F334448

General Info

Members Datasets Scaffolds Average Seq Length
222 164 444 155

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10669107|Ga0105239_106691071
Length 175
Sequence MAAGVSGFRRIAGYPDLAKDAGVTVTRSEKPSTVKVRKPRTGNGDGEALFDAYPAPIKAKLLALRRLILATAKATPGVGALQETLKWGQPSYLTAETGSGSTIRIDQVKPAADQYAVYFHCQANLVETFRELYPELSYSGNRAILLDAKEKLPEAALRHCVALALTYHLNRRKAK

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
31 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
34 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
50 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
51 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
52 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
58 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
59 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
60 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
61 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
131 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
132 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
133 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
134 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
135 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
136 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
137 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
140 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
141 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
142 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
143 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
144 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
145 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
146 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
147 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
148 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
149 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
150 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
151 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
152 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
153 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
154 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
155 2904699407
156 2906610324
157 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
158 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
159 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
160 2922425934
161 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
162 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
163 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
164 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.78
Metatranscriptomes 0
Isolates 8.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.26
Nodule 7.66
Rhizoplane 3.6
Rhizosphere 67.12
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10669107 3300010375 Bacteria 1186
2 JGI25404J52841_10000834 3300003659 Bacteria 4939
3 JGI25404J52841_10000864 3300003659 Bacteria 4891
4 JGI25404J52841_10002896 3300003659 Bacteria 3322
5 JGI25404J52841_10016569 3300003659 Bacteria 1598
6 JGI25404J52841_10032045 3300003659 Bacteria 1121
7 Ga0070666_10128199 3300005335 Bacteria 1762
8 Ga0070709_10007489 3300005434 Bacteria 5985
