F334507

General Info

Members Datasets Scaffolds Average Seq Length
222 158 444 130

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10018614|Ga0213875_100186142
Length 155
Sequence VSERRATATVGDVADWDDVRRLALGLPETAEHVSRGLASWRVRDKGFVWERPLRPGDLRALGPAAPRGPILGARVEHLGAKEALLADDPSVYFTTPHFDGYPAILVRLEQIALDELEELVIEAWLARAPKRVATRFMQSAGIGEPAARPPGGSAA

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
53 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
54 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
55 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
56 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
75 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
76 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
77 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
78 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
79 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
80 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
81 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
82 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
83 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
84 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
85 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
86 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
89 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
147 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 2643221572 Leifsonia sp. Root60 Isolate Unclassified
156 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
157 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
158 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.26
Rhizosphere 81.08
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10018614 3300021388 Bacteria 3348
2 Ga0070682_100054157 3300005337 Bacteria 2516
3 Ga0070668_100881374 3300005347 Bacteria 799
4 Ga0070714_100003104 3300005435 Bacteria 12334
5 Ga0070714_100210490 3300005435 Bacteria 1782
6 Ga0070713_100092095 3300005436 Bacteria 2609
7 Ga0070713_100384119 3300005436 Bacteria 1309
8 Ga0070713_101411289 3300005436 Bacteria 675
9 Ga0070710_10154022 3300005437 Bacteria 1420
10 Ga0070710_11495993 3300005437 Unclassified 507
11 Ga0070711_100002855 3300005439 Bacteria 9941
12 Ga0070708_101630700 3300005445 Bacteria 600
13 Ga0070707_100452750 3300005468 Bacteria 1244
14 Ga0070698_101014864 3300005471 Bacteria 777
15 Ga0070699_100183547 3300005518 Bacteria 1857
16 Ga0070697_100180783 3300005536 Bacteria 1788
17 Ga0070686_101575477 3300005544 Bacteria 555
18 Ga0070693_100110284 3300005547 Bacteria 1692
19 Ga0070665_100048999 3300005548 Bacteria 4240
20 Ga0070704_100060526 3300005549 Bacteria 2706
21 Ga0068856_100103758 3300005614 Bacteria 2836
22 Ga0068861_101000671 3300005719 Bacteria 798
23 Ga0081455_10372209 3300005937 Bacteria 1001
24 Ga0081540_1053421 3300005983 Bacteria 1981
25 Ga0075432_10124187 3300006058 Bacteria 972
26 Ga0070715_10010093 3300006163 Bacteria 3354
27 Ga0070716_100076818 3300006173 Bacteria 1980
28 Ga0070712_100004556 3300006175 Bacteria 8558
29 Ga0070712_100747224 3300006175 Bacteria 837
