F333549

General Info

Members Datasets Scaffolds Average Seq Length
221 109 221 118

Family's Representative Sequence

Representative Sequence 3300034957|Ga0373938_0120418|Ga0373938_0120418_30_464
Length 144
Sequence LVPALARPVTPENKEDQTLKVNQEGTMTKRNMWVGGLAMPVMAMLLLFAGSPSVRAADQRSAATAEVKIDNFSFGPQTITVPVGVTVTWTNRDDIPHTVVSTDGVFKSKVRDTDEKFSYTFTKAGTYPYFCSVHPKMTGKVVVQ

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
38 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
39 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
55 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
56 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
61 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
62 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
63 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
64 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
66 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.29
Metatranscriptomes 2.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.81
Rhizosphere 97.29
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10089778 3300005295 Bacteria 4284
2 Ga0070680_100032199 3300005336 Bacteria 4219
3 Ga0070703_10155730 3300005406 Unclassified 862
4 Ga0070709_10087162 3300005434 Bacteria 2051
5 Ga0070709_10664033 3300005434 Unclassified 808
6 Ga0070709_10667197 3300005434 Unclassified 806
7 Ga0070709_10699205 3300005434 Bacteria 789
8 Ga0070709_11220445 3300005434 Bacteria 605
9 Ga0070714_100374234 3300005435 Bacteria 1341
10 Ga0070714_100506208 3300005435 Unclassified 1152
11 Ga0070714_100798146 3300005435 Bacteria 914
12 Ga0070714_101215117 3300005435 Unclassified 735
13 Ga0070713_100142075 3300005436 Bacteria 2127
14 Ga0070713_101249054 3300005436 Unclassified 719
15 Ga0070713_101689076 3300005436 Unclassified 615
16 Ga0070710_10377504 3300005437 Bacteria 945
17 Ga0070711_100034847 3300005439 Bacteria 3360
18 Ga0070711_100327427 3300005439 Unclassified 1226
19 Ga0070711_100503129 3300005439 Unclassified 999
20 Ga0070711_100691567 3300005439 Bacteria 858
21 Ga0070711_100776440 3300005439 Unclassified 811
22 Ga0070711_101390338 3300005439 Unclassified 611
23 Ga0070711_101461567 3300005439 Unclassified 596
24 Ga0070705_100071221 3300005440 Unclassified 2102
25 Ga0070694_100004621 3300005444 Bacteria 8286
26 Ga0070708_100000809 3300005445 Bacteria 23603
27 Ga0070708_100013864 3300005445 Bacteria 6619
28 Ga0070708_100018204 3300005445 Bacteria 5877
29 Ga0070708_100019954 3300005445 Bacteria 5643
30 Ga0070708_100164803 3300005445 Bacteria 2067
31 Ga0070708_100650088 3300005445 Unclassified 994
32 Ga0070708_101364585 3300005445 Viruses 662
33 Ga0070681_10264626 3300005458 Bacteria 1631
34 Ga0070706_100001161 3300005467 Bacteria 28349
35 Ga0070706_100107040 3300005467 Bacteria 2601
36 Ga0070707_100001294 3300005468 Bacteria 24612
37 Ga0070707_100024346 3300005468 Bacteria 5733
38 Ga0070707_100090217 3300005468 Bacteria 2967
39 Ga0070707_100296638 3300005468 Unclassified 1571
40 Ga0070707_101194994 3300005468 Bacteria 726
41 Ga0070698_100635054 3300005471 Bacteria 1009
42 Ga0070698_101717253 3300005471 Unclassified 580
43 Ga0070699_100097039 3300005518 Bacteria 2582
44 Ga0070699_100118427 3300005518 Bacteria 2328
45 Ga0070699_100876876 3300005518 Bacteria 822
46 Ga0070699_101200629 3300005518 Unclassified 696
47 Ga0070699_101462271 3300005518 Unclassified 627
48 Ga0070699_101876586 3300005518 Unclassified 548
49 Ga0070679_100057105 3300005530 Unclassified 3890
50 Ga0070697_100002206 3300005536 Bacteria 14947
51 Ga0070697_100003979 3300005536 Bacteria 11341
52 Ga0070697_100016188 3300005536 Bacteria 5864
