F334468

General Info

Members Datasets Scaffolds Average Seq Length
222 122 444 256

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10000987|Ga0157374_100009877
Length 306
Sequence MGNTAGIFYSVINSVQAIFANQFAPPCNPAVIVAQYASSPMELKRKCPMSRIRLVSWNVNGIRAAIKKGFFDWLEQDQPDILGLQETKISSEQLTLDMVAPLGYRTYWSHANKKGYSGVAIFTKEEPISVTEGLGIPEWDTEGRTLIAEYPNFVLYNIYYPNGGRGDDRLQYKLGFYDVFLEHIDNMRKAGKKVIACGDFNTAHHPIDLARPKENEKISGFMPIERAWVDQFVEHGYVDTFRHFYPEQKDAYSWWNMRTFARERNVGWRIDYFFTSPDLKDNLVDASIEPEVQGSDHCPVTLTLEF

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
92 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
93 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
120 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 0
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10000987 3300013296 Bacteria 24666
2 rootH2_10044461 3300003320 Bacteria 6653
3 Ga0068869_100006406 3300005334 Bacteria 7464
4 Ga0068869_100039086 3300005334 Bacteria 3386
5 Ga0070680_100001053 3300005336 Bacteria 19744
6 Ga0070691_10006829 3300005341 Bacteria 5217
7 Ga0070692_10030446 3300005345 Bacteria 2698
8 Ga0070692_10056583 3300005345 Bacteria 2054
9 Ga0070703_10005200 3300005406 Bacteria 3636
10 Ga0070701_10002377 3300005438 Bacteria 7230
11 Ga0070705_100017206 3300005440 Bacteria 3770
12 Ga0070705_100049072 3300005440 Bacteria 2449
13 Ga0070700_100027791 3300005441 Bacteria 3358
14 Ga0070700_100034300 3300005441 Bacteria 3064
15 Ga0070694_100000432 3300005444 Bacteria 22841
16 Ga0070694_100016698 3300005444 Bacteria 4623
17 Ga0070694_100118926 3300005444 Bacteria 1893
18 Ga0070708_100012971 3300005445 Bacteria 6809
19 Ga0070708_100101423 3300005445 Bacteria 2636
20 Ga0070708_100124996 3300005445 Bacteria 2376
21 Ga0070708_100148914 3300005445 Bacteria 2176
22 Ga0070662_100233888 3300005457 Bacteria 1471
23 Ga0070681_10175688 3300005458 Bacteria 2064
24 Ga0070706_100001785 3300005467 Bacteria 22282
25 Ga0070706_100010686 3300005467 Bacteria 8522
26 Ga0070706_100316078 3300005467 Unclassified 1457
27 Ga0070706_100362117 3300005467 Bacteria 1351
28 Ga0070706_100446836 3300005467 Bacteria 1203
29 Ga0070707_100005788 3300005468 Bacteria 11531
30 Ga0070707_100041038 3300005468 Bacteria 4428
31 Ga0070707_100081648 3300005468 Bacteria 3121
32 Ga0070707_100099609 3300005468 Bacteria 2816
33 Ga0070707_100100822 3300005468 Bacteria 2798
34 Ga0070707_100158809 3300005468 Bacteria 2202
35 Ga0070698_100005227 3300005471 Bacteria 14196
36 Ga0070698_100227084 3300005471 Bacteria 1800
37 Ga0070698_100240017 3300005471 Bacteria 1745
38 Ga0070699_100009458 3300005518 Bacteria 8446
39 Ga0070699_100011276 3300005518 Bacteria 7721
40 Ga0070699_100068156 3300005518 Bacteria 3089
41 Ga0070699_100093316 3300005518 Bacteria 2634
42 Ga0070699_100117063 3300005518 Bacteria 2342
43 Ga0070699_100120189 3300005518 Bacteria 2310
44 Ga0070699_100135737 3300005518 Bacteria 2170
45 Ga0070679_100062171 3300005530 Unclassified 3722
46 Ga0070697_100001742 3300005536 Bacteria 16600
47 Ga0070697_100161908 3300005536 Bacteria 1890
48 Ga0070697_100312139 3300005536 Bacteria 1353
