F333506

General Info

Members Datasets Scaffolds Average Seq Length
221 142 442 271

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100231929|Ga0307408_1002319291
Length 313
Sequence VDVIAKAASSQRTVASVKFLYERGYAIECAVSKLFLTRDSIMILEAEKFRSFELAGWQAIPAGYHDAFGPLTSQAIEPLLDAVRLKKAMSFLDIASGPGYVAAAAAKRGAAVVGVDFSAAMVEHAQRLHAGVEFREGDAEALPFGNGLVDAAAMNFGILHLGQPEKALIEARRILRTNGRFAFSVWAKPEETIGFGIVLRAVELHGEPRVELPEGPPFFRYSDPEECQRSLLVAGFETPSVIKVKQVWRLPAGDGLFNAMKDSTVRTAGLLRAQKPTVLTKIRDEMRGALAQYTKRDVVELPMPAWVASGIKA

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.62
Rhizosphere 95.93
Stem 0
Stem Tuber 0
Unclassified 12.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100231929 3300031548 Unclassified 1512
2 rootH2_10037160 3300003320 Bacteria 5135
3 Ga0065715_10111184 3300005293 Bacteria 2580
4 Ga0070670_100257302 3300005331 Bacteria 1521
5 Ga0068869_100612204 3300005334 Bacteria 921
6 Ga0070666_10018645 3300005335 Bacteria 4466
7 Ga0070680_100177957 3300005336 Unclassified 1791
8 Ga0070668_100321146 3300005347 Bacteria 1303
9 Ga0070668_100484112 3300005347 Bacteria 1069
10 Ga0070675_100084766 3300005354 Bacteria 2646
11 Ga0070671_100011893 3300005355 Bacteria 6999
12 Ga0070671_100166853 3300005355 Bacteria 1862
13 Ga0070674_100060033 3300005356 Unclassified 2649
14 Ga0070667_100284816 3300005367 Bacteria 1485
15 Ga0070711_100107337 3300005439 Bacteria 2043
16 Ga0070694_100014104 3300005444 Bacteria 5002
17 Ga0070694_100103236 3300005444 Bacteria 2020
18 Ga0070694_100161728 3300005444 Bacteria 1643
19 Ga0070708_100003399 3300005445 Bacteria 12467
20 Ga0070678_100066661 3300005456 Bacteria 2677
21 Ga0070681_10338871 3300005458 Bacteria 1413
22 Ga0068867_100009455 3300005459 Bacteria 6874
23 Ga0070706_100122959 3300005467 Bacteria 2420
24 Ga0070706_100489571 3300005467 Bacteria 1144
25 Ga0070707_100045491 3300005468 Bacteria 4202
26 Ga0070707_100289957 3300005468 Unclassified 1590
27 Ga0070698_100140634 3300005471 Bacteria 2365
28 Ga0070699_100306637 3300005518 Bacteria 1425
29 Ga0070699_100601100 3300005518 Bacteria 1003
30 Ga0070697_100034860 3300005536 Bacteria 4059
31 Ga0068853_100344946 3300005539 Bacteria 1384
32 Ga0070695_100000640 3300005545 Bacteria 18572
33 Ga0070695_100028463 3300005545 Bacteria 3467
34 Ga0070665_100218498 3300005548 Bacteria 1906
35 Ga0070704_100289393 3300005549 Bacteria 1361
36 Ga0068855_100012597 3300005563 Bacteria 10206
37 Ga0070664_100187737 3300005564 Bacteria 1840
38 Ga0068857_100073587 3300005577 Bacteria 3045
39 Ga0068854_100070974 3300005578 Bacteria 2546
40 Ga0068856_100542801 3300005614 Bacteria 1184
41 Ga0068852_100388692 3300005616 Bacteria 1370
42 Ga0068864_100009540 3300005618 Bacteria 8008
43 Ga0068866_10023751 3300005718 Bacteria 2856
44 Ga0068866_10146588 3300005718 Bacteria 1362
45 Ga0068858_100411835 3300005842 Unclassified 1299
46 Ga0068860_100239677 3300005843 Unclassified 1764
47 Ga0081455_10084513 3300005937 Unclassified 2590
48 Ga0081538_10003129 3300005981 Bacteria 15741
49 Ga0075432_10089703 3300006058 Bacteria 1124
50 Ga0075428_100026713 3300006844 Bacteria 6392
51 Ga0075428_100226987 3300006844 Bacteria 2016
52 Ga0075428_100603044 3300006844 Bacteria 1173
53 Ga0075430_100192079 3300006846 Bacteria 1697
54 Ga0075430_100431200 3300006846 Bacteria 1088