53 Ga0070697_100056295 3300005536 Bacteria 3199
54 Ga0070697_100149036 3300005536 Bacteria 1971
55 Ga0070697_100486845 3300005536 Unclassified 1078
56 Ga0070695_100011195 3300005545 Bacteria 5364
57 Ga0070695_100387682 3300005545 Bacteria 1056
58 Ga0070696_100014271 3300005546 Bacteria 5330
59 Ga0070693_100000116 3300005547 Bacteria 35837
60 Ga0070693_101357459 3300005547 Unclassified 551
61 Ga0070704_100001254 3300005549 Bacteria 13370
62 Ga0068856_100897063 3300005614 Unclassified 905
63 Ga0070717_10124569 3300006028 Bacteria 2211
64 Ga0070715_10056077 3300006163 Unclassified 1713
65 Ga0070715_10301823 3300006163 Bacteria 857
66 Ga0070716_100000261 3300006173 Bacteria 21154
67 Ga0070716_100020396 3300006173 Bacteria 3478
68 Ga0070716_100376188 3300006173 Unclassified 1014
69 Ga0070716_100393067 3300006173 Bacteria 995
70 Ga0070716_100861193 3300006173 Bacteria 706
71 Ga0070712_100025534 3300006175 Bacteria 3928
72 Ga0070712_100057118 3300006175 Unclassified 2740
73 Ga0070712_100087869 3300006175 Bacteria 2269
74 Ga0070712_100130614 3300006175 Bacteria 1903
75 Ga0070712_100282679 3300006175 Bacteria 1337
76 Ga0070712_100719772 3300006175 Unclassified 852
77 Ga0070712_100758602 3300006175 Unclassified 831
78 Ga0070712_100884274 3300006175 Unclassified 770
79 Ga0070712_100942223 3300006175 Bacteria 746
80 Ga0097621_101833791 3300006237 Unclassified 578
81 Ga0075428_100292446 3300006844 Bacteria 1752
82 Ga0075433_10107239 3300006852 Unclassified 2476
83 Ga0075434_100123340 3300006871 Bacteria 2607
84 Ga0075434_100126816 3300006871 Bacteria 2569
85 Ga0075434_101315885 3300006871 Unclassified 733
86 Ga0075436_100001331 3300006914 Bacteria 16801
87 Ga0075436_100600109 3300006914 Bacteria 811
88 Ga0075435_100032367 3300007076 Bacteria 4129
89 Ga0075435_100267742 3300007076 Bacteria 1457
90 Ga0075435_100835927 3300007076 Unclassified 802
91 Ga0099794_10003776 3300007265 Bacteria 5843
92 Ga0099794_10105892 3300007265 Bacteria 1406
93 Ga0099794_10296921 3300007265 Unclassified 836
94 Ga0099795_10196341 3300007788 Bacteria 849
95 Ga0111539_10060086 3300009094 Bacteria 4506
96 Ga0157316_1025967 3300012510 Unclassified 676
97 Ga0228598_1021912 3300024227 Bacteria 1258
98 Ga0207653_10042803 3300025885 Bacteria 1490
99 Ga0207699_10041152 3300025906 Bacteria 2667
100 Ga0207699_10041156 3300025906 Unclassified 2667
101 Ga0207699_10124486 3300025906 Unclassified 1672
102 Ga0207699_10205529 3300025906 Bacteria 1337
103 Ga0207699_10291792 3300025906 Bacteria 1137
104 Ga0207699_10546396 3300025906 Unclassified 840
105 Ga0207699_10693210 3300025906 Unclassified 745
106 Ga0207684_10003146 3300025910 Bacteria 16239
107 Ga0207684_10216882 3300025910 Bacteria 1651
108 Ga0207684_10451095 3300025910 Bacteria 1104
109 Ga0207684_10562087 3300025910 Unclassified 975
110 Ga0207707_10521555 3300025912 Bacteria 1012
111 Ga0207693_10004131 3300025915 Bacteria 12324
112 Ga0207693_10022954 3300025915 Bacteria 4954
113 Ga0207693_10028255 3300025915 Unclassified 4431
114 Ga0207693_10048304 3300025915 Unclassified 3341
115 Ga0207693_10114076 3300025915 Bacteria 2120
116 Ga0207693_10764592 3300025915 Bacteria 746
117 Ga0207663_10011958 3300025916 Unclassified 4677
118 Ga0207663_10094828 3300025916 Bacteria 1989
119 Ga0207663_10146657 3300025916 Bacteria 1650
120 Ga0207663_10188773 3300025916 Unclassified 1478
121 Ga0207663_10222042 3300025916 Bacteria 1375
122 Ga0207663_10612909 3300025916 Unclassified 856
123 Ga0207663_10637601 3300025916 Bacteria 840
124 Ga0207660_10035104 3300025917 Bacteria 3479
125 Ga0207652_10209509 3300025921 Bacteria 1755
126 Ga0207646_10002072 3300025922 Bacteria 24051