9 Ga0070709_10022933 3300005434 Bacteria 3658
10 Ga0070709_10245750 3300005434 Bacteria 1287
11 Ga0070714_100018950 3300005435 Bacteria 5598
12 Ga0070714_100106044 3300005435 Bacteria 2482
13 Ga0070713_100011151 3300005436 Bacteria 6533
14 Ga0070713_100021012 3300005436 Bacteria 5012
15 Ga0070713_100065320 3300005436 Bacteria 3056
16 Ga0070713_100145390 3300005436 Bacteria 2104
17 Ga0070710_10011751 3300005437 Bacteria 4334
18 Ga0070710_10034302 3300005437 Bacteria 2760
19 Ga0070711_100003658 3300005439 Bacteria 8987
20 Ga0070711_100008292 3300005439 Bacteria 6357
21 Ga0070711_100903238 3300005439 Bacteria 754
22 Ga0070706_100328734 3300005467 Bacteria 1426
23 Ga0070698_100076525 3300005471 Bacteria 3348
24 Ga0070699_100400067 3300005518 Bacteria 1241
25 Ga0068855_101474830 3300005563 Bacteria 699
26 Ga0068864_100167105 3300005618 Bacteria 2004
27 Ga0068858_100702777 3300005842 Bacteria 984
28 Ga0081455_10021689 3300005937 Bacteria 6018
29 Ga0081455_10048983 3300005937 Bacteria 3646
30 Ga0081455_10585569 3300005937 Bacteria 730
31 Ga0081540_1006166 3300005983 Bacteria 8793
32 Ga0081540_1006293 3300005983 Bacteria 8687
33 Ga0081540_1013510 3300005983 Bacteria 5304
34 Ga0081540_1023372 3300005983 Bacteria 3617
35 Ga0081540_1049854 3300005983 Bacteria 2085
36 Ga0081540_1071438 3300005983 Bacteria 1604
37 Ga0081539_10014277 3300005985 Bacteria 5890
38 Ga0070717_10019356 3300006028 Bacteria 5338
39 Ga0070716_100010003 3300006173 Bacteria 4743
40 Ga0070716_100730583 3300006173 Bacteria 759
41 Ga0070712_100017429 3300006175 Bacteria 4649
42 Ga0070712_100162873 3300006175 Bacteria 1724
43 Ga0075434_100019895 3300006871 Bacteria 6501
44 Ga0075436_100879260 3300006914 Bacteria 669
45 Ga0099822_1003320 3300006943 Bacteria 20578
46 Ga0099794_10192875 3300007265 Bacteria 1042
47 Ga0114129_11062463 3300009147 Bacteria 1016
48 Ga0105249_11844594 3300009553 Bacteria 677
49 Ga0105239_10766578 3300010375 Bacteria 1105
50 Ga0163162_10526138 3300013306 Bacteria 1312
51 Ga0157375_10551587 3300013308 Bacteria 1314
52 Ga0163161_10551912 3300017792 Bacteria 944
53 Ga0213873_10076250 3300021358 Bacteria 931
54 Ga0213874_10014839 3300021377 Bacteria 2044
55 Ga0213876_10000976 3300021384 Bacteria 18836
56 Ga0213876_10114359 3300021384 Bacteria 1432
57 Ga0213876_10116983 3300021384 Bacteria 1415
58 Ga0213871_10100359 3300021441 Bacteria 846
59 Ga0209677_100550 3300025253 Bacteria 20817
60 Ga0209233_1003426 3300025261 Bacteria 5587
61 Ga0209455_1011352 3300025272 Bacteria 2198
62 Ga0207692_10011545 3300025898 Bacteria 3764
63 Ga0207692_10020440 3300025898 Bacteria 3011
64 Ga0207692_10022020 3300025898 Bacteria 2926
65 Ga0207692_10371627 3300025898 Bacteria 886
66 Ga0207699_10075080 3300025906 Bacteria 2078
67 Ga0207643_10358120 3300025908 Bacteria 917
68 Ga0207684_10238192 3300025910 Bacteria 1570
69 Ga0207684_10260138 3300025910 Bacteria 1497
70 Ga0207693_10024600 3300025915 Bacteria 4776
71 Ga0207693_10128916 3300025915 Bacteria 1989
72 Ga0207663_10045346 3300025916 Bacteria 2704
73 Ga0207663_10048957 3300025916 Bacteria 2618
74 Ga0207694_10328840 3300025924 Bacteria 1262
75 Ga0207700_10075468 3300025928 Bacteria 2612
76 Ga0207700_10096655 3300025928 Bacteria 2346
77 Ga0207700_10832725 3300025928 Bacteria 825
