F334397

General Info

Members Datasets Scaffolds Average Seq Length
222 178 444 454

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10021036|Ga0105247_100210363
Length 487
Sequence MAEEAAPSPSGTKHTDEAGVLAPSTLEDVSSPSLPFVETGSYPTRGGNQIRPWIDGEPAFRRICEAIDAAQHSVWATVTFMWSSFQMPDDRGSALDVLERAARRGIDVRIIFWRPDDQLAHLRQNAFWGSAGHVELLSQRHPHLNVRWDRAPAGYCQHQKSWLVDATHGDATAFVGGINLNPHSVVGPGHRGEGQNHDVYIELAGPAVADVHHNFVQRWNEASERASHDGRWGNRSDDSLAFPDRTPAERGSALVQMQRTIPAGCYTNGHPPPAWSAFEIARGERTNLEQYCASIRSARRTIYVENQYVEVPEIVDALTEAVRRGIQVVLLLPAVPDISSLSAATPERIAFLESRASLAAYDNVTLCGIAGLGDDGHRKPVYVHAKIMLIDDAWATVGSCNLHRWSLTGNGELNAAFWDPETVRALRVELFQEHLARDTSDLDDTEALRLFRRIARDNRQRHERRDPHWQGLACSLNLATYGQERQF

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
173 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
174 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
175 2818991459 Paenibacillus sp. 597 Isolate Unclassified
176 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
177 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
178 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 0
Isolates 3.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.95
Nodule 0.45
Rhizoplane 1.35
Rhizosphere 87.84
Stem 0
Stem Tuber 0
Unclassified 4.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10021036 3300009101 Bacteria 3925
2 JGI25406J46586_10000126 3300003203 Bacteria 33162
3 rootH1_10158439 3300003316 Bacteria 2410
4 rootH2_10238985 3300003320 Bacteria 2000
5 rootL2_10144744 3300003322 Bacteria 2694
6 Ga0070658_10015733 3300005327 Bacteria 6050
7 Ga0070683_100000368 3300005329 Bacteria 31242
8 Ga0070670_100011923 3300005331 Bacteria 7433
9 Ga0070670_100012150 3300005331 Bacteria 7366
10 Ga0068869_100003193 3300005334 Bacteria 10015
11 Ga0070666_10014054 3300005335 Bacteria 5090
12 Ga0070666_10144928 3300005335 Bacteria 1655
13 Ga0070671_100001278 3300005355 Bacteria 18877
14 Ga0070667_100001018 3300005367 Bacteria 25570
15 Ga0070663_100103600 3300005455 Unclassified 2127
16 Ga0070706_100000220 3300005467 Bacteria 69811
17 Ga0070707_100013081 3300005468 Bacteria 7754
18 Ga0070698_100026462 3300005471 Bacteria 6039
19 Ga0070698_100184268 3300005471 Bacteria 2025
20 Ga0070698_100209165 3300005471 Unclassified 1886
21 Ga0070699_100064292 3300005518 Bacteria 3182
22 Ga0070699_100065518 3300005518 Bacteria 3153
23 Ga0070699_100072791 3300005518 Unclassified 2990
24 Ga0070684_100000336 3300005535 Bacteria 32547
25 Ga0070665_100010475 3300005548 Bacteria 9383
26 Ga0070665_100066071 3300005548 Bacteria 3628
27 Ga0070665_100092108 3300005548 Bacteria 3036
28 Ga0070664_100028435 3300005564 Bacteria 4650
29 Ga0070664_100158799 3300005564 Bacteria 1999
30 Ga0068857_100003502 3300005577 Bacteria 13106
31 Ga0068856_100001109 3300005614 Bacteria 28428
32 Ga0068852_100000020 3300005616 Bacteria 126369
33 Ga0068859_100003553 3300005617 Bacteria 15882
34 Ga0068859_100062769 3300005617 Bacteria 3746
35 Ga0068864_100003226 3300005618 Bacteria 13480
36 Ga0068863_100000102 3300005841 Bacteria 92290
37 Ga0068863_100000874 3300005841 Bacteria 30198
38 Ga0068858_100002511 3300005842 Bacteria 18501
39 Ga0068860_100000118 3300005843 Bacteria 127169
40 Ga0068860_100001082 3300005843 Bacteria 30043
41 Ga0068862_100163630 3300005844 Bacteria 1987
42 Ga0081455_10020594 3300005937 Bacteria 6205
43 Ga0081455_10036235 3300005937 Bacteria 4397
44 Ga0081540_1028065 3300005983 Bacteria 3171