127 Ga0207646_10028098 3300025922 Bacteria 5123
128 Ga0207646_10032743 3300025922 Bacteria 4703
129 Ga0207646_10248334 3300025922 Bacteria 1607
130 Ga0207646_10367117 3300025922 Bacteria 1300
131 Ga0207646_10571290 3300025922 Unclassified 1016
132 Ga0207700_10244610 3300025928 Bacteria 1530
133 Ga0207664_10041517 3300025929 Unclassified 3584
134 Ga0207664_10714718 3300025929 Bacteria 901
135 Ga0207665_10000020 3300025939 Bacteria 117316
136 Ga0207665_10012239 3300025939 Bacteria 5635
137 Ga0207665_10034701 3300025939 Unclassified 3347
138 Ga0207665_10096830 3300025939 Bacteria 2053
139 Ga0207702_10054525 3300026078 Bacteria 3388
140 Ga0209588_1003533 3300027671 Bacteria 4345
141 Ga0209588_1067015 3300027671 Unclassified 1160
142 Ga0209588_1073709 3300027671 Bacteria 1103
143 Ga0209588_1090855 3300027671 Unclassified 984
144 Ga0209588_1114161 3300027671 Unclassified 867
145 Ga0207428_10816375 3300027907 Bacteria 662
146 Ga0265354_1000587 3300028016 Bacteria 6130
147 Ga0265354_1006650 3300028016 Unclassified 1143
148 Ga0265357_1036100 3300028023 Unclassified 573
149 Ga0265770_1001687 3300030878 Bacteria 3025
150 Ga0265770_1001939 3300030878 Bacteria 2825
151 Ga0265765_1000108 3300030879 Bacteria 4767
152 Ga0265765_1009905 3300030879 Bacteria 1055
153 Ga0265760_10013051 3300031090 Bacteria 2379
154 Ga0265760_10023804 3300031090 Unclassified 1780
155 Ga0265340_10081355 3300031247 Bacteria 1525
156 Ga0316215_1031454 3300033544 Unclassified 551
157 Ga0316212_1020729 3300033547 Unclassified 922
158 Ga0373938_0120418 3300034957 Unclassified 676
159 Ga0373944_0178704 3300035089 Unclassified 760
160 Ga0373923_0388814 3300035111 Bacteria 670
161 Ga0373945_0169309 3300035116 Bacteria 894
162 Ga0373953_0322464 3300035117 Bacteria 675
163 Ga0373956_0513419 3300035119 Unclassified 572
164 Ga0373957_0312115 3300035120 Unclassified 668
165 Ga0373943_0010686 3300035170 Bacteria 4120
166 Ga0373946_0011895 3300035171 Bacteria 3252
167 Ga0373955_0002752 3300035172 Bacteria 7714
168 Ga0373931_0412211 3300035691 Bacteria 857
169 Ga0373935_1331475 3300035692 Bacteria 536
170 Ga0373927_0016021 3300035695 Bacteria 4948
171 Ga0373947_0002271 3300035725 Bacteria 11617
172 Ga0373937_0253003 3300036401 Bacteria 1661
173 Ga0373925_0004256 3300037068 Bacteria 10843
174 Ga0373925_0328189 3300037068 Unclassified 1239
175 Ga0466967_0012772 3300045976 Bacteria 6451
176 Ga0495603_0166227 3300046455 Bacteria 1279
177 Ga0495629_0000013 3300046459 Bacteria 212317
178 Ga0495580_0001283 3300046472 Bacteria 22135
179 Ga0495580_0372129 3300046472 Bacteria 966
180 Ga0495582_0000266 3300046473 Bacteria 29128
181 Ga0495582_0015538 3300046473 Bacteria 4181
182 Ga0495639_0005070 3300046475 Bacteria 5657
183 Ga0495662_0071596 3300046476 Bacteria 1680
184 Ga0495594_0018732 3300046499 Bacteria 3670
185 Ga0495618_0332217 3300046514 Bacteria 940
186 Ga0495665_0060683 3300046531 Bacteria 1996
187 Ga0495586_0003201 3300046535 Bacteria 8799
188 Ga0495634_0072313 3300046642 Bacteria 2268
189 Ga0495634_0383644 3300046642 Unclassified 837
190 Ga0495635_0000413 3300046663 Bacteria 27156
191 Ga0495657_0329281 3300046675 Bacteria 907
192 Ga0495657_0550769 3300046675 Unclassified 670
193 Ga0495658_0000018 3300046683 Bacteria 93319
194 Ga0495613_0012849 3300046689 Bacteria 6224
195 Ga0495613_0857196 3300046689 Unclassified 590
196 Ga0495600_0132566 3300046809 Unclassified 1620
197 Ga0495581_0000031 3300047315 Bacteria 53247
198 Ga0495581_0072871 3300047315 Bacteria 1987
199 Ga0495676_0371398 3300047321 Bacteria 953
200 Ga0495680_0000214 3300047322 Bacteria 63113