30 Ga0097621_100704021 3300006237 Bacteria 930
31 Ga0068871_100468251 3300006358 Bacteria 1132
32 Ga0075428_100024161 3300006844 Bacteria 6723
33 Ga0075433_10156763 3300006852 Bacteria 2026
34 Ga0075434_100111833 3300006871 Bacteria 2742
35 Ga0075429_100119619 3300006880 Bacteria 2301
36 Ga0075435_100039908 3300007076 Bacteria 3747
37 Ga0111539_10177413 3300009094 Bacteria 2489
38 Ga0111539_10335233 3300009094 Bacteria 1761
39 Ga0105245_10401413 3300009098 Bacteria 1370
40 Ga0105247_10170621 3300009101 Bacteria 1446
41 Ga0105241_10031864 3300009174 Bacteria 3948
42 Ga0163163_10137008 3300014325 Bacteria 2489
43 Ga0157379_10580246 3300014968 Unclassified 1045
44 Ga0213873_10145292 3300021358 Bacteria 711
45 Ga0213876_10019357 3300021384 Bacteria 3596
46 Ga0213875_10014738 3300021388 Bacteria 3812
47 Ga0207692_10006419 3300025898 Bacteria 4765
48 Ga0207692_11092524 3300025898 Bacteria 528
49 Ga0207685_10019827 3300025905 Bacteria 2223
50 Ga0207699_10008891 3300025906 Bacteria 4979
51 Ga0207693_10002904 3300025915 Bacteria 14830
52 Ga0207693_10026123 3300025915 Bacteria 4623
53 Ga0207663_10177723 3300025916 Bacteria 1517
54 Ga0207663_10440515 3300025916 Bacteria 1003
55 Ga0207646_10572790 3300025922 Bacteria 1014
56 Ga0207700_10002123 3300025928 Bacteria 11329
57 Ga0207700_10197668 3300025928 Bacteria 1693
58 Ga0207700_10404975 3300025928 Bacteria 1196
59 Ga0207700_11944003 3300025928 Unclassified 515
60 Ga0207664_10002851 3300025929 Bacteria 11484
61 Ga0207664_10164527 3300025929 Bacteria 1894
62 Ga0207664_10167995 3300025929 Bacteria 1876
63 Ga0207665_10067827 3300025939 Bacteria 2430
64 Ga0207675_100278897 3300026118 Bacteria 1624
65 Ga0207683_10023051 3300026121 Bacteria 5350
66 Ga0268266_10074585 3300028379 Bacteria 2946
67 Ga0265326_10000030 3300028558 Bacteria 96518
68 Ga0265319_1000432 3300028563 Bacteria 30066
69 Ga0265319_1016036 3300028563 Bacteria 2880
70 Ga0265334_10000026 3300028573 Bacteria 116448
71 Ga0265318_10030937 3300028577 Bacteria 2079
72 Ga0265336_10005624 3300028666 Bacteria 4603
73 Ga0265338_10048221 3300028800 Bacteria 3878
74 Ga0265338_10085637 3300028800 Bacteria 2626
75 Ga0265338_10165265 3300028800 Bacteria 1704
76 Ga0265338_10680540 3300028800 Bacteria 711
77 Ga0265324_10007002 3300029957 Bacteria 4635
78 Ga0265320_10123791 3300031240 Bacteria 1177
79 Ga0265320_10177339 3300031240 Bacteria 956
80 Ga0265325_10106553 3300031241 Unclassified 1366
81 Ga0265325_10161444 3300031241 Bacteria 1054
82 Ga0265316_10135375 3300031344 Bacteria 1854
83 Ga0307408_100213802 3300031548 Bacteria 1569
84 Ga0307408_101162324 3300031548 Bacteria 718
85 Ga0265314_10112191 3300031711 Unclassified 1731
86 Ga0265314_10164417 3300031711 Bacteria 1347
87 Ga0265342_10254832 3300031712 Bacteria 935
88 Ga0307405_10033842 3300031731 Bacteria 3036
89 Ga0307413_10558225 3300031824 Bacteria 930
90 Ga0307413_11009410 3300031824 Bacteria 714
91 Ga0307410_10073794 3300031852 Bacteria 2374
92 Ga0307410_10880374 3300031852 Bacteria 766
93 Ga0307406_10215028 3300031901 Bacteria 1425
94 Ga0307406_10463503 3300031901 Bacteria 1019