45 Ga0081539_10000064 3300005985 Bacteria 247020
46 Ga0081539_10007368 3300005985 Bacteria 10064
47 Ga0081539_10021939 3300005985 Bacteria 4243
48 Ga0075365_10036209 3300006038 Bacteria 3197
49 Ga0075364_10038762 3300006051 Bacteria 3088
50 Ga0070715_10008474 3300006163 Bacteria 3585
51 Ga0097621_100002829 3300006237 Bacteria 11899
52 Ga0068871_100002038 3300006358 Bacteria 13697
53 Ga0075436_100039861 3300006914 Unclassified 3241
54 Ga0097620_100003553 3300006931 Bacteria 15882
55 Ga0097620_100062769 3300006931 Bacteria 3746
56 Ga0099795_10013002 3300007788 Bacteria 2541
57 Ga0105240_10000145 3300009093 Bacteria 143918
58 Ga0105240_10001315 3300009093 Bacteria 42896
59 Ga0105240_10002041 3300009093 Bacteria 33251
60 Ga0105240_10276771 3300009093 Bacteria 1930
61 Ga0111539_10019565 3300009094 Bacteria 8352
62 Ga0105245_10013348 3300009098 Bacteria 7158
63 Ga0105247_10001975 3300009101 Bacteria 14247
64 Ga0105241_10000990 3300009174 Bacteria 21523
65 Ga0105241_10095530 3300009174 Unclassified 2353
66 Ga0105242_10073511 3300009176 Bacteria 2842
67 Ga0105248_10000948 3300009177 Bacteria 32315
68 Ga0105248_10010958 3300009177 Bacteria 10003
69 Ga0105248_10498627 3300009177 Bacteria 1373
70 Ga0105237_10004511 3300009545 Bacteria 16092
71 Ga0105237_10011430 3300009545 Bacteria 9391
72 Ga0105237_10066261 3300009545 Bacteria 3606
73 Ga0105238_10000722 3300009551 Bacteria 34471
74 Ga0105238_10000843 3300009551 Bacteria 31674
75 Ga0105249_10008526 3300009553 Bacteria 8936
76 Ga0099796_10017211 3300010159 Bacteria 2148
77 Ga0105239_10003218 3300010375 Bacteria 20192
78 Ga0105239_10004879 3300010375 Bacteria 15876
79 Ga0105246_10000540 3300011119 Bacteria 20755
80 Ga0157370_10001298 3300013104 Bacteria 31167
81 Ga0157369_10001853 3300013105 Bacteria 25553
82 Ga0157374_10001673 3300013296 Bacteria 18570
83 Ga0157374_10049448 3300013296 Bacteria 3905
84 Ga0157378_10003977 3300013297 Bacteria 13061
85 Ga0163162_10042373 3300013306 Bacteria 4556
86 Ga0157372_10004236 3300013307 Bacteria 15341
87 Ga0157375_10001635 3300013308 Bacteria 19280
88 Ga0163163_10000506 3300014325 Bacteria 35071
89 Ga0163163_10010400 3300014325 Bacteria 8366
90 Ga0157380_10004164 3300014326 Bacteria 9991
91 Ga0157379_10001100 3300014968 Bacteria 22079
92 Ga0157376_10000547 3300014969 Bacteria 24165
93 Ga0207656_10003379 3300025321 Bacteria 5481
94 Ga0207710_10001784 3300025900 Bacteria 10391
95 Ga0207710_10037495 3300025900 Bacteria 2141
96 Ga0207647_10013626 3300025904 Bacteria 5630
97 Ga0207685_10009521 3300025905 Bacteria 2826
98 Ga0207645_10110781 3300025907 Bacteria 1777
99 Ga0207643_10004268 3300025908 Bacteria 7697
100 Ga0207684_10000176 3300025910 Bacteria 104968
101 Ga0207654_10029345 3300025911 Bacteria 3010
102 Ga0207695_10000035 3300025913 Bacteria 486590
103 Ga0207695_10001051 3300025913 Bacteria 48477
104 Ga0207695_10012771 3300025913 Bacteria 10056
105 Ga0207671_10002177 3300025914 Bacteria 21285
106 Ga0207646_10019821 3300025922 Bacteria 6243
107 Ga0207681_10003193 3300025923 Bacteria 10281
108 Ga0207694_10001201 3300025924 Bacteria 22457
109 Ga0207694_10002006 3300025924 Bacteria 16851
110 Ga0207650_10011311 3300025925 Bacteria 6141
111 Ga0207687_10000903 3300025927 Bacteria 20201
112 Ga0207691_10118391 3300025940 Bacteria 2350
113 Ga0207711_10003403 3300025941 Bacteria 13770
114 Ga0207711_10032125 3300025941 Bacteria 4438
115 Ga0207689_10002259 3300025942 Bacteria 18059