201 Ga0495680_0331958 3300047322 Unclassified 1062
202 Ga0495680_0370932 3300047322 Bacteria 993
203 Ga0495684_0107644 3300047471 Bacteria 2105
204 Ga0495593_0123095 3300047673 Bacteria 1319
205 Ga0495602_0655533 3300048088 Unclassified 716
206 Ga0495614_0000561 3300048089 Bacteria 15437
207 Ga0495614_0163246 3300048089 Unclassified 997
208 Ga0496100_0524349 3300048903 Bacteria 915
209 Ga0496102_0261852 3300048905 Bacteria 1630
210 Ga0496102_1297199 3300048905 Unclassified 647
211 Ga0496103_0089394 3300048906 Bacteria 1943
212 nmdc:mga08y16_32152_c1 3300050511 Bacteria 5517
213 nmdc:mga0n895_1371407_c1 3300050512 Unclassified 676
214 nmdc:mga0n895_1952595_c1 3300050512 Unclassified 545
215 nmdc:mga0n895_70759_c2 3300050512 Bacteria 2589
216 nmdc:mga0rr50_1350606_c1 3300050513 Unclassified 604
217 nmdc:mga0rr50_9020_c1 3300050513 Bacteria 6240
218 nmdc:mga08x19_380882_c1 3300050514 Bacteria 988
219 nmdc:mga08x19_8582_c1 3300050514 Bacteria 6090
220 Ga0495619_0004045 3300053085 Bacteria 9393
221 Ga0495619_0640256 3300053085 Unclassified 726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0072871 Ga0495581_0072871_671_982 103
2 3300007788 Ga0099795_10196341 Ga0099795_101963412 104
3 3300005439 Ga0070711_100327427 Ga0070711_1003274272 114
4 3300025916 Ga0207663_10188773 Ga0207663_101887732 114
5 3300005434 Ga0070709_10087162 Ga0070709_100871622 115
6 3300005435 Ga0070714_100374234 Ga0070714_1003742342 115
7 3300005436 Ga0070713_100142075 Ga0070713_1001420753 115
8 3300005439 Ga0070711_100034847 Ga0070711_1000348473 115
9 3300005439 Ga0070711_101390338 Ga0070711_1013903381 115
10 3300005547 Ga0070693_101357459 Ga0070693_1013574591 115
11 3300005614 Ga0068856_100897063 Ga0068856_1008970632 115
12 3300006175 Ga0070712_100087869 Ga0070712_1000878693 115
13 3300006175 Ga0070712_100884274 Ga0070712_1008842742 115
14 3300006237 Ga0097621_101833791 Ga0097621_1018337912 115
15 3300006871 Ga0075434_100123340 Ga0075434_1001233404 115
16 3300006914 Ga0075436_100001331 Ga0075436_10000133119 115
17 3300007076 Ga0075435_100032367 Ga0075435_1000323673 115
18 3300025906 Ga0207699_10041152 Ga0207699_100411522 115
19 3300025915 Ga0207693_10004131 Ga0207693_100041318 115
20 3300025916 Ga0207663_10222042 Ga0207663_102220422 115
21 3300025928 Ga0207700_10244610 Ga0207700_102446103 115
22 3300025929 Ga0207664_10714718 Ga0207664_107147182 115
23 3300026078 Ga0207702_10054525 Ga0207702_100545253 115
24 3300035089 Ga0373944_0178704 Ga0373944_0178704_252_599 115
25 3300035116 Ga0373945_0169309 Ga0373945_0169309_425_772 115
26 3300035170 Ga0373943_0010686 Ga0373943_0010686_296_643 115
27 3300035171 Ga0373946_0011895 Ga0373946_0011895_930_1277 115
28 3300035695 Ga0373927_0016021 Ga0373927_0016021_3124_3471 115
29 3300035725 Ga0373947_0002271 Ga0373947_0002271_2556_2903 115
30 3300037068 Ga0373925_0004256 Ga0373925_0004256_2004_2351 115
31 3300046472 Ga0495580_0001283 Ga0495580_0001283_12201_12548 115
32 3300046473 Ga0495582_0000266 Ga0495582_0000266_3449_3796 115
33 3300046531 Ga0495665_0060683 Ga0495665_0060683_50_397 115
34 3300048089 Ga0495614_0163246 Ga0495614_0163246_550_897 115
35 3300048905 Ga0496102_1297199 Ga0496102_1297199_269_616 115
36 3300050512 nmdc:mga0n895_1371407_c1 nmdc:mga0n895_1371407_c1_266_613 115
37 3300050513 nmdc:mga0rr50_9020_c1 nmdc:mga0rr50_9020_c1_694_1041 115
38 3300050514 nmdc:mga08x19_8582_c1 nmdc:mga08x19_8582_c1_4995_5342 115
39 3300005434 Ga0070709_10667197 Ga0070709_106671971 116
40 3300005434 Ga0070709_10699205 Ga0070709_106992052 116
41 3300005439 Ga0070711_101461567 Ga0070711_1014615671 116
42 3300006175 Ga0070712_100942223 Ga0070712_1009422232 116