95 Ga0307406_11338127 3300031901 Bacteria 626
96 Ga0307406_11539883 3300031901 Bacteria 586
97 Ga0307407_10060299 3300031903 Bacteria 2214
98 Ga0307407_10252670 3300031903 Bacteria 1209
99 Ga0307412_10332774 3300031911 Bacteria 1213
100 Ga0307412_11032062 3300031911 Bacteria 728
101 Ga0307409_100060253 3300031995 Bacteria 2959
102 Ga0307409_100090239 3300031995 Bacteria 2508
103 Ga0307409_100151510 3300031995 Bacteria 2014
104 Ga0307409_100186066 3300031995 Bacteria 1843
105 Ga0307409_100250156 3300031995 Bacteria 1620
106 Ga0307416_100197075 3300032002 Bacteria 1906
107 Ga0307416_100619477 3300032002 Bacteria 1164
108 Ga0307416_100774307 3300032002 Bacteria 1054
109 Ga0307416_101244452 3300032002 Bacteria 850
110 Ga0307416_101285822 3300032002 Bacteria 837
111 Ga0307416_102131713 3300032002 Bacteria 662
112 Ga0307415_101363932 3300032126 Bacteria 674
113 Ga0373948_0041550 3300034817 Bacteria 963
114 Ga0373958_0011408 3300034819 Bacteria 1502
115 Ga0373959_0031192 3300034820 Bacteria 1077
116 Ga0373938_0002617 3300034957 Bacteria 2904
117 Ga0373926_0379333 3300035083 Bacteria 557
118 Ga0373928_0003794 3300035084 Bacteria 2882
119 Ga0373928_0215361 3300035084 Bacteria 559
120 Ga0373929_0002118 3300035085 Bacteria 3690
121 Ga0373940_0050689 3300035088 Bacteria 1165
122 Ga0373949_0093081 3300035090 Bacteria 817
123 Ga0373951_0014477 3300035091 Bacteria 1774
124 Ga0373932_0100272 3300035112 Bacteria 941
125 Ga0373939_0014257 3300035114 Bacteria 2059
126 Ga0373960_0021495 3300035121 Bacteria 1716
127 Ga0373946_0035691 3300035171 Bacteria 2013
128 Ga0373942_0005858 3300035207 Bacteria 2844
129 Ga0373962_0013189 3300035242 Bacteria 2089
130 Ga0373931_0014299 3300035691 Bacteria 3876
131 Ga0373947_0061552 3300035725 Bacteria 2281
132 Ga0373925_1346592 3300037068 Bacteria 585
133 Ga0436364_0734518 3300037853 Bacteria 3247
134 Ga0436364_1555547 3300037853 Bacteria 5901
135 Ga0436365_0617076 3300039437 Bacteria 701
136 Ga0436365_1072604 3300039437 Bacteria 12891
137 Ga0436365_1867504 3300039437 Bacteria 1596
138 Ga0436365_1908722 3300039437 Bacteria 1543
139 Ga0436363_0455076 3300039450 Bacteria 525
140 Ga0436363_0653833 3300039450 Unclassified 1678
141 Ga0436363_1592906 3300039450 Bacteria 1150
142 Ga0436363_1614050 3300039450 Bacteria 850
143 Ga0436363_1631986 3300039450 Bacteria 534
144 Ga0436362_0289190 3300039453 Bacteria 919
145 Ga0436362_0667976 3300039453 Bacteria 1202
146 Ga0451833_1302774 3300041491 Bacteria 505
147 Ga0466963_0636485 3300044694 Bacteria 753
148 Ga0466963_0743099 3300044694 Unclassified 692
149 Ga0466971_0637142 3300044719 Bacteria 533
150 Ga0466968_0072536 3300044735 Bacteria 1501
151 Ga0466957_0077712 3300044842 Bacteria 2063
152 Ga0466958_0213803 3300045836 Bacteria 1229
153 Ga0466958_1107705 3300045836 Bacteria 517
154 Ga0466967_0486875 3300045976 Bacteria 1209
155 Ga0466967_0945958 3300045976 Bacteria 857
156 Ga0495603_0019530 3300046455 Bacteria 4101
157 Ga0495629_0051192 3300046459 Bacteria 2890
158 Ga0495653_0024524 3300046463 Bacteria 4859
159 Ga0495580_0071570 3300046472 Bacteria 2422