55 Ga0075431_100032474 3300006847 Bacteria 5379
56 Ga0075431_100086738 3300006847 Unclassified 3230
57 Ga0075431_100152000 3300006847 Bacteria 2383
58 Ga0075433_10056020 3300006852 Bacteria 3443
59 Ga0075433_10111909 3300006852 Bacteria 2422
60 Ga0075433_10113600 3300006852 Unclassified 2403
61 Ga0075433_10118905 3300006852 Unclassified 2345
62 Ga0075433_10119335 3300006852 Bacteria 2341
63 Ga0075433_10298067 3300006852 Bacteria 1428
64 Ga0075434_100001626 3300006871 Bacteria 19109
65 Ga0075434_100057451 3300006871 Bacteria 3867
66 Ga0075434_100150330 3300006871 Bacteria 2349
67 Ga0075434_100183770 3300006871 Bacteria 2111
68 Ga0075434_100331312 3300006871 Bacteria 1543
69 Ga0075434_100336765 3300006871 Bacteria 1529
70 Ga0075434_100569986 3300006871 Unclassified 1152
71 Ga0068865_100139259 3300006881 Bacteria 1828
72 Ga0075436_100020704 3300006914 Bacteria 4513
73 Ga0075436_100053446 3300006914 Bacteria 2789
74 Ga0075436_100261551 3300006914 Bacteria 1234
75 Ga0097620_100232412 3300006931 Bacteria 1932
76 Ga0075435_100001374 3300007076 Bacteria 15713
77 Ga0075435_100030372 3300007076 Bacteria 4248
78 Ga0075435_100054474 3300007076 Bacteria 3228
79 Ga0075435_100060643 3300007076 Bacteria 3067
80 Ga0111539_10135970 3300009094 Bacteria 2878
81 Ga0114129_10003195 3300009147 Bacteria 22988
82 Ga0114129_10010283 3300009147 Bacteria 13353
83 Ga0114129_10039742 3300009147 Bacteria 6635
84 Ga0114129_10557547 3300009147 Bacteria 1489
85 Ga0114129_10580581 3300009147 Bacteria 1454
86 Ga0114129_11147255 3300009147 Bacteria 970
87 Ga0105243_10431451 3300009148 Bacteria 1232
88 Ga0105241_10403619 3300009174 Bacteria 1199
89 Ga0105242_10810773 3300009176 Bacteria 927
90 Ga0105249_10110046 3300009553 Bacteria 2603
91 Ga0157374_10010438 3300013296 Bacteria 7986
92 Ga0157378_10092952 3300013297 Bacteria 2745
93 Ga0163162_10035239 3300013306 Bacteria 4983
94 Ga0163162_10312698 3300013306 Bacteria 1703
95 Ga0157372_10011807 3300013307 Bacteria 9305
96 Ga0163163_10487298 3300014325 Bacteria 1294
97 Ga0157379_10160720 3300014968 Bacteria 2027
98 Ga0207697_10005660 3300025315 Bacteria 5769
99 Ga0207697_10045681 3300025315 Bacteria 1803
100 Ga0207642_10042847 3300025899 Bacteria 1992
101 Ga0207642_10078398 3300025899 Bacteria 1596
102 Ga0207642_10164398 3300025899 Bacteria 1195
103 Ga0207688_10210086 3300025901 Bacteria 1169
104 Ga0207680_10127381 3300025903 Bacteria 1673
105 Ga0207645_10002294 3300025907 Bacteria 15127
106 Ga0207684_10350118 3300025910 Unclassified 1271
107 Ga0207684_10651635 3300025910 Unclassified 897
108 Ga0207707_10087629 3300025912 Bacteria 2719
109 Ga0207660_10385250 3300025917 Unclassified 1127
110 Ga0207657_10015184 3300025919 Bacteria 7473
111 Ga0207652_10209392 3300025921 Bacteria 1755
112 Ga0207646_10264199 3300025922 Bacteria 1555
113 Ga0207646_10277492 3300025922 Bacteria 1515
114 Ga0207644_10321726 3300025931 Bacteria 1251
115 Ga0207706_10039326 3300025933 Unclassified 4193
116 Ga0207706_10132920 3300025933 Bacteria 2188
117 Ga0207686_10340747 3300025934 Bacteria 1126
118 Ga0207670_10326377 3300025936 Bacteria 1209
119 Ga0207704_10234475 3300025938 Bacteria 1367
120 Ga0207691_10271693 3300025940 Bacteria 1460
121 Ga0207679_10182686 3300025945 Bacteria 1736