43 3300006871 Ga0075434_101315885 Ga0075434_1013158852 116
44 3300007076 Ga0075435_100267742 Ga0075435_1002677422 116
45 3300007265 Ga0099794_10296921 Ga0099794_102969211 116
46 3300025906 Ga0207699_10291792 Ga0207699_102917922 116
47 3300025906 Ga0207699_10546396 Ga0207699_105463961 116
48 3300025906 Ga0207699_10693210 Ga0207699_106932102 116
49 3300025915 Ga0207693_10764592 Ga0207693_107645921 116
50 3300025916 Ga0207663_10612909 Ga0207663_106129092 116
51 3300045976 Ga0466967_0012772 Ga0466967_0012772_1268_1618 116
52 3300046689 Ga0495613_0857196 Ga0495613_0857196_196_549 116
53 3300048088 Ga0495602_0655533 Ga0495602_0655533_230_583 116
54 3300050512 nmdc:mga0n895_1952595_c1 nmdc:mga0n895_1952595_c1_160_513 116
55 3300005435 Ga0070714_100506208 Ga0070714_1005062081 117
56 3300005435 Ga0070714_101215117 Ga0070714_1012151172 117
57 3300005436 Ga0070713_101689076 Ga0070713_1016890761 117
58 3300005439 Ga0070711_100691567 Ga0070711_1006915671 117
59 3300005439 Ga0070711_100776440 Ga0070711_1007764402 117
60 3300005445 Ga0070708_100013864 Ga0070708_1000138645 117
61 3300005445 Ga0070708_100018204 Ga0070708_1000182043 117
62 3300005445 Ga0070708_100019954 Ga0070708_1000199547 117
63 3300005445 Ga0070708_100650088 Ga0070708_1006500882 117
64 3300005445 Ga0070708_101364585 Ga0070708_1013645851 117
65 3300005467 Ga0070706_100107040 Ga0070706_1001070401 117
66 3300005468 Ga0070707_100001294 Ga0070707_10000129421 117
67 3300005468 Ga0070707_100090217 Ga0070707_1000902174 117
68 3300005468 Ga0070707_100296638 Ga0070707_1002966382 117
69 3300005468 Ga0070707_101194994 Ga0070707_1011949942 117
70 3300005471 Ga0070698_100635054 Ga0070698_1006350542 117
71 3300005518 Ga0070699_100097039 Ga0070699_1000970394 117
72 3300005518 Ga0070699_100876876 Ga0070699_1008768761 117
73 3300005518 Ga0070699_101462271 Ga0070699_1014622712 117
74 3300005536 Ga0070697_100003979 Ga0070697_10000397914 117
75 3300005536 Ga0070697_100056295 Ga0070697_1000562954 117
76 3300005536 Ga0070697_100149036 Ga0070697_1001490363 117
77 3300005536 Ga0070697_100486845 Ga0070697_1004868452 117
78 3300006028 Ga0070717_10124569 Ga0070717_101245692 117
79 3300006163 Ga0070715_10301823 Ga0070715_103018232 117
80 3300006173 Ga0070716_100376188 Ga0070716_1003761881 117
81 3300006175 Ga0070712_100025534 Ga0070712_1000255344 117
82 3300006175 Ga0070712_100130614 Ga0070712_1001306143 117
83 3300006175 Ga0070712_100282679 Ga0070712_1002826792 117
84 3300006175 Ga0070712_100719772 Ga0070712_1007197721 117
85 3300012510 Ga0157316_1025967 Ga0157316_10259672 117
86 3300025906 Ga0207699_10205529 Ga0207699_102055292 117
87 3300025910 Ga0207684_10216882 Ga0207684_102168822 117
88 3300025910 Ga0207684_10451095 Ga0207684_104510952 117
89 3300025910 Ga0207684_10562087 Ga0207684_105620872 117
90 3300025915 Ga0207693_10022954 Ga0207693_100229545 117
91 3300025916 Ga0207663_10094828 Ga0207663_100948282 117
92 3300025916 Ga0207663_10146657 Ga0207663_101466572 117
93 3300025916 Ga0207663_10637601 Ga0207663_106376011 117
94 3300025922 Ga0207646_10002072 Ga0207646_1000207218 117
95 3300025922 Ga0207646_10028098 Ga0207646_100280984 117
96 3300025922 Ga0207646_10248334 Ga0207646_102483342 117
97 3300025922 Ga0207646_10367117 Ga0207646_103671172 117
98 3300025922 Ga0207646_10571290 Ga0207646_105712901 117
99 3300025939 Ga0207665_10012239 Ga0207665_100122392 117
100 3300025939 Ga0207665_10034701 Ga0207665_100347011 117
101 3300034957 Ga0373938_0120418 Ga0373938_0120418_30_464 117
102 3300035691 Ga0373931_0412211 Ga0373931_0412211_367_801 117
103 3300046455 Ga0495603_0166227 Ga0495603_0166227_462_890 117