49 Ga0070695_100000260 3300005545 Bacteria 26475
50 Ga0070695_100007481 3300005545 Bacteria 6469
51 Ga0070695_100025647 3300005545 Bacteria 3641
52 Ga0070696_100017987 3300005546 Bacteria 4773
53 Ga0070693_100492476 3300005547 Bacteria 868
54 Ga0070704_100077477 3300005549 Bacteria 2435
55 Ga0070704_100118698 3300005549 Bacteria 2027
56 Ga0068857_100176491 3300005577 Bacteria 1944
57 Ga0068859_100824626 3300005617 Bacteria 1014
58 Ga0068861_100086929 3300005719 Bacteria 2459
59 Ga0068861_100708185 3300005719 Unclassified 936
60 Ga0068870_10019785 3300005840 Bacteria 3270
61 Ga0068863_100123538 3300005841 Bacteria 2470
62 Ga0068862_100004786 3300005844 Bacteria 11393
63 Ga0068862_100009418 3300005844 Bacteria 8080
64 Ga0068862_100010621 3300005844 Bacteria 7608
65 Ga0081538_10012605 3300005981 Bacteria 6770
66 Ga0070712_100000931 3300006175 Bacteria 17609
67 Ga0075428_100498836 3300006844 Bacteria 1302
68 Ga0075431_100000510 3300006847 Bacteria 32484
69 Ga0075433_10000716 3300006852 Bacteria 22713
70 Ga0075433_10001649 3300006852 Bacteria 16585
71 Ga0075433_10063703 3300006852 Bacteria 3231
72 Ga0075433_10075421 3300006852 Bacteria 2968
73 Ga0075434_100009307 3300006871 Bacteria 9152
74 Ga0075434_100051997 3300006871 Bacteria 4070
75 Ga0075434_100612193 3300006871 Bacteria 1108
76 Ga0075429_100216929 3300006880 Bacteria 1676
77 Ga0097620_100025742 3300006931 Bacteria 5900
78 Ga0097620_100824542 3300006931 Bacteria 1014
79 Ga0075435_100028461 3300007076 Bacteria 4383
80 Ga0099794_10039752 3300007265 Bacteria 2234
81 Ga0099794_10162944 3300007265 Bacteria 1135
82 Ga0111539_10000395 3300009094 Bacteria 54076
83 Ga0114129_10111433 3300009147 Bacteria 3776
84 Ga0114129_10473358 3300009147 Bacteria 1640
85 Ga0105243_10015211 3300009148 Bacteria 5823
86 Ga0105243_10184480 3300009148 Bacteria 1817
87 Ga0105242_10020642 3300009176 Bacteria 5168
88 Ga0105242_10366652 3300009176 Bacteria 1335
89 Ga0105248_10236165 3300009177 Bacteria 2058
90 Ga0105249_10143948 3300009553 Bacteria 2288
91 Ga0105239_10001800 3300010375 Bacteria 28149
92 Ga0157326_1000410 3300012513 Bacteria 5077
93 Ga0157371_10234606 3300013102 Bacteria 1319
94 Ga0157375_10184133 3300013308 Bacteria 2241
95 Ga0157376_10002335 3300014969 Bacteria 12810
96 Ga0207653_10003091 3300025885 Bacteria 5276
97 Ga0207653_10013684 3300025885 Bacteria 2541
98 Ga0207653_10027895 3300025885 Bacteria 1813
99 Ga0207645_10043712 3300025907 Bacteria 2867
100 Ga0207684_10000536 3300025910 Bacteria 47037
101 Ga0207684_10002635 3300025910 Bacteria 17949
102 Ga0207684_10006308 3300025910 Bacteria 10816
103 Ga0207684_10050967 3300025910 Bacteria 3511
104 Ga0207684_10119317 3300025910 Bacteria 2261
105 Ga0207684_10191033 3300025910 Bacteria 1767
106 Ga0207684_10303901 3300025910 Bacteria 1375
107 Ga0207707_10462218 3300025912 Bacteria 1085
108 Ga0207660_10004220 3300025917 Bacteria 9359
109 Ga0207652_10611239 3300025921 Bacteria 977
110 Ga0207646_10000688 3300025922 Bacteria 43754
111 Ga0207646_10063765 3300025922 Bacteria 3289