78 Ga0207664_10009273 3300025929 Bacteria 6897
79 Ga0207664_10019674 3300025929 Bacteria 4995
80 Ga0207664_10764301 3300025929 Bacteria 869
81 Ga0207665_10009810 3300025939 Bacteria 6286
82 Ga0207665_10646008 3300025939 Bacteria 829
83 Ga0207689_10492338 3300025942 Bacteria 1027
84 Ga0207712_10857500 3300025961 Bacteria 801
85 Ga0207712_11189190 3300025961 Bacteria 680
86 Ga0209589_1000276 3300027357 Bacteria 65299
87 Ga0209489_100714 3300027361 Bacteria 65299
88 Ga0209700_100732 3300027363 Bacteria 65299
89 Ga0209588_1129804 3300027671 Bacteria 804
90 Ga0265331_10022521 3300031250 Bacteria 3214
91 Ga0265316_10218623 3300031344 Bacteria 1407
92 Ga0265314_10029320 3300031711 Bacteria 4092
93 Ga0265342_10017297 3300031712 Bacteria 4693
94 Ga0316215_1017126 3300033544 Bacteria 731
95 Ga0373936_0012961 3300035113 Bacteria 3179
96 Ga0373945_0007742 3300035116 Bacteria 3484
97 Ga0373943_0072092 3300035170 Bacteria 1751
98 Ga0373946_0002865 3300035171 Bacteria 6111
99 Ga0373955_0004445 3300035172 Bacteria 6212
100 Ga0373935_0000350 3300035692 Bacteria 23435
101 Ga0373927_0000483 3300035695 Bacteria 30626
102 Ga0373933_0011268 3300035724 Bacteria 4922
103 Ga0373947_0001638 3300035725 Bacteria 13732
104 Ga0373947_0086124 3300035725 Bacteria 1952
105 Ga0373937_0045324 3300036401 Bacteria 4019
106 Ga0373925_0002012 3300037068 Bacteria 16829
107 Ga0436364_0508717 3300037853 Bacteria 622
108 Ga0436365_0164008 3300039437 Bacteria 4006
109 Ga0436365_1659153 3300039437 Bacteria 4467
110 Ga0436360_0031168 3300039438 Bacteria 5062
111 Ga0436360_0109727 3300039438 Bacteria 990
112 Ga0436361_0515269 3300039447 Bacteria 4026
113 Ga0436362_0067136 3300039453 Bacteria 1568
114 Ga0436362_0116062 3300039453 Bacteria 3860
115 Ga0466963_0779728 3300044694 Bacteria 674
116 Ga0466970_0315834 3300044765 Bacteria 883
117 Ga0466959_0070362 3300045049 Bacteria 2535
118 Ga0466967_0014506 3300045976 Bacteria 6141
119 Ga0466967_1210506 3300045976 Unclassified 752
120 Ga0495592_0030805 3300046454 Bacteria 4058
121 Ga0495603_0019489 3300046455 Bacteria 4105
122 Ga0495590_0141976 3300046457 Bacteria 867
123 Ga0495629_0000151 3300046459 Bacteria 60632
124 Ga0495638_0021664 3300046460 Bacteria 4230
125 Ga0495651_0525937 3300046462 Bacteria 754
126 Ga0495580_0000692 3300046472 Bacteria 28762
127 Ga0495582_0000218 3300046473 Bacteria 31814
128 Ga0495639_0001352 3300046475 Bacteria 11004
129 Ga0495662_0000968 3300046476 Bacteria 14076
130 Ga0495664_0005405 3300046477 Bacteria 7014
131 Ga0495594_0002957 3300046499 Bacteria 8810
132 Ga0495594_0088348 3300046499 Bacteria 1735
133 Ga0495608_0207765 3300046511 Bacteria 1232
134 Ga0495630_0001212 3300046517 Bacteria 17791
135 Ga0495630_0061538 3300046517 Bacteria 2819
136 Ga0495666_0008403 3300046526 Bacteria 5176
137 Ga0495665_0000471 3300046531 Bacteria 20276
138 Ga0495640_0023203 3300046533 Bacteria 4528
139 Ga0495586_0051946 3300046535 Bacteria 2218
140 Ga0495622_0009327 3300046557 Bacteria 4539
141 Ga0495667_0014586 3300046559 Bacteria 5308
142 Ga0495656_0171506 3300046615 Bacteria 1061
143 Ga0495634_0000780 3300046642 Bacteria 30840
144 Ga0495635_0007349 3300046663 Bacteria 7688
145 Ga0495588_0014140 3300046674 Bacteria 3815
146 Ga0495599_0084939 3300046678 Bacteria 1977