122 Ga0207640_10446935 3300025981 Bacteria 1064
123 Ga0207678_10073283 3300026067 Bacteria 2935
124 Ga0207702_10413127 3300026078 Bacteria 1303
125 Ga0207674_10459439 3300026116 Unclassified 1231
126 Ga0207683_10028123 3300026121 Unclassified 4861
127 Ga0207683_10350404 3300026121 Unclassified 1355
128 Ga0209983_1014229 3300027665 Bacteria 1639
129 Ga0209971_1011159 3300027682 Bacteria 2128
130 Ga0209998_10021973 3300027717 Bacteria 1373
131 Ga0209974_10013836 3300027876 Bacteria 2688
132 Ga0207428_10244159 3300027907 Bacteria 1341
133 Ga0268266_10131086 3300028379 Bacteria 2242
134 Ga0268265_10014789 3300028380 Bacteria 5325
135 Ga0268264_10223807 3300028381 Bacteria 1733
136 Ga0307410_10442064 3300031852 Bacteria 1059
137 Ga0307412_10306033 3300031911 Unclassified 1258
138 Ga0307409_100339465 3300031995 Unclassified 1413
139 Ga0307416_100006859 3300032002 Bacteria 7166
140 Ga0373945_0033247 3300035116 Bacteria 1832
141 Ga0373931_0047501 3300035691 Bacteria 2272
142 Ga0373931_0114953 3300035691 Bacteria 1531
143 Ga0373935_0299335 3300035692 Unclassified 1136
144 Ga0373925_0147321 3300037068 Bacteria 1846
145 Ga0451576_0634903 3300045051 Bacteria 1122
146 Ga0451576_0853876 3300045051 Bacteria 955
147 Ga0495638_0023392 3300046460 Bacteria 4041
148 Ga0495580_0004750 3300046472 Bacteria 11370
149 Ga0495580_0051776 3300046472 Unclassified 2902
150 Ga0495594_0141632 3300046499 Unclassified 1364
151 Ga0496101_0287801 3300048904 Bacteria 1285
152 Ga0496104_0024251 3300048907 Bacteria 5580
153 Ga0496105_0119262 3300048908 Bacteria 2176
154 Ga0496106_0030133 3300048909 Bacteria 4045
155 Ga0496112_0253059 3300048915 Bacteria 1712
156 Ga0496113_0010147 3300048916 Bacteria 6216
157 Ga0496114_0279155 3300048917 Bacteria 1473
158 Ga0496114_0468347 3300048917 Bacteria 1115
159 Ga0501036_0030902 3300049572 Bacteria 4526
160 Ga0501038_0015679 3300049574 Bacteria 6888
161 Ga0501039_0005296 3300049575 Bacteria 9757
162 Ga0501040_0000256 3300049576 Bacteria 31223
163 Ga0501041_0010793 3300049577 Bacteria 5388
164 Ga0501041_0044034 3300049577 Bacteria 2713
165 Ga0501042_0000111 3300049578 Bacteria 34173
166 Ga0501046_0047679 3300049580 Bacteria 3396
167 Ga0501046_0182052 3300049580 Bacteria 1571
168 Ga0501068_0016734 3300049584 Unclassified 4231
169 Ga0501071_0004221 3300049587 Bacteria 9098
170 Ga0501072_0000400 3300049588 Bacteria 31059
171 Ga0501072_0109864 3300049588 Bacteria 2195
172 Ga0501074_0113547 3300049590 Bacteria 1938
173 Ga0501075_0002289 3300049591 Bacteria 12708
174 Ga0501075_0045182 3300049591 Bacteria 3305
175 Ga0501075_0058569 3300049591 Bacteria 2902
176 Ga0501076_0000082 3300049592 Bacteria 49503
177 Ga0501076_0015300 3300049592 Bacteria 5795
178 Ga0501077_0000386 3300049593 Bacteria 26424
179 Ga0501079_0000078 3300049741 Bacteria 46006
180 Ga0501079_0029844 3300049741 Bacteria 4188
181 Ga0501080_0090595 3300049742 Bacteria 2841
182 Ga0501081_0000256 3300049743 Bacteria 27559
183 Ga0501081_0018988 3300049743 Bacteria 4571
184 Ga0501083_0142200 3300049744 Bacteria 1571
185 Ga0501083_0143322 3300049744 Bacteria 1564
186 Ga0501035_0031709 3300049822 Bacteria 4813
187 Ga0501035_0440546 3300049822 Bacteria 1079
188 Ga0501045_0216979 3300049824 Unclassified 1425
189 Ga0501045_0255629 3300049824 Bacteria 1304