112 Ga0207646_10078137 3300025922 Bacteria 2958
113 Ga0207646_10156076 3300025922 Bacteria 2058
114 Ga0207646_10175298 3300025922 Bacteria 1936
115 Ga0207646_10284180 3300025922 Bacteria 1495
116 Ga0207706_10159203 3300025933 Bacteria 1985
117 Ga0207686_10191697 3300025934 Bacteria 1458
118 Ga0207709_10383808 3300025935 Bacteria 1070
119 Ga0207704_10087393 3300025938 Bacteria 2036
120 Ga0207689_10050667 3300025942 Bacteria 3423
121 Ga0207689_10093012 3300025942 Bacteria 2477
122 Ga0207712_10020719 3300025961 Bacteria 4309
123 Ga0207708_10036873 3300026075 Bacteria 3723
124 Ga0207708_10041504 3300026075 Bacteria 3508
125 Ga0207674_10091978 3300026116 Bacteria 3023
126 Ga0207675_100114028 3300026118 Bacteria 2552
127 Ga0209588_1000661 3300027671 Bacteria 8654
128 Ga0207428_10000783 3300027907 Bacteria 35993
129 Ga0268265_10032827 3300028380 Bacteria 3767
130 Ga0268265_10050052 3300028380 Bacteria 3146
131 Ga0265337_1012375 3300028556 Bacteria 2902
132 Ga0265319_1097233 3300028563 Bacteria 926
133 Ga0265334_10003019 3300028573 Bacteria 7688
134 Ga0265334_10084817 3300028573 Unclassified 1163
135 Ga0265318_10064387 3300028577 Unclassified 1364
136 Ga0265318_10118507 3300028577 Bacteria 973
137 Ga0265323_10006252 3300028653 Bacteria 5012
138 Ga0265323_10013195 3300028653 Bacteria 3299
139 Ga0265323_10021421 3300028653 Bacteria 2476
140 Ga0265338_10000947 3300028800 Bacteria 48809
141 Ga0265338_10237864 3300028800 Unclassified 1350
142 Ga0265325_10093038 3300031241 Bacteria 1484
143 Ga0265331_10003087 3300031250 Bacteria 10925
144 Ga0265327_10000162 3300031251 Bacteria 144118
145 Ga0265316_10001194 3300031344 Bacteria 28116
146 Ga0265316_10002869 3300031344 Bacteria 17646
147 Ga0265316_10016770 3300031344 Bacteria 6343
148 Ga0265316_10369071 3300031344 Bacteria 1037
149 Ga0265313_10021549 3300031595 Unclassified 3523
150 Ga0316579_10037144 3300031691 Bacteria 2249
151 Ga0265314_10008973 3300031711 Bacteria 8511
152 Ga0265314_10009829 3300031711 Bacteria 8034
153 Ga0265342_10046913 3300031712 Bacteria 2595
154 Ga0265342_10087340 3300031712 Bacteria 1792
155 Ga0265342_10134293 3300031712 Unclassified 1384
156 Ga0316576_10000469 3300031727 Bacteria 18921
157 Ga0316576_10270694 3300031727 Bacteria 1273
158 Ga0316577_10020422 3300031733 Bacteria 3671
159 Ga0316577_10142380 3300031733 Archaea 1351
160 Ga0316583_10081112 3300032133 Bacteria 1134
161 Ga0316580_10057606 3300032139 Bacteria 1194
162 Ga0316582_0011062 3300036647 Unclassified 4976
163 Ga0316582_0031277 3300036647 Bacteria 3252
164 Ga0316582_0075594 3300036647 Unclassified 2189
165 Ga0316584_0374524 3300036712 Bacteria 1019
166 Ga0400484_11723 3300038725 Unclassified 3912
167 Ga0400490_51400 3300038726 Bacteria 1694
168 Ga0400483_023647 3300039062 Bacteria 3349
169 Ga0451577_0000727 3300042876 Bacteria 51041
170 Ga0451577_0026132 3300042876 Bacteria 5289
171 Ga0451577_0042769 3300042876 Bacteria 4061
172 Ga0451577_0311810 3300042876 Bacteria 1426
173 Ga0451577_0347075 3300042876 Bacteria 1346
174 Ga0453683_0009041 3300044673 Bacteria 6656
175 Ga0453683_0012206 3300044673 Bacteria 5635