147 Ga0495623_0354230 3300046679 Bacteria 799
148 Ga0495646_0021401 3300046680 Bacteria 4085
149 Ga0495658_0000542 3300046683 Bacteria 20582
150 Ga0495658_0032687 3300046683 Bacteria 2843
151 Ga0495613_0001185 3300046689 Bacteria 19921
152 Ga0495624_0002867 3300046690 Bacteria 12913
153 Ga0495581_0000271 3300047315 Bacteria 25033
154 Ga0495674_0000664 3300047319 Bacteria 32284
155 Ga0495676_0003614 3300047321 Bacteria 14032
156 Ga0495680_0056137 3300047322 Bacteria 3050
157 Ga0495684_0047155 3300047471 Bacteria 3296
158 Ga0495684_0697089 3300047471 Bacteria 674
159 Ga0495593_0000063 3300047673 Bacteria 45066
160 Ga0495614_0049725 3300048089 Bacteria 1797
161 Ga0496101_0169191 3300048904 Bacteria 1679
162 Ga0496102_0053191 3300048905 Bacteria 3692
163 Ga0496102_0094655 3300048905 Bacteria 2768
164 Ga0496104_0572727 3300048907 Bacteria 1040
165 Ga0496106_0346165 3300048909 Bacteria 1194
166 Ga0496106_0349872 3300048909 Bacteria 1187
167 Ga0496107_0503272 3300048910 Bacteria 899
168 Ga0496118_0107295 3300048921 Bacteria 1865
169 Ga0496121_0007720 3300048924 Bacteria 12905
170 Ga0496121_0260981 3300048924 Bacteria 1196
171 Ga0496126_0015876 3300048929 Bacteria 7561
172 Ga0496126_0061850 3300048929 Bacteria 3361
173 Ga0496126_0066732 3300048929 Bacteria 3216
174 Ga0496126_0082624 3300048929 Bacteria 2838
175 Ga0496126_0161409 3300048929 Bacteria 1915
176 Ga0501075_0934566 3300049591 Bacteria 659
177 nmdc:mga03n38_128712_c1 3300050490 Bacteria 1252
178 nmdc:mga0yw44_584991_c1 3300050492 Bacteria 758
179 nmdc:mga0n895_68342_c1 3300050512 Bacteria 3520
180 nmdc:mga0rr50_127407_c1 3300050513 Bacteria 2034
181 Ga0500635_0047261 3300053080 Bacteria 1462
182 Ga0495619_0065983 3300053085 Bacteria 2416
183 Ga0500647_0027220 3300053091 Bacteria 2701
184 Ga0500566_0019446 3300053094 Bacteria 3987
185 Ga0500640_027166 3300053095 Bacteria 2497
186 Ga0500572_000373 3300053111 Bacteria 15944
187 Ga0500572_003759 3300053111 Bacteria 3444
188 Ga0500592_016529 3300053116 Bacteria 1184
189 Ga0500595_001879 3300053119 Bacteria 10842
190 Ga0500608_133451 3300053122 Bacteria 1110
191 Ga0500628_194798 3300053129 Bacteria 583
192 Ga0500559_0001759 3300053136 Bacteria 11887
193 Ga0500559_0150942 3300053136 Bacteria 1090
194 Ga0500559_0151000 3300053136 Bacteria 1090
195 Ga0500639_138187 3300053163 Bacteria 1143
196 Ga0500637_0032185 3300053178 Bacteria 2923
197 Ga0500576_045565 3300053725 Bacteria 1961
198 Ga0500576_112389 3300053725 Bacteria 1090
199 Ga0500596_000385 3300053735 Bacteria 8029
200 Ga0500596_005489 3300053735 Bacteria 2224
201 Ga0500601_036088 3300053737 Bacteria 595
202 2509149928 2508501128 Bacteria 8613869
203 2513658896 2513237096 Bacteria 8722461
204 2513858911 2513237137 Bacteria 9558895
205 2513889667 2513237141 Bacteria 8496279
206 2513921160 2513237145 Bacteria 8979722
207 2517889526 2517572143 Bacteria 9484767
208 2524539747 2524023228 Bacteria 10118060
209 2671121282 2667528175 Bacteria 7532676
210 2728751866 2728368998 Bacteria 8720350
211 2885380054 2885374607 Bacteria 8927485
212 2903753970 2903748898 Bacteria 9972761
213 2904709335
214 2906613092
215 2906641196 2906635258 Bacteria 8601019
216 2906665752 2906660503 Bacteria 8595048
217 2908748026 2908739725 Bacteria 8628932