160 Ga0495639_0016280 3300046475 Bacteria 3227
161 Ga0495662_0302040 3300046476 Bacteria 787
162 Ga0495585_0385786 3300046492 Bacteria 676
163 Ga0495594_0110685 3300046499 Bacteria 1549
164 Ga0495618_0149098 3300046514 Bacteria 1494
165 Ga0495630_0088442 3300046517 Bacteria 2339
166 Ga0495652_0096104 3300046529 Bacteria 2413
167 Ga0495665_0046580 3300046531 Bacteria 2301
168 Ga0495665_0183725 3300046531 Bacteria 1086
169 Ga0495634_0076176 3300046642 Bacteria 2202
170 Ga0495635_0013520 3300046663 Bacteria 5712
171 Ga0495588_0054521 3300046674 Bacteria 2063
172 Ga0495646_0595426 3300046680 Bacteria 562
173 Ga0495647_0036173 3300046681 Bacteria 1857
174 Ga0495613_0081161 3300046689 Bacteria 2356
175 Ga0495624_0024847 3300046690 Bacteria 3941
176 Ga0495589_0468282 3300046794 Bacteria 576
177 Ga0495581_0013202 3300047315 Bacteria 4791
178 Ga0495674_0021883 3300047319 Bacteria 5906
179 Ga0495676_0969207 3300047321 Bacteria 543
180 Ga0495680_0002869 3300047322 Bacteria 17316
181 Ga0495684_0031836 3300047471 Bacteria 4051
182 Ga0495593_0036125 3300047673 Bacteria 2680
183 Ga0496101_0211516 3300048904 Bacteria 1502
184 Ga0496101_1290602 3300048904 Bacteria 571
185 Ga0496102_0261345 3300048905 Bacteria 1632
186 Ga0496102_0725398 3300048905 Bacteria 917
187 Ga0496104_0214305 3300048907 Bacteria 1837
188 Ga0496104_0272572 3300048907 Bacteria 1605
189 Ga0496104_0758933 3300048907 Bacteria 877
190 Ga0496105_0154250 3300048908 Bacteria 1887
191 Ga0496106_0039041 3300048909 Bacteria 3555
192 Ga0496107_0143007 3300048910 Bacteria 1768
193 Ga0496108_0081379 3300048911 Bacteria 2744
194 Ga0496109_0569311 3300048912 Bacteria 1068
195 Ga0496109_0795685 3300048912 Bacteria 884
196 Ga0496110_0109929 3300048913 Bacteria 2476
197 Ga0496110_0620355 3300048913 Bacteria 980
198 Ga0496111_0167260 3300048914 Bacteria 1633
199 Ga0496112_0031383 3300048915 Bacteria 5153
200 Ga0496112_0927157 3300048915 Bacteria 792
201 Ga0496112_0943195 3300048915 Bacteria 784
202 Ga0496112_1579058 3300048915 Bacteria 569
203 Ga0496113_0055402 3300048916 Bacteria 2972
204 Ga0496113_0319407 3300048916 Bacteria 1244
205 Ga0496113_0547737 3300048916 Bacteria 928
206 Ga0496114_0053881 3300048917 Bacteria 3353
207 Ga0496115_0005266 3300048918 Bacteria 9401
208 Ga0501042_0514963 3300049578 Bacteria 869
209 Ga0501047_0074590 3300049581 Bacteria 3266
210 Ga0501268_115936 3300049765 Bacteria 589
211 Ga0501212_085095 3300049851 Bacteria 577
212 nmdc:mga09592_639194_c1 3300050508 Bacteria 909
213 nmdc:mga08y16_224920_c1 3300050511 Bacteria 1942
214 nmdc:mga0n895_19458_c1 3300050512 Bacteria 3286
215 nmdc:mga08x19_189254_c1 3300050514 Bacteria 1407
216 nmdc:mga0a205_193200_c1 3300050515 Unclassified 1927
217 Ga0495619_0427499 3300053085 Bacteria 914
218 Ga0501084_1116742 3300054114 Bacteria 662
219 2643876799 2643221572 Bacteria 3614809
220 2644383854 2643221669 Bacteria 3611286
221 2870722082 2870721527 Bacteria 9689237
222 2883823366 2883821847 Bacteria 5121194
223 Ga0213875_10018614
224 Ga0070682_100054157
225 Ga0070668_100881374
226 Ga0070714_100003104