116 Ga0207661_10011587 3300025944 Bacteria 6396
117 Ga0207679_10009744 3300025945 Bacteria 6163
118 Ga0207712_10003601 3300025961 Bacteria 9770
119 Ga0207658_10000987 3300025986 Bacteria 23454
120 Ga0207677_10001737 3300026023 Bacteria 11561
121 Ga0207702_10006744 3300026078 Bacteria 9857
122 Ga0207641_10000108 3300026088 Bacteria 121144
123 Ga0207641_10002057 3300026088 Bacteria 19108
124 Ga0207641_10066894 3300026088 Bacteria 3077
125 Ga0207648_10138252 3300026089 Bacteria 2146
126 Ga0207648_10167299 3300026089 Bacteria 1943
127 Ga0207676_10005523 3300026095 Bacteria 8948
128 Ga0207676_10131301 3300026095 Bacteria 2130
129 Ga0207674_10003613 3300026116 Bacteria 18856
130 Ga0207675_100011572 3300026118 Bacteria 8250
131 Ga0207698_10011365 3300026142 Bacteria 5769
132 Ga0207428_10005178 3300027907 Bacteria 12208
133 Ga0268266_10015406 3300028379 Bacteria 6561
134 Ga0268266_10116787 3300028379 Bacteria 2370
135 Ga0268265_10009606 3300028380 Bacteria 6533
136 Ga0268265_10141033 3300028380 Bacteria 2018
137 Ga0268264_10000057 3300028381 Bacteria 309824
138 Ga0268264_10001584 3300028381 Bacteria 21070
139 Ga0265338_10032824 3300028800 Bacteria 5053
140 Ga0265330_10007369 3300031235 Bacteria 5366
141 Ga0265340_10027353 3300031247 Bacteria 2876
142 Ga0265339_10020217 3300031249 Bacteria 3893
143 Ga0265331_10016942 3300031250 Bacteria 3812
144 Ga0307513_10144331 3300031456 Bacteria 2301
145 Ga0265314_10074979 3300031711 Bacteria 2252
146 Ga0265342_10056943 3300031712 Bacteria 2315
147 Ga0307516_10004744 3300031730 Bacteria 16607
148 Ga0307405_10006133 3300031731 Bacteria 5885
149 Ga0307413_10047027 3300031824 Bacteria 2570
150 Ga0307409_100192391 3300031995 Unclassified 1817
151 Ga0307411_10024494 3300032005 Bacteria 3599
152 Ga0307415_100052342 3300032126 Bacteria 2776
153 Ga0373934_0006436 3300035086 Bacteria 4357
154 Ga0373923_0005020 3300035111 Bacteria 4453
155 Ga0373954_0000117 3300035118 Bacteria 26539
156 Ga0373957_0031969 3300035120 Bacteria 1936
157 Ga0373955_0004262 3300035172 Bacteria 6316
158 Ga0373927_0010909 3300035695 Bacteria 6049
159 Ga0373933_0001107 3300035724 Bacteria 16053
160 Ga0373937_0007317 3300036401 Bacteria 9555
161 Ga0436365_0123567 3300039437 Bacteria 19259
162 Ga0436365_0281010 3300039437 Bacteria 6813
163 Ga0495592_0010761 3300046454 Bacteria 6897
164 Ga0495629_0000611 3300046459 Bacteria 29086
165 Ga0495651_0008917 3300046462 Bacteria 7702
166 Ga0495653_0001910 3300046463 Bacteria 16427
167 Ga0495650_0000071 3300046471 Bacteria 258374
168 Ga0495606_0000252 3300046507 Bacteria 94511
169 Ga0495608_0004094 3300046511 Bacteria 10457
170 Ga0495618_0050378 3300046514 Bacteria 2630
171 Ga0495628_0004989 3300046516 Bacteria 11659
172 Ga0495630_0018077 3300046517 Bacteria 5174
173 Ga0495652_0003071 3300046529 Bacteria 16736
174 Ga0495640_0012797 3300046533 Bacteria 6402
175 Ga0495587_0011481 3300046536 Bacteria 5610
176 Ga0495633_0000026 3300046558 Bacteria 204722
177 Ga0495667_0002624 3300046559 Bacteria 11997
178 Ga0495634_0039998 3300046642 Bacteria 3191
179 Ga0495635_0000576 3300046663 Bacteria 23548
180 Ga0495599_0005168 3300046678 Bacteria 7778
181 Ga0495623_0021372 3300046679 Bacteria 4178
182 Ga0495646_0008004 3300046680 Bacteria 6717
183 Ga0495658_0006372 3300046683 Bacteria 5798
184 Ga0495613_0018905 3300046689 Bacteria 5133
185 Ga0495649_0056935 3300046694 Bacteria 2109
186 Ga0495600_0000654 3300046809 Bacteria 17979