176 Ga0453684_0001047 3300044712 Bacteria 88484
177 Ga0453684_0017702 3300044712 Bacteria 11009
178 Ga0453684_0036962 3300044712 Bacteria 6714
179 Ga0451576_0000246 3300045051 Bacteria 132778
180 Ga0451576_0002689 3300045051 Bacteria 25896
181 Ga0451576_0003717 3300045051 Bacteria 20634
182 Ga0451576_0010533 3300045051 Bacteria 10597
183 Ga0451576_0011991 3300045051 Bacteria 9789
184 Ga0451576_0024165 3300045051 Bacteria 6567
185 Ga0451576_0071603 3300045051 Unclassified 3609
186 Ga0451576_0184160 3300045051 Bacteria 2181
187 Ga0451576_0320666 3300045051 Bacteria 1621
188 Ga0451576_0478516 3300045051 Bacteria 1308
189 Ga0495580_0110533 3300046472 Bacteria 1909
190 Ga0501033_0105143 3300049570 Bacteria 2058
191 Ga0501034_0010288 3300049571 Bacteria 9754
192 Ga0501034_0011466 3300049571 Bacteria 9185
193 Ga0501036_0237433 3300049572 Bacteria 1529
194 Ga0501040_0045127 3300049576 Bacteria 3005
195 Ga0501041_0011052 3300049577 Bacteria 5332
196 Ga0501042_0073917 3300049578 Bacteria 2439
197 Ga0501072_0076617 3300049588 Bacteria 2646
198 Ga0501075_0006045 3300049591 Bacteria 8301
199 Ga0501076_0355050 3300049592 Bacteria 1204
200 Ga0501077_0057127 3300049593 Bacteria 2478
201 Ga0501079_0004656 3300049741 Bacteria 10162
202 Ga0501081_0001451 3300049743 Bacteria 14519
203 nmdc:mga05p37_357138_c1 3300050507 Bacteria 1719
204 nmdc:mga05p37_835710_c1 3300050507 Bacteria 1002
205 nmdc:mga05p37_9813_c1 3300050507 Bacteria 11363
206 nmdc:mga09592_255689_c1 3300050508 Bacteria 1518
207 nmdc:mga06r32_568988_c1 3300050510 Bacteria 1106
208 nmdc:mga06r32_67406_c1 3300050510 Bacteria 3455
209 nmdc:mga06r32_769_c1 3300050510 Bacteria 28288
210 nmdc:mga08y16_1013_c1 3300050511 Bacteria 27501
211 nmdc:mga0n895_24736_c1 3300050512 Bacteria 5662
212 nmdc:mga0n895_358245_c1 3300050512 Bacteria 1477
213 nmdc:mga0n895_89228_c1 3300050512 Bacteria 3084
214 nmdc:mga0rr50_4198_c1 3300050513 Bacteria 8425
215 nmdc:mga0a205_4109_c1 3300050515 Bacteria 13023
216 nmdc:mga0a205_6209_c1 3300050515 Bacteria 10787
217 nmdc:mga0a205_826_c1 3300050515 Bacteria 25211
218 Ga0495619_0008165 3300053085 Bacteria 6624
219 Ga0500594_0000002 3300053118 Bacteria 916890
220 Ga0500608_002254 3300053122 Bacteria 6966
221 Ga0501084_0002849 3300054114 Bacteria 13974
222 Ga0530510_0142913 3300061734 Bacteria 1764
223 Ga0157374_10000987
224 rootH2_10044461
225 Ga0068869_100006406
226 Ga0068869_100039086
227 Ga0070680_100001053
228 Ga0070691_10006829
229 Ga0070692_10030446
230 Ga0070692_10056583
231 Ga0070703_10005200
232 Ga0070701_10002377
233 Ga0070705_100017206
234 Ga0070705_100049072
235 Ga0070700_100027791
236 Ga0070700_100034300
237 Ga0070694_100000432
238 Ga0070694_100016698
239 Ga0070694_100118926
240 Ga0070708_100012971
241 Ga0070708_100101423
242 Ga0070708_100124996
243 Ga0070708_100148914
244 Ga0070662_100233888
245 Ga0070681_10175688
246 Ga0070706_100001785
247 Ga0070706_100010686
248 Ga0070706_100316078
249 Ga0070706_100362117
250 Ga0070706_100446836
251 Ga0070707_100005788
252 Ga0070707_100041038
253 Ga0070707_100081648