227 Ga0070714_100210490
228 Ga0070713_100092095
229 Ga0070713_100384119
230 Ga0070713_101411289
231 Ga0070710_10154022
232 Ga0070710_11495993
233 Ga0070711_100002855
234 Ga0070708_101630700
235 Ga0070707_100452750
236 Ga0070698_101014864
237 Ga0070699_100183547
238 Ga0070697_100180783
239 Ga0070686_101575477
240 Ga0070693_100110284
241 Ga0070665_100048999
242 Ga0070704_100060526
243 Ga0068856_100103758
244 Ga0068861_101000671
245 Ga0081455_10372209
246 Ga0081540_1053421
247 Ga0075432_10124187
248 Ga0070715_10010093
249 Ga0070716_100076818
250 Ga0070712_100004556
251 Ga0070712_100747224
252 Ga0097621_100704021
253 Ga0068871_100468251
254 Ga0075428_100024161
255 Ga0075433_10156763
256 Ga0075434_100111833
257 Ga0075429_100119619
258 Ga0075435_100039908
259 Ga0111539_10177413
260 Ga0111539_10335233
261 Ga0105245_10401413
262 Ga0105247_10170621
263 Ga0105241_10031864
264 Ga0163163_10137008
265 Ga0157379_10580246
266 Ga0213873_10145292
267 Ga0213876_10019357
268 Ga0213875_10014738
269 Ga0207692_10006419
270 Ga0207692_11092524
271 Ga0207685_10019827
272 Ga0207699_10008891
273 Ga0207693_10002904
274 Ga0207693_10026123
275 Ga0207663_10177723
276 Ga0207663_10440515
277 Ga0207646_10572790
278 Ga0207700_10002123
279 Ga0207700_10197668
280 Ga0207700_10404975
281 Ga0207700_11944003
282 Ga0207664_10002851
283 Ga0207664_10164527
284 Ga0207664_10167995
285 Ga0207665_10067827
286 Ga0207675_100278897
287 Ga0207683_10023051
288 Ga0268266_10074585
289 Ga0265326_10000030
290 Ga0265319_1000432
291 Ga0265319_1016036
292 Ga0265334_10000026
293 Ga0265318_10030937
294 Ga0265336_10005624
295 Ga0265338_10048221
296 Ga0265338_10085637
297 Ga0265338_10165265
298 Ga0265338_10680540
299 Ga0265324_10007002
300 Ga0265320_10123791
301 Ga0265320_10177339
302 Ga0265325_10106553
303 Ga0265325_10161444
304 Ga0265316_10135375
305 Ga0307408_100213802
306 Ga0307408_101162324
307 Ga0265314_10112191
308 Ga0265314_10164417
309 Ga0265342_10254832
310 Ga0307405_10033842
311 Ga0307413_10558225
312 Ga0307413_11009410
313 Ga0307410_10073794
314 Ga0307410_10880374
315 Ga0307406_10215028
316 Ga0307406_10463503
317 Ga0307406_11338127
318 Ga0307406_11539883
319 Ga0307407_10060299
320 Ga0307407_10252670
321 Ga0307412_10332774
322 Ga0307412_11032062
323 Ga0307409_100060253
324 Ga0307409_100090239
325 Ga0307409_100151510
326 Ga0307409_100186066
327 Ga0307409_100250156
328 Ga0307416_100197075
329 Ga0307416_100619477
330 Ga0307416_100774307
331 Ga0307416_101244452
332 Ga0307416_101285822
333 Ga0307416_102131713
334 Ga0307415_101363932
335 Ga0373948_0041550
336 Ga0373958_0011408
337 Ga0373959_0031192
338 Ga0373938_0002617
339 Ga0373926_0379333
340 Ga0373928_0003794
341 Ga0373928_0215361
342 Ga0373929_0002118
343 Ga0373940_0050689
344 Ga0373949_0093081
345 Ga0373951_0014477
346 Ga0373932_0100272
347 Ga0373939_0014257
348 Ga0373960_0021495
349 Ga0373946_0035691
350 Ga0373942_0005858
351 Ga0373962_0013189
352 Ga0373931_0014299
353 Ga0373947_0061552
354 Ga0373925_1346592
355 Ga0436364_0734518
356 Ga0436364_1555547
357 Ga0436365_0617076
358 Ga0436365_1072604
359 Ga0436365_1867504