104 3300048905 Ga0496102_0261852 Ga0496102_0261852_880_1233 117
105 3300048906 Ga0496103_0089394 Ga0496103_0089394_914_1267 117
106 3300005439 Ga0070711_100503129 Ga0070711_1005031292 118
107 3300005445 Ga0070708_100164803 Ga0070708_1001648033 118
108 3300005468 Ga0070707_100024346 Ga0070707_1000243463 118
109 3300005518 Ga0070699_101200629 Ga0070699_1012006292 118
110 3300005518 Ga0070699_101876586 Ga0070699_1018765861 118
111 3300006163 Ga0070715_10056077 Ga0070715_100560772 118
112 3300006173 Ga0070716_100000261 Ga0070716_1000002617 118
113 3300006173 Ga0070716_100020396 Ga0070716_1000203964 118
114 3300006173 Ga0070716_100393067 Ga0070716_1003930672 118
115 3300006175 Ga0070712_100057118 Ga0070712_1000571182 118
116 3300006175 Ga0070712_100758602 Ga0070712_1007586022 118
117 3300006852 Ga0075433_10107239 Ga0075433_101072392 118
118 3300006914 Ga0075436_100600109 Ga0075436_1006001092 118
119 3300007265 Ga0099794_10003776 Ga0099794_100037766 118
120 3300007265 Ga0099794_10105892 Ga0099794_101058922 118
121 3300025915 Ga0207693_10028255 Ga0207693_100282553 118
122 3300025915 Ga0207693_10048304 Ga0207693_100483044 118
123 3300025915 Ga0207693_10114076 Ga0207693_101140763 118
124 3300025916 Ga0207663_10011958 Ga0207663_100119585 118
125 3300025922 Ga0207646_10032743 Ga0207646_100327434 118
126 3300025939 Ga0207665_10000020 Ga0207665_1000002033 118
127 3300025939 Ga0207665_10096830 Ga0207665_100968303 118
128 3300027671 Ga0209588_1003533 Ga0209588_10035334 118
129 3300027671 Ga0209588_1067015 Ga0209588_10670153 118
130 3300027671 Ga0209588_1073709 Ga0209588_10737092 118
131 3300027671 Ga0209588_1090855 Ga0209588_10908552 118
132 3300027671 Ga0209588_1114161 Ga0209588_11141612 118
133 3300033544 Ga0316215_1031454 Ga0316215_10314542 118
134 3300035117 Ga0373953_0322464 Ga0373953_0322464_133_489 118
135 3300035119 Ga0373956_0513419 Ga0373956_0513419_141_497 118
136 3300035120 Ga0373957_0312115 Ga0373957_0312115_176_532 118
137 3300035172 Ga0373955_0002752 Ga0373955_0002752_3854_4210 118
138 3300036401 Ga0373937_0253003 Ga0373937_0253003_865_1221 118
139 3300046642 Ga0495634_0383644 Ga0495634_0383644_465_824 118
140 3300046809 Ga0495600_0132566 Ga0495600_0132566_388_744 118
141 3300047322 Ga0495680_0331958 Ga0495680_0331958_318_674 118
142 3300048903 Ga0496100_0524349 Ga0496100_0524349_50_406 118
143 3300050514 nmdc:mga08x19_380882_c1 nmdc:mga08x19_380882_c1_272_628 118
144 3300053085 Ga0495619_0640256 Ga0495619_0640256_84_440 118
145 3300005295 Ga0065707_10089778 Ga0065707_100897784 119
146 3300005336 Ga0070680_100032199 Ga0070680_1000321994 119
147 3300005406 Ga0070703_10155730 Ga0070703_101557302 119
148 3300005434 Ga0070709_10664033 Ga0070709_106640332 119
149 3300005434 Ga0070709_11220445 Ga0070709_112204452 119
150 3300005435 Ga0070714_100798146 Ga0070714_1007981462 119
151 3300005436 Ga0070713_101249054 Ga0070713_1012490542 119
152 3300005437 Ga0070710_10377504 Ga0070710_103775041 119
153 3300005440 Ga0070705_100071221 Ga0070705_1000712213 119
154 3300005444 Ga0070694_100004621 Ga0070694_1000046215 119
155 3300005445 Ga0070708_100000809 Ga0070708_10000080920 119
156 3300005458 Ga0070681_10264626 Ga0070681_102646262 119
157 3300005467 Ga0070706_100001161 Ga0070706_1000011612 119
158 3300005471 Ga0070698_101717253 Ga0070698_1017172532 119
159 3300005518 Ga0070699_100118427 Ga0070699_1001184272 119
160 3300005530 Ga0070679_100057105 Ga0070679_1000571054 119
161 3300005536 Ga0070697_100002206 Ga0070697_10000220611 119
162 3300005536 Ga0070697_100016188 Ga0070697_1000161887 119
163 3300005545 Ga0070695_100011195 Ga0070695_1000111952 119