254 Ga0070707_100099609
255 Ga0070707_100100822
256 Ga0070707_100158809
257 Ga0070698_100005227
258 Ga0070698_100227084
259 Ga0070698_100240017
260 Ga0070699_100009458
261 Ga0070699_100011276
262 Ga0070699_100068156
263 Ga0070699_100093316
264 Ga0070699_100117063
265 Ga0070699_100120189
266 Ga0070699_100135737
267 Ga0070679_100062171
268 Ga0070697_100001742
269 Ga0070697_100161908
270 Ga0070697_100312139
271 Ga0070695_100000260
272 Ga0070695_100007481
273 Ga0070695_100025647
274 Ga0070696_100017987
275 Ga0070693_100492476
276 Ga0070704_100077477
277 Ga0070704_100118698
278 Ga0068857_100176491
279 Ga0068859_100824626
280 Ga0068861_100086929
281 Ga0068861_100708185
282 Ga0068870_10019785
283 Ga0068863_100123538
284 Ga0068862_100004786
285 Ga0068862_100009418
286 Ga0068862_100010621
287 Ga0081538_10012605
288 Ga0070712_100000931
289 Ga0075428_100498836
290 Ga0075431_100000510
291 Ga0075433_10000716
292 Ga0075433_10001649
293 Ga0075433_10063703
294 Ga0075433_10075421
295 Ga0075434_100009307
296 Ga0075434_100051997
297 Ga0075434_100612193
298 Ga0075429_100216929
299 Ga0097620_100025742
300 Ga0097620_100824542
301 Ga0075435_100028461
302 Ga0099794_10039752
303 Ga0099794_10162944
304 Ga0111539_10000395
305 Ga0114129_10111433
306 Ga0114129_10473358
307 Ga0105243_10015211
308 Ga0105243_10184480
309 Ga0105242_10020642
310 Ga0105242_10366652
311 Ga0105248_10236165
312 Ga0105249_10143948
313 Ga0105239_10001800
314 Ga0157326_1000410
315 Ga0157371_10234606
316 Ga0157375_10184133
317 Ga0157376_10002335
318 Ga0207653_10003091
319 Ga0207653_10013684
320 Ga0207653_10027895
321 Ga0207645_10043712
322 Ga0207684_10000536
323 Ga0207684_10002635
324 Ga0207684_10006308
325 Ga0207684_10050967
326 Ga0207684_10119317
327 Ga0207684_10191033
328 Ga0207684_10303901
329 Ga0207707_10462218
330 Ga0207660_10004220
331 Ga0207652_10611239
332 Ga0207646_10000688
333 Ga0207646_10063765
334 Ga0207646_10078137
335 Ga0207646_10156076
336 Ga0207646_10175298
337 Ga0207646_10284180
338 Ga0207706_10159203
339 Ga0207686_10191697
340 Ga0207709_10383808
341 Ga0207704_10087393
342 Ga0207689_10050667
343 Ga0207689_10093012
344 Ga0207712_10020719
345 Ga0207708_10036873
346 Ga0207708_10041504
347 Ga0207674_10091978
348 Ga0207675_100114028
349 Ga0209588_1000661
350 Ga0207428_10000783
351 Ga0268265_10032827
352 Ga0268265_10050052
353 Ga0265337_1012375
354 Ga0265319_1097233
355 Ga0265334_10003019
356 Ga0265334_10084817
357 Ga0265318_10064387
358 Ga0265318_10118507
359 Ga0265323_10006252
360 Ga0265323_10013195
361 Ga0265323_10021421
362 Ga0265338_10000947
363 Ga0265338_10237864
364 Ga0265325_10093038
365 Ga0265331_10003087
366 Ga0265327_10000162
367 Ga0265316_10001194
368 Ga0265316_10002869
369 Ga0265316_10016770
370 Ga0265316_10369071
371 Ga0265313_10021549
372 Ga0316579_10037144
373 Ga0265314_10008973
374 Ga0265314_10009829
375 Ga0265342_10046913
376 Ga0265342_10087340
377 Ga0265342_10134293
378 Ga0316576_10000469
379 Ga0316576_10270694
380 Ga0316577_10020422
381 Ga0316577_10142380
382 Ga0316583_10081112
383 Ga0316580_10057606