187 Ga0495604_0002232 3300047317 Bacteria 15513
188 Ga0495674_0024458 3300047319 Bacteria 5550
189 Ga0495675_0000555 3300047444 Bacteria 24048
190 Ga0495684_0001096 3300047471 Bacteria 21825
191 Ga0495686_0003888 3300047472 Bacteria 12605
192 Ga0495593_0041879 3300047673 Bacteria 2460
193 Ga0495602_0159256 3300048088 Bacteria 1764
194 Ga0496109_0006144 3300048912 Bacteria 10091
195 Ga0496109_0032680 3300048912 Bacteria 4679
196 Ga0496112_0000020 3300048915 Bacteria 169373
197 Ga0496126_0100150 3300048929 Bacteria 2537
198 Ga0501076_0117855 3300049592 Unclassified 2149
199 Ga0501076_0144233 3300049592 Bacteria 1936
200 Ga0501079_0075728 3300049741 Unclassified 2603
201 Ga0501044_0333915 3300049823 Bacteria 1438
202 Ga0501045_0045621 3300049824 Unclassified 3191
203 nmdc:mga00v17_32103_c1 3300050491 Bacteria 3102
204 nmdc:mga0yw44_59594_c1 3300050492 Bacteria 2336
205 nmdc:mga06z11_9631_c1 3300050494 Bacteria 4078
206 nmdc:mga07m45_9620_c1 3300050496 Bacteria 5023
207 nmdc:mga08y16_14288_c1 3300050511 Bacteria 6157
208 Ga0495595_0008332 3300053084 Bacteria 4255
209 Ga0495619_0001710 3300053085 Bacteria 14541
210 Ga0500643_029070 3300053087 Bacteria 1704
211 Ga0500604_0007838 3300053151 Bacteria 2832
212 Ga0500616_0064231 3300053153 Bacteria 1891
213 Ga0500622_0000014 3300053156 Bacteria 368189
214 Ga0500636_0003609 3300053177 Bacteria 8724
215 Ga0501084_0080441 3300054114 Unclassified 2732
216 2644086702 2643221614 Bacteria 4260023
217 2644341656 2643221661 Bacteria 4267604
218 2644367943 2643221666 Bacteria 4265935
219 2819673105 2818991459 Bacteria 8736032
220 2888583395 2888578766 Bacteria 6743310
221 2889055534 2889049205 Bacteria 7524325
222 8054799422 8054795415 Bacteria 9785225
223 Ga0105247_10021036
224 JGI25406J46586_10000126
225 rootH1_10158439
226 rootH2_10238985
227 rootL2_10144744
228 Ga0070658_10015733
229 Ga0070683_100000368
230 Ga0070670_100011923
231 Ga0070670_100012150
232 Ga0068869_100003193
233 Ga0070666_10014054
234 Ga0070666_10144928
235 Ga0070671_100001278
236 Ga0070667_100001018
237 Ga0070663_100103600
238 Ga0070706_100000220
239 Ga0070707_100013081
240 Ga0070698_100026462
241 Ga0070698_100184268
242 Ga0070698_100209165
243 Ga0070699_100064292
244 Ga0070699_100065518
245 Ga0070699_100072791
246 Ga0070684_100000336
247 Ga0070665_100010475
248 Ga0070665_100066071
249 Ga0070665_100092108
250 Ga0070664_100028435
251 Ga0070664_100158799
252 Ga0068857_100003502
253 Ga0068856_100001109
254 Ga0068852_100000020
255 Ga0068859_100003553
256 Ga0068859_100062769
257 Ga0068864_100003226
258 Ga0068863_100000102
259 Ga0068863_100000874
260 Ga0068858_100002511
261 Ga0068860_100000118
262 Ga0068860_100001082
263 Ga0068862_100163630
264 Ga0081455_10020594
265 Ga0081455_10036235
266 Ga0081540_1028065
267 Ga0081539_10000064
268 Ga0081539_10007368
269 Ga0081539_10021939
270 Ga0075365_10036209
271 Ga0075364_10038762
272 Ga0070715_10008474
273 Ga0097621_100002829
274 Ga0068871_100002038
275 Ga0075436_100039861
276 Ga0097620_100003553
277 Ga0097620_100062769
278 Ga0099795_10013002
279 Ga0105240_10000145
280 Ga0105240_10001315
281 Ga0105240_10002041
282 Ga0105240_10276771
283 Ga0111539_10019565
284 Ga0105245_10013348
285 Ga0105247_10001975
286 Ga0105241_10000990
287 Ga0105241_10095530
288 Ga0105242_10073511
289 Ga0105248_10000948
290 Ga0105248_10010958
291 Ga0105248_10498627
292 Ga0105237_10004511
293 Ga0105237_10011430
294 Ga0105237_10066261