360 Ga0436365_1908722
361 Ga0436363_0455076
362 Ga0436363_0653833
363 Ga0436363_1592906
364 Ga0436363_1614050
365 Ga0436363_1631986
366 Ga0436362_0289190
367 Ga0436362_0667976
368 Ga0451833_1302774
369 Ga0466963_0636485
370 Ga0466963_0743099
371 Ga0466971_0637142
372 Ga0466968_0072536
373 Ga0466957_0077712
374 Ga0466958_0213803
375 Ga0466958_1107705
376 Ga0466967_0486875
377 Ga0466967_0945958
378 Ga0495603_0019530
379 Ga0495629_0051192
380 Ga0495653_0024524
381 Ga0495580_0071570
382 Ga0495639_0016280
383 Ga0495662_0302040
384 Ga0495585_0385786
385 Ga0495594_0110685
386 Ga0495618_0149098
387 Ga0495630_0088442
388 Ga0495652_0096104
389 Ga0495665_0046580
390 Ga0495665_0183725
391 Ga0495634_0076176
392 Ga0495635_0013520
393 Ga0495588_0054521
394 Ga0495646_0595426
395 Ga0495647_0036173
396 Ga0495613_0081161
397 Ga0495624_0024847
398 Ga0495589_0468282
399 Ga0495581_0013202
400 Ga0495674_0021883
401 Ga0495676_0969207
402 Ga0495680_0002869
403 Ga0495684_0031836
404 Ga0495593_0036125
405 Ga0496101_0211516
406 Ga0496101_1290602
407 Ga0496102_0261345
408 Ga0496102_0725398
409 Ga0496104_0214305
410 Ga0496104_0272572
411 Ga0496104_0758933
412 Ga0496105_0154250
413 Ga0496106_0039041
414 Ga0496107_0143007
415 Ga0496108_0081379
416 Ga0496109_0569311
417 Ga0496109_0795685
418 Ga0496110_0109929
419 Ga0496110_0620355
420 Ga0496111_0167260
421 Ga0496112_0031383
422 Ga0496112_0927157
423 Ga0496112_0943195
424 Ga0496112_1579058
425 Ga0496113_0055402
426 Ga0496113_0319407
427 Ga0496113_0547737
428 Ga0496114_0053881
429 Ga0496115_0005266
430 Ga0501042_0514963
431 Ga0501047_0074590
432 Ga0501268_115936
433 Ga0501212_085095
434 nmdc:mga09592_639194_c1
435 nmdc:mga08y16_224920_c1
436 nmdc:mga0n895_19458_c1
437 nmdc:mga08x19_189254_c1
438 nmdc:mga0a205_193200_c1
439 Ga0495619_0427499
440 Ga0501084_1116742
441 2643876799
442 2644383854
443 2870722082
444 2883823366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

24

126

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7684 3 116
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7453 3 116
2kfp-assembly1.cif.gz_A solution nmr structure of pspto_3016 from pseudomonas syringae. northeast structural genomics consortium target psr293. 0.7439 3 111
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7209 1 123
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.7092 3 126
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9374 4 122 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9221 4 122 3.30.70.1230
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7577 1 126 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7519 1 126 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7442 5 126 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A535UHV6-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9951 1 95 GO:0003677
AF-A0A2W6E1I1-F1-model_v4 MFS transporter 0.9943 1 130 GO:0016020
GO:0022857
AF-A0A1C6SVR5-F1-model_v4 YjbR protein 0.9918 1 129
AF-A0A1C5IRY7-F1-model_v4 YjbR protein 0.9904 1 128
AF-A0A2W6E1I1-F1-model_v4 MFS transporter 0.9867 1 130 GO:0016020
GO:0022857

Map