384 Ga0316582_0011062
385 Ga0316582_0031277
386 Ga0316582_0075594
387 Ga0316584_0374524
388 Ga0400484_11723
389 Ga0400490_51400
390 Ga0400483_023647
391 Ga0451577_0000727
392 Ga0451577_0026132
393 Ga0451577_0042769
394 Ga0451577_0311810
395 Ga0451577_0347075
396 Ga0453683_0009041
397 Ga0453683_0012206
398 Ga0453684_0001047
399 Ga0453684_0017702
400 Ga0453684_0036962
401 Ga0451576_0000246
402 Ga0451576_0002689
403 Ga0451576_0003717
404 Ga0451576_0010533
405 Ga0451576_0011991
406 Ga0451576_0024165
407 Ga0451576_0071603
408 Ga0451576_0184160
409 Ga0451576_0320666
410 Ga0451576_0478516
411 Ga0495580_0110533
412 Ga0501033_0105143
413 Ga0501034_0010288
414 Ga0501034_0011466
415 Ga0501036_0237433
416 Ga0501040_0045127
417 Ga0501041_0011052
418 Ga0501042_0073917
419 Ga0501072_0076617
420 Ga0501075_0006045
421 Ga0501076_0355050
422 Ga0501077_0057127
423 Ga0501079_0004656
424 Ga0501081_0001451
425 nmdc:mga05p37_357138_c1
426 nmdc:mga05p37_835710_c1
427 nmdc:mga05p37_9813_c1
428 nmdc:mga09592_255689_c1
429 nmdc:mga06r32_568988_c1
430 nmdc:mga06r32_67406_c1
431 nmdc:mga06r32_769_c1
432 nmdc:mga08y16_1013_c1
433 nmdc:mga0n895_24736_c1
434 nmdc:mga0n895_358245_c1
435 nmdc:mga0n895_89228_c1
436 nmdc:mga0rr50_4198_c1
437 nmdc:mga0a205_4109_c1
438 nmdc:mga0a205_6209_c1
439 nmdc:mga0a205_826_c1
440 Ga0495619_0008165
441 Ga0500594_0000002
442 Ga0500608_002254
443 Ga0501084_0002849
444 Ga0530510_0142913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

55

297

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g0r-assembly1.cif.gz_A complex of mth0212 and an 8bp dsdna with distorted ends 0.9511 4 257
3g4t-assembly1.cif.gz_A mth0212 (wt) in complex with a 7bp dsdna 0.9505 4 256
3g91-assembly1.cif.gz_A 1.2 angstrom structure of the exonuclease iii homologue mth0212 0.9487 2 258
3w2y-assembly2.cif.gz_D crystal structure of dna uridine endonuclease mth212 mutant w205s 0.9474 2 257
5j8n-assembly1.cif.gz_A exonuclease iii homologue mm3148 from methanosarcina mazei 0.9465 1 258
ID Description Score Start End Superfamily
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9502 2 258 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9466 2 258 3.60.10.10
af_P51173_13_359_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9342 2 256 3.60.10.10
af_P27864_388_678_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9337 4 256 3.60.10.10
4qh9A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.931 4 255 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A354KP14-F1-model_v4 deleted 0.9738 6 199
AF-A0A5J4N4C4-F1-model_v4 exodeoxyribonuclease III (EC 3.1.11.2) 0.9716 4 108 GO:0003677
GO:0003906
GO:0004519
GO:0005634
GO:0006284
GO:0008081
GO:0008311
GO:0046872
AF-A0A382Z521-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.969 5 151 GO:0003677
GO:0003906
GO:0004519
GO:0006284
GO:0008081
GO:0008311
AF-A0A7Z9WZX8-F1-model_v4 Exodeoxyribonuclease III 0.9688 4 108 GO:0000703
GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0006289
GO:0016829
GO:0046872
GO:0051539
AF-A0A7U8ICA6-F1-model_v4 deleted 0.9683 4 142

Map