164 3300005545 Ga0070695_100387682 Ga0070695_1003876822 119
165 3300005546 Ga0070696_100014271 Ga0070696_1000142712 119
166 3300005547 Ga0070693_100000116 Ga0070693_1000001168 119
167 3300005549 Ga0070704_100001254 Ga0070704_1000012549 119
168 3300006173 Ga0070716_100861193 Ga0070716_1008611932 119
169 3300006844 Ga0075428_100292446 Ga0075428_1002924462 119
170 3300006871 Ga0075434_100126816 Ga0075434_1001268163 119
171 3300007076 Ga0075435_100835927 Ga0075435_1008359272 119
172 3300009094 Ga0111539_10060086 Ga0111539_100600862 119
173 3300024227 Ga0228598_1021912 Ga0228598_10219122 119
174 3300025885 Ga0207653_10042803 Ga0207653_100428032 119
175 3300025906 Ga0207699_10041156 Ga0207699_100411563 119
176 3300025906 Ga0207699_10124486 Ga0207699_101244863 119
177 3300025910 Ga0207684_10003146 Ga0207684_100031462 119
178 3300025912 Ga0207707_10521555 Ga0207707_105215552 119
179 3300025917 Ga0207660_10035104 Ga0207660_100351043 119
180 3300025921 Ga0207652_10209509 Ga0207652_102095092 119
181 3300025929 Ga0207664_10041517 Ga0207664_100415172 119
182 3300027907 Ga0207428_10816375 Ga0207428_108163752 119
183 3300028016 Ga0265354_1000587 Ga0265354_10005875 119
184 3300028016 Ga0265354_1006650 Ga0265354_10066502 119
185 3300028023 Ga0265357_1036100 Ga0265357_10361001 119
186 3300030878 Ga0265770_1001687 Ga0265770_10016873 119
187 3300030878 Ga0265770_1001939 Ga0265770_10019393 119
188 3300030879 Ga0265765_1000108 Ga0265765_10001082 119
189 3300030879 Ga0265765_1009905 Ga0265765_10099052 119
190 3300031090 Ga0265760_10013051 Ga0265760_100130512 119
191 3300031090 Ga0265760_10023804 Ga0265760_100238042 119
192 3300031247 Ga0265340_10081355 Ga0265340_100813552 119
193 3300033547 Ga0316212_1020729 Ga0316212_10207292 119
194 3300035111 Ga0373923_0388814 Ga0373923_0388814_102_461 119
195 3300035692 Ga0373935_1331475 Ga0373935_1331475_74_433 119
196 3300037068 Ga0373925_0328189 Ga0373925_0328189_752_1180 119
197 3300046459 Ga0495629_0000013 Ga0495629_0000013_127819_128178 119
198 3300046472 Ga0495580_0372129 Ga0495580_0372129_189_548 119
199 3300046473 Ga0495582_0015538 Ga0495582_0015538_3631_3990 119
200 3300046475 Ga0495639_0005070 Ga0495639_0005070_456_815 119
201 3300046476 Ga0495662_0071596 Ga0495662_0071596_531_890 119
202 3300046499 Ga0495594_0018732 Ga0495594_0018732_1008_1367 119
203 3300046514 Ga0495618_0332217 Ga0495618_0332217_83_442 119
204 3300046535 Ga0495586_0003201 Ga0495586_0003201_6335_6694 119
205 3300046642 Ga0495634_0072313 Ga0495634_0072313_1578_1937 119
206 3300046663 Ga0495635_0000413 Ga0495635_0000413_15823_16182 119
207 3300046675 Ga0495657_0329281 Ga0495657_0329281_481_840 119
208 3300046675 Ga0495657_0550769 Ga0495657_0550769_183_542 119
209 3300046683 Ga0495658_0000018 Ga0495658_0000018_71208_71567 119
210 3300046689 Ga0495613_0012849 Ga0495613_0012849_1442_1801 119
211 3300047315 Ga0495581_0000031 Ga0495581_0000031_21709_22068 119
212 3300047321 Ga0495676_0371398 Ga0495676_0371398_114_473 119
213 3300047322 Ga0495680_0000214 Ga0495680_0000214_2266_2625 119
214 3300047322 Ga0495680_0370932 Ga0495680_0370932_296_655 119
215 3300047471 Ga0495684_0107644 Ga0495684_0107644_1307_1666 119
216 3300047673 Ga0495593_0123095 Ga0495593_0123095_271_630 119
217 3300048089 Ga0495614_0000561 Ga0495614_0000561_1488_1847 119
218 3300050511 nmdc:mga08y16_32152_c1 nmdc:mga08y16_32152_c1_260_619 119
219 3300050512 nmdc:mga0n895_70759_c2 nmdc:mga0n895_70759_c2_1558_1917 119
220 3300050513 nmdc:mga0rr50_1350606_c1 nmdc:mga0rr50_1350606_c1_205_564 119
221 3300053085 Ga0495619_0004045 Ga0495619_0004045_608_967 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00127