295 Ga0105238_10000722
296 Ga0105238_10000843
297 Ga0105249_10008526
298 Ga0099796_10017211
299 Ga0105239_10003218
300 Ga0105239_10004879
301 Ga0105246_10000540
302 Ga0157370_10001298
303 Ga0157369_10001853
304 Ga0157374_10001673
305 Ga0157374_10049448
306 Ga0157378_10003977
307 Ga0163162_10042373
308 Ga0157372_10004236
309 Ga0157375_10001635
310 Ga0163163_10000506
311 Ga0163163_10010400
312 Ga0157380_10004164
313 Ga0157379_10001100
314 Ga0157376_10000547
315 Ga0207656_10003379
316 Ga0207710_10001784
317 Ga0207710_10037495
318 Ga0207647_10013626
319 Ga0207685_10009521
320 Ga0207645_10110781
321 Ga0207643_10004268
322 Ga0207684_10000176
323 Ga0207654_10029345
324 Ga0207695_10000035
325 Ga0207695_10001051
326 Ga0207695_10012771
327 Ga0207671_10002177
328 Ga0207646_10019821
329 Ga0207681_10003193
330 Ga0207694_10001201
331 Ga0207694_10002006
332 Ga0207650_10011311
333 Ga0207687_10000903
334 Ga0207691_10118391
335 Ga0207711_10003403
336 Ga0207711_10032125
337 Ga0207689_10002259
338 Ga0207661_10011587
339 Ga0207679_10009744
340 Ga0207712_10003601
341 Ga0207658_10000987
342 Ga0207677_10001737
343 Ga0207702_10006744
344 Ga0207641_10000108
345 Ga0207641_10002057
346 Ga0207641_10066894
347 Ga0207648_10138252
348 Ga0207648_10167299
349 Ga0207676_10005523
350 Ga0207676_10131301
351 Ga0207674_10003613
352 Ga0207675_100011572
353 Ga0207698_10011365
354 Ga0207428_10005178
355 Ga0268266_10015406
356 Ga0268266_10116787
357 Ga0268265_10009606
358 Ga0268265_10141033
359 Ga0268264_10000057
360 Ga0268264_10001584
361 Ga0265338_10032824
362 Ga0265330_10007369
363 Ga0265340_10027353
364 Ga0265339_10020217
365 Ga0265331_10016942
366 Ga0307513_10144331
367 Ga0265314_10074979
368 Ga0265342_10056943
369 Ga0307516_10004744
370 Ga0307405_10006133
371 Ga0307413_10047027
372 Ga0307409_100192391
373 Ga0307411_10024494
374 Ga0307415_100052342
375 Ga0373934_0006436
376 Ga0373923_0005020
377 Ga0373954_0000117
378 Ga0373957_0031969
379 Ga0373955_0004262
380 Ga0373927_0010909
381 Ga0373933_0001107
382 Ga0373937_0007317
383 Ga0436365_0123567
384 Ga0436365_0281010
385 Ga0495592_0010761
386 Ga0495629_0000611
387 Ga0495651_0008917
388 Ga0495653_0001910
389 Ga0495650_0000071
390 Ga0495606_0000252
391 Ga0495608_0004094
392 Ga0495618_0050378
393 Ga0495628_0004989
394 Ga0495630_0018077
395 Ga0495652_0003071
396 Ga0495640_0012797
397 Ga0495587_0011481
398 Ga0495633_0000026
399 Ga0495667_0002624
400 Ga0495634_0039998
401 Ga0495635_0000576
402 Ga0495599_0005168
403 Ga0495623_0021372
404 Ga0495646_0008004
405 Ga0495658_0006372
406 Ga0495613_0018905
407 Ga0495649_0056935
408 Ga0495600_0000654
409 Ga0495604_0002232
410 Ga0495674_0024458
411 Ga0495675_0000555
412 Ga0495684_0001096
413 Ga0495686_0003888
414 Ga0495593_0041879
415 Ga0495602_0159256
416 Ga0496109_0006144
417 Ga0496109_0032680
418 Ga0496112_0000020
419 Ga0496126_0100150
420 Ga0501076_0117855
421 Ga0501076_0144233
422 Ga0501079_0075728
423 Ga0501044_0333915
424 Ga0501045_0045621
425 nmdc:mga00v17_32103_c1
426 nmdc:mga0yw44_59594_c1
427 nmdc:mga06z11_9631_c1
428 nmdc:mga07m45_9620_c1
429 nmdc:mga08y16_14288_c1
430 Ga0495595_0008332
431 Ga0495619_0001710
432 Ga0500643_029070
433 Ga0500604_0007838
434 Ga0500616_0064231
435 Ga0500622_0000014
436 Ga0500636_0003609
437 Ga0501084_0080441
438 2644086702
439 2644341656
440 2644367943
441 2819673105
442 2888583395
443 2889055534
444 8054799422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13091

