1000112718 414
70 3300025916 Ga0207663_10018014 Ga0207663_100180142 414
71 3300025928 Ga0207700_10072031 Ga0207700_100720312 414
72 3300025929 Ga0207664_10020925 Ga0207664_100209251 414
73 3300025939 Ga0207665_10034187 Ga0207665_100341873 414
74 3300048922 Ga0496119_0096153 Ga0496119_0096153_44_1303 414
75 iso_pu_bacteria 2874628541 2874633813 414
76 iso_pu_bacteria 2935777560 2935778329 415
77 iso_pu_bacteria 8016522445 8016529835 415
78 iso_pu_bacteria 8016530956 8016535069 415
79 iso_pu_bacteria 8016539877 8016548275 415
80 iso_pu_bacteria 8016548790 8016553850 415
81 iso_pu_bacteria 8016557553 8016562225 415
82 iso_pu_bacteria 8016566248 8016573412 415
83 iso_pu_bacteria 8016575299 8016577544 415
84 iso_pu_bacteria 8016613128 8016614209 415
85 iso_pu_bacteria 8016622563 8016626775 415
86 iso_pu_bacteria 8019530166 8019534824 415
87 iso_pu_bacteria 8019547302 8019553886 415
88 3300053737 Ga0500601_000316 Ga0500601_000316_6318_7586 416
89 iso_pu_bacteria 2524023228 2524539683 416
90 iso_pu_bacteria 2617270735 2617346362 416
91 iso_pu_bacteria 2874612657 2874617383 416
92 iso_pu_bacteria 8019648815 8019659070 417
93 3300005548 Ga0070665_100192260 Ga0070665_1001922602 418
94 3300028379 Ga0268266_10118498 Ga0268266_101184983 418
95 3300031824 Ga0307413_10115215 Ga0307413_101152152 418
96 3300031901 Ga0307406_10023908 Ga0307406_100239083 418
97 iso_pu_bacteria 2841957949 2841961228 418
98 iso_pu_bacteria 2932801729 2932801747 418
99 3300005548 Ga0070665_100080394 Ga0070665_1000803943 419
100 3300046515 Ga0495620_0026005 Ga0495620_0026005_161_1441 419
101 3300046665 Ga0495661_0091229 Ga0495661_0091229_45_1325 419
102 iso_pu_bacteria 2508501042 2508693895 420
103 iso_pu_bacteria 2524023205 2524442548 420
104 iso_pu_bacteria 2744054633 2745075513 420
105 iso_pu_bacteria 2824600985 2824604840 420
106 iso_pu_bacteria 2824609381 2824611408 420
107 iso_pu_bacteria 2824653114 2824656095 420
108 iso_pu_bacteria 2857509624 2857512491 420
109 iso_pu_bacteria 2888419890 2888421637 420
110 iso_pu_bacteria 2935608549 2935610149 420
111 iso_pu_bacteria 2935648319 2935650321 420
112 iso_pu_bacteria 2935656913 2935658468 420
113 iso_pu_bacteria 2935819856 2935823309 420
114 iso_pu_bacteria 2935984226 2935986032 420
115 iso_pu_bacteria 2936011229 2936013120 420
116 iso_pu_bacteria 2936019824 2936021793 420
117 iso_pu_bacteria 2936028420 2936030413 420
118 iso_pu_bacteria 2936046547 2936047987 420
119 iso_pu_bacteria 2936055302 2936057987 420
120 3300053093 Ga0500651_0034756 Ga0500651_0034756_89_1372 421
121 iso_pu_bacteria 2513237102 2513702766 421
122 iso_pu_bacteria 2816332527 2818239182 421
123 iso_pu_bacteria 2824617872 2824620238 421
124 iso_pu_bacteria 2824626560 2824629503 421
125 iso_pu_bacteria 2824635225 2824635823 421
126 iso_pu_bacteria 2824644064 2824646125 421
127 iso_pu_bacteria 2824661429 2824663198 421
128 iso_pu_bacteria 2824704595 2824706482 421
129 iso_pu_bacteria 2824714736 2824716677 421
130 iso_pu_bacteria 2824723954 2824726634 421
131 iso_pu_bacteria 2824753945 2824757887 421
132 iso_pu_bacteria 2824763712 2824766981 421
133 iso_pu_bacteria 2879099564 2879104198 421
134 iso_pu_bacteria 2881364244 2881368287 421
135 iso_pu_bacteria 2888388044 2888389479 421
136 iso_pu_bacteria 2904711408 2904712509 421
137 iso_pu_bacteria 2929615660 2929620805 421
138 iso_pu_bacteria 2929624759 2929626699 421
139 iso_pu_bacteria 2932784394 2932784436 421
140 iso_pu_bacteria 2932809354 2932809418 421
141 iso_pu_bacteria 2932818245 2932818839 421
142 iso_pu_bacteria 2932828146 2932828206 421
143 iso_pu_bacteria 2933577622 2933582719 421
144 iso_pu_bacteria 2935616580 2935617180 421
145 iso_pu_bacteria 2935638405 2935639339 421
146 iso_pu_bacteria 2935665750 2935665810 421
147 iso_pu_bacteria 2935675223 2935675456 421
148 iso_pu_bacteria 2935684952 2935685533 421
149 iso_pu_bacteria 2935703347 2935704346 421
150 iso_pu_bacteria 2935713505 2935714086 421
151 iso_pu_bacteria 2935722832 2935724705 421
152 iso_pu_bacteria 2935732158 2935732937 421
153 iso_pu_bacteria 2935741537 2935742316 421
154 iso_pu_bacteria 2935750917 2935751498 421
155 iso_pu_bacteria 2935760218 2935765729 421