218 2922433584
219 3005483238 3005474847 Bacteria 9259049
220 8006935619 8006933436 Bacteria 10410654
221 8006975547 8006973647 Bacteria 10679141
222 8019573271 8019565922 Bacteria 9639779
223 Ga0105239_10669107
224 JGI25404J52841_10000834
225 JGI25404J52841_10000864
226 JGI25404J52841_10002896
227 JGI25404J52841_10016569
228 JGI25404J52841_10032045
229 Ga0070666_10128199
230 Ga0070709_10007489
231 Ga0070709_10022933
232 Ga0070709_10245750
233 Ga0070714_100018950
234 Ga0070714_100106044
235 Ga0070713_100011151
236 Ga0070713_100021012
237 Ga0070713_100065320
238 Ga0070713_100145390
239 Ga0070710_10011751
240 Ga0070710_10034302
241 Ga0070711_100003658
242 Ga0070711_100008292
243 Ga0070711_100903238
244 Ga0070706_100328734
245 Ga0070698_100076525
246 Ga0070699_100400067
247 Ga0068855_101474830
248 Ga0068864_100167105
249 Ga0068858_100702777
250 Ga0081455_10021689
251 Ga0081455_10048983
252 Ga0081455_10585569
253 Ga0081540_1006166
254 Ga0081540_1006293
255 Ga0081540_1013510
256 Ga0081540_1023372
257 Ga0081540_1049854
258 Ga0081540_1071438
259 Ga0081539_10014277
260 Ga0070717_10019356
261 Ga0070716_100010003
262 Ga0070716_100730583
263 Ga0070712_100017429
264 Ga0070712_100162873
265 Ga0075434_100019895
266 Ga0075436_100879260
267 Ga0099822_1003320
268 Ga0099794_10192875
269 Ga0114129_11062463
270 Ga0105249_11844594
271 Ga0105239_10766578
272 Ga0163162_10526138
273 Ga0157375_10551587
274 Ga0163161_10551912
275 Ga0213873_10076250
276 Ga0213874_10014839
277 Ga0213876_10000976
278 Ga0213876_10114359
279 Ga0213876_10116983
280 Ga0213871_10100359
281 Ga0209677_100550
282 Ga0209233_1003426
283 Ga0209455_1011352
284 Ga0207692_10011545
285 Ga0207692_10020440
286 Ga0207692_10022020
287 Ga0207692_10371627
288 Ga0207699_10075080
289 Ga0207643_10358120
290 Ga0207684_10238192
291 Ga0207684_10260138
292 Ga0207693_10024600
293 Ga0207693_10128916
294 Ga0207663_10045346
295 Ga0207663_10048957
296 Ga0207694_10328840
297 Ga0207700_10075468
298 Ga0207700_10096655
299 Ga0207700_10832725
300 Ga0207664_10009273
301 Ga0207664_10019674
302 Ga0207664_10764301
303 Ga0207665_10009810
304 Ga0207665_10646008
305 Ga0207689_10492338
306 Ga0207712_10857500
307 Ga0207712_11189190
308 Ga0209589_1000276
309 Ga0209489_100714
310 Ga0209700_100732
311 Ga0209588_1129804
312 Ga0265331_10022521
313 Ga0265316_10218623
314 Ga0265314_10029320
315 Ga0265342_10017297
316 Ga0316215_1017126
317 Ga0373936_0012961
318 Ga0373945_0007742
319 Ga0373943_0072092
320 Ga0373946_0002865
321 Ga0373955_0004445
322 Ga0373935_0000350
323 Ga0373927_0000483
324 Ga0373933_0011268
325 Ga0373947_0001638
326 Ga0373947_0086124
327 Ga0373937_0045324
328 Ga0373925_0002012
329 Ga0436364_0508717
330 Ga0436365_0164008
331 Ga0436365_1659153
332 Ga0436360_0031168
333 Ga0436360_0109727
334 Ga0436361_0515269
335 Ga0436362_0067136
336 Ga0436362_0116062
337 Ga0466963_0779728
338 Ga0466970_0315834
339 Ga0466959_0070362
340 Ga0466967_0014506
341 Ga0466967_1210506
342 Ga0495592_0030805
343 Ga0495603_0019489
344 Ga0495590_0141976
345 Ga0495629_0000151
346 Ga0495638_0021664
347 Ga0495651_0525937
348 Ga0495580_0000692
349 Ga0495582_0000218
350 Ga0495639_0001352
351 Ga0495662_0000968
352 Ga0495664_0005405
353 Ga0495594_0002957
354 Ga0495594_0088348
355 Ga0495608_0207765