PLDc_2

PLD-like domain

291

434

0.8

PF13091

PLDc_2

PLD-like domain

63

219

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ehi-assembly5.cif.gz_J nuct from helicobacter pylori 0.8193 263 403
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.7799 227 403
7svp-assembly3.cif.gz_B structure of compound 34 bound to human phospholipase d2 catalytic domain 0.7742 15 458
6ohp-assembly1.cif.gz_A structure of compound 1 (halopemide) bound human phospholipase d2 catalytic domain 0.7669 16 455
6ohr-assembly3.cif.gz_C structure of compound 5 bound human phospholipase d1 catalytic domain 0.7668 15 455
ID Description Score Start End Superfamily
af_Q2FYW4_304_492_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.8498 226 406 3.30.870.10
af_Q2FWG8_323_468_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.837 260 407 3.30.870.10
af_P0A6H8_316_458_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.8269 259 406 3.30.870.10
af_Q2FYW4_119_303_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.7699 22 200 3.30.870.10
2f5tX01 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.7636 263 407 3.30.870.10
ID Description Score Start End GO Terms
AF-A0A1Y6C027-F1-model_v4 Phospholipase D (Choline phosphatase) 0.9841 286 458 GO:0004630
GO:0005576
GO:0005886
GO:0009395
AF-A0A6G8NQS6-F1-model_v4 Cardiolipin synthase B (EC 2.7.8.-) 0.9825 2 458 GO:0003677
GO:0004630
GO:0006355
GO:0009395
GO:0016740
AF-A0A2A5ES44-F1-model_v4 Phospholipase D (Choline phosphatase) 0.979 6 458 GO:0004630
GO:0005576
GO:0009395
AF-A0A328U0V5-F1-model_v4 PLD phosphodiesterase domain-containing protein 0.9787 9 451 GO:0030572
GO:0032049
AF-A0A6G8NQS6-F1-model_v4 Cardiolipin synthase B (EC 2.7.8.-) 0.9762 2 458 GO:0003677
GO:0004630
GO:0006355
GO:0009395
GO:0016740

Map