156 iso_pu_bacteria 2935801545 2935802429 421
157 iso_pu_bacteria 2935810662 2935811253 421
158 iso_pu_bacteria 2935827899 2935828834 421
159 iso_pu_bacteria 2935837841 2935840208 421
160 iso_pu_bacteria 2935855204 2935855805 421
161 iso_pu_bacteria 2935864058 2935866252 421
162 iso_pu_bacteria 2935873716 2935877422 421
163 iso_pu_bacteria 2935992306 2935992367 421
164 iso_pu_bacteria 2936002035 2936002239 421
165 iso_pu_bacteria 2936037263 2936037327 421
166 iso_pu_bacteria 2940556831 2940557700 421
167 iso_pu_bacteria 2941538514 2941540451 421
168 iso_pu_bacteria 8017057580 8017064291 421
169 iso_pu_bacteria 8019576017 8019583635 421
170 iso_pu_bacteria 8019597564 8019599892 421
171 iso_pu_bacteria 8019608314 8019618652 421
172 iso_pu_bacteria 8055742211 8055745666 421
173 3300005471 Ga0070698_100095757 Ga0070698_1000957572 423
174 3300005549 Ga0070704_100062636 Ga0070704_1000626362 423
175 3300025295 Ga0209564_1008190 Ga0209564_10081902 423
176 3300005327 Ga0070658_10027446 Ga0070658_100274464 424
177 3300026067 Ga0207678_10035523 Ga0207678_100355233 424
178 3300046507 Ga0495606_0029681 Ga0495606_0029681_958_2250 424
179 3300003322 rootL2_10166156 rootL2_101661563 425
180 3300005334 Ga0068869_100007901 Ga0068869_1000079016 425
181 3300005347 Ga0070668_100045882 Ga0070668_1000458823 425
182 3300005353 Ga0070669_100031584 Ga0070669_1000315843 425
183 3300005367 Ga0070667_100022148 Ga0070667_1000221483 425
184 3300005367 Ga0070667_100292021 Ga0070667_1002920211 425
185 3300005441 Ga0070700_100012251 Ga0070700_1000122513 425
186 3300005455 Ga0070663_100040235 Ga0070663_1000402354 425
187 3300005457 Ga0070662_100012312 Ga0070662_1000123121 425
188 3300005457 Ga0070662_100017768 Ga0070662_1000177684 425
189 3300005546 Ga0070696_100061223 Ga0070696_1000612233 425
190 3300005616 Ga0068852_100226008 Ga0068852_1002260082 425
191 3300005843 Ga0068860_100019390 Ga0068860_1000193903 425
192 3300006038 Ga0075365_10007043 Ga0075365_100070435 425
193 3300006178 Ga0075367_10028849 Ga0075367_100288492 425
194 3300009098 Ga0105245_10159390 Ga0105245_101593903 425
195 3300009148 Ga0105243_10066152 Ga0105243_100661523 425
196 3300010375 Ga0105239_10017992 Ga0105239_100179923 425
197 3300010375 Ga0105239_10026464 Ga0105239_100264643 425
198 3300013308 Ga0157375_10068127 Ga0157375_100681272 425
199 3300014325 Ga0163163_10087641 Ga0163163_100876412 425
200 3300025253 Ga0209677_101774 Ga0209677_10177411 425
201 3300025297 Ga0209758_1004616 Ga0209758_100461610 425
202 3300025302 Ga0207426_1000237 Ga0207426_100023749 425
203 3300025914 Ga0207671_10056430 Ga0207671_100564303 425
204 3300025923 Ga0207681_10029964 Ga0207681_100299643 425
205 3300025942 Ga0207689_10002319 Ga0207689_100023193 425
206 3300025972 Ga0207668_10114721 Ga0207668_101147212 425
207 3300026067 Ga0207678_10007805 Ga0207678_100078053 425
208 3300026075 Ga0207708_10026915 Ga0207708_100269153 425
209 3300026118 Ga0207675_100000292 Ga0207675_10000029225 425
210 3300046513 Ga0495616_0032598 Ga0495616_0032598_32_1330 425
211 3300046522 Ga0495643_0068732 Ga0495643_0068732_54_1352 425
212 3300046524 Ga0495648_0088554 Ga0495648_0088554_353_1648 425
213 3300046674 Ga0495588_0016197 Ga0495588_0016197_1806_3104 425
214 3300046694 Ga0495649_0031210 Ga0495649_0031210_166_1461 425
215 3300048904 Ga0496101_0116470 Ga0496101_0116470_497_1795 425
216 3300048906 Ga0496103_0147614 Ga0496103_0147614_181_1479 425
217 3300048910 Ga0496107_0053262 Ga0496107_0053262_55_1353 425
218 3300048917 Ga0496114_0116132 Ga0496114_0116132_128_1426 425
219 3300048918 Ga0496115_0039781 Ga0496115_0039781_2313_3611 425
220 3300048928 Ga0496125_0009470 Ga0496125_0009470_4116_5411 425
221 3300050494 nmdc:mga06z11_12407_c1 nmdc:mga06z11_12407_c1_1355_2650 425
222 3300053156 Ga0500622_0003040 Ga0500622_0003040_3089_4384 425

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

101

150

0.94

PF13437

HlyD_3

HlyD family secretion protein

211

328

0.9

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

95

292

0.81

Feature Viewer

pLDDT pTM Quality
63.9 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map