356 Ga0495630_0001212
357 Ga0495630_0061538
358 Ga0495666_0008403
359 Ga0495665_0000471
360 Ga0495640_0023203
361 Ga0495586_0051946
362 Ga0495622_0009327
363 Ga0495667_0014586
364 Ga0495656_0171506
365 Ga0495634_0000780
366 Ga0495635_0007349
367 Ga0495588_0014140
368 Ga0495599_0084939
369 Ga0495623_0354230
370 Ga0495646_0021401
371 Ga0495658_0000542
372 Ga0495658_0032687
373 Ga0495613_0001185
374 Ga0495624_0002867
375 Ga0495581_0000271
376 Ga0495674_0000664
377 Ga0495676_0003614
378 Ga0495680_0056137
379 Ga0495684_0047155
380 Ga0495684_0697089
381 Ga0495593_0000063
382 Ga0495614_0049725
383 Ga0496101_0169191
384 Ga0496102_0053191
385 Ga0496102_0094655
386 Ga0496104_0572727
387 Ga0496106_0346165
388 Ga0496106_0349872
389 Ga0496107_0503272
390 Ga0496118_0107295
391 Ga0496121_0007720
392 Ga0496121_0260981
393 Ga0496126_0015876
394 Ga0496126_0061850
395 Ga0496126_0066732
396 Ga0496126_0082624
397 Ga0496126_0161409
398 Ga0501075_0934566
399 nmdc:mga03n38_128712_c1
400 nmdc:mga0yw44_584991_c1
401 nmdc:mga0n895_68342_c1
402 nmdc:mga0rr50_127407_c1
403 Ga0500635_0047261
404 Ga0495619_0065983
405 Ga0500647_0027220
406 Ga0500566_0019446
407 Ga0500640_027166
408 Ga0500572_000373
409 Ga0500572_003759
410 Ga0500592_016529
411 Ga0500595_001879
412 Ga0500608_133451
413 Ga0500628_194798
414 Ga0500559_0001759
415 Ga0500559_0150942
416 Ga0500559_0151000
417 Ga0500639_138187
418 Ga0500637_0032185
419 Ga0500576_045565
420 Ga0500576_112389
421 Ga0500596_000385
422 Ga0500596_005489
423 Ga0500601_036088
424 2509149928
425 2513658896
426 2513858911
427 2513889667
428 2513921160
429 2517889526
430 2524539747
431 2671121282
432 2728751866
433 2885380054
434 2903753970
435 2904709335
436 2906613092
437 2906641196
438 2906665752
439 2908748026
440 2922433584
441 3005483238
442 8006935619
443 8006975547
444 8019573271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

58

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7732 21 147
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7667 19 149
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.728 21 147
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.723 19 149
7fz5-assembly1.cif.gz_A crystal structure of human fabp4 in complex with rac-(2r)-1-[[3-(3-cyclopropyl-1,2,4-oxadiazol-5-yl)-4,5,6,7-tetrahydro-1-benzothiophen-2-yl]carbamoyl]pyrrolidine-2-carboxylic acid 0.7041 55 94
ID Description Score Start End Superfamily
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7917 19 145 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7733 19 145 3.90.1150.200
af_P0AEX5_1_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6333 88 145 3.40.50.300
af_I1JVV8_800_1053_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.6017 55 93 2.70.98.10
2p1xA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Frataxin/CyaY 0.5571 31 93 3.30.920.10
ID Description Score Start End GO Terms
AF-A0A1B1UR56-F1-model_v4 YdhG-like domain-containing protein 0.9963 19 147
AF-A0A0F6IGH5-F1-model_v4 PF08818 domain protein 0.989 88 145
AF-A0A1D7UTP0-F1-model_v4 YdhG-like domain-containing protein 0.9886 15 147
AF-A0A3D9HWJ0-F1-model_v4 Uncharacterized protein DUF1801 0.9883 38 145
AF-A0A843SSP7-F1-model_v4 DUF1801 domain-containing protein 0.9873 31 135

Map