Copper-bind

Copper binding proteins, plastocyanin/azurin family

61

144

0.88

PF13473

Cupredoxin_1

Cupredoxin-like domain

38

143

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ids-assembly1.cif.gz_A structure of m98a mutant of amicyanin, cu(i) 0.7609 41 119
2uxg-assembly1.cif.gz_A pseudoazurin with engineered amicyanin ligand loop, reduced form, ph 5.5 0.7567 40 119
1py0-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.755 40 119
2idu-assembly1.cif.gz_A structure of m98q mutant of amicyanin, cu(i) 0.7526 40 119
5paz-assembly1.cif.gz_A reduced mutant p80a pseudoazurin from a. faecalis 0.7504 41 119
ID Description Score Start End Superfamily
af_Q54VX3_19_99_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.7669 39 119 2.60.40.420
af_Q54VX3_19_99_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.7508 39 119 2.60.40.420
5ysgA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.7421 40 119 2.60.40.420
af_Q54Z76_20_120_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.7383 37 119 2.60.40.420
af_P13475_13_104_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7255 37 118 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2M8EMM0-F1-model_v4 Uncharacterized protein 0.7758 40 119 GO:0016020
AF-A0A1F8P9B3-F1-model_v4 Blue (type 1) copper domain-containing protein 0.7737 40 119 GO:0005507
GO:0009055
AF-A0A4Q6BLQ1-F1-model_v4 Methylamine utilization protein 0.7689 39 119 GO:0030246
AF-A0A0Q3WL36-F1-model_v4 deleted 0.7672 34 119
AF-Q54VX3-F1-model_v4 Uncharacterized protein 0.7662 39 119

Feature Viewer

pLDDT pTM Quality
76.21 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map