190 nmdc:mga05p37_138504_c1 3300050507 Bacteria 2982
191 nmdc:mga05p37_184056_c1 3300050507 Unclassified 2540
192 nmdc:mga05p37_406401_c1 3300050507 Bacteria 1588
193 nmdc:mga05p37_6316_c1 3300050507 Bacteria 13955
194 nmdc:mga05p37_67698_c1 3300050507 Bacteria 4393
195 nmdc:mga05p37_8233_c1 3300050507 Bacteria 12332
196 nmdc:mga09592_602435_c1 3300050508 Unclassified 941
197 nmdc:mga06r32_335804_c1 3300050510 Bacteria 1496
198 nmdc:mga08y16_69975_c1 3300050511 Bacteria 3658
199 nmdc:mga0n895_119788_c1 3300050512 Bacteria 2653
200 nmdc:mga0n895_171353_c1 3300050512 Bacteria 2203
201 nmdc:mga0n895_359061_c1 3300050512 Bacteria 1475
202 nmdc:mga0n895_3665_c1 3300050512 Bacteria 12411
203 nmdc:mga0n895_522948_c1 3300050512 Bacteria 1194
204 nmdc:mga0n895_56446_c1 3300050512 Bacteria 3868
205 nmdc:mga0n895_57564_c1 3300050512 Bacteria 3831
206 nmdc:mga0rr50_102681_c1 3300050513 Bacteria 2249
207 nmdc:mga0rr50_44151_c1 3300050513 Bacteria 3267
208 nmdc:mga0rr50_75593_c1 3300050513 Bacteria 2583
209 nmdc:mga08x19_43788_c1 3300050514 Bacteria 2856
210 nmdc:mga08x19_82024_c1 3300050514 Bacteria 2118
211 nmdc:mga0a205_118805_c1 3300050515 Bacteria 2542
212 nmdc:mga0a205_218231_c1 3300050515 Bacteria 1794
213 nmdc:mga0a205_65028_c1 3300050515 Bacteria 3524
214 nmdc:mga0a205_8510_c1 3300050515 Bacteria 9330
215 Ga0501084_0000285 3300054114 Bacteria 38213
216 Ga0501084_0631402 3300054114 Bacteria 904
217 Ga0501082_0010241 3300060353 Bacteria 8073
218 Ga0501082_0404386 3300060353 Bacteria 1191
219 Ga0530510_0013823 3300061734 Bacteria 5684
220 Ga0530510_0036913 3300061734 Bacteria 3521
221 Ga0530510_0476600 3300061734 Bacteria 945
222 Ga0307408_100231929
223 rootH2_10037160
224 Ga0065715_10111184
225 Ga0070670_100257302
226 Ga0068869_100612204
227 Ga0070666_10018645
228 Ga0070680_100177957
229 Ga0070668_100321146
230 Ga0070668_100484112
231 Ga0070675_100084766
232 Ga0070671_100011893
233 Ga0070671_100166853
234 Ga0070674_100060033
235 Ga0070667_100284816
236 Ga0070711_100107337
237 Ga0070694_100014104
238 Ga0070694_100103236
239 Ga0070694_100161728
240 Ga0070708_100003399
241 Ga0070678_100066661
242 Ga0070681_10338871
243 Ga0068867_100009455
244 Ga0070706_100122959
245 Ga0070706_100489571
246 Ga0070707_100045491
247 Ga0070707_100289957
248 Ga0070698_100140634
249 Ga0070699_100306637
250 Ga0070699_100601100
251 Ga0070697_100034860
252 Ga0068853_100344946
253 Ga0070695_100000640
254 Ga0070695_100028463
255 Ga0070665_100218498
256 Ga0070704_100289393
257 Ga0068855_100012597
258 Ga0070664_100187737
259 Ga0068857_100073587
260 Ga0068854_100070974
261 Ga0068856_100542801
262 Ga0068852_100388692
263 Ga0068864_100009540
264 Ga0068866_10023751
265 Ga0068866_10146588
266 Ga0068858_100411835
267 Ga0068860_100239677
268 Ga0081455_10084513
269 Ga0081538_10003129
270 Ga0075432_10089703
271 Ga0075428_100026713
272 Ga0075428_100226987
273 Ga0075428_100603044
274 Ga0075430_100192079
275 Ga0075430_100431200
276 Ga0075431_100032474
277 Ga0075431_100086738
278 Ga0075431_100152000
279 Ga0075433_10056020
280 Ga0075433_10111909
281 Ga0075433_10113600
282 Ga0075433_10118905
283 Ga0075433_10119335
284 Ga0075433_10298067
285 Ga0075434_100001626
286 Ga0075434_100057451
287 Ga0075434_100150330
288 Ga0075434_100183770
289 Ga0075434_100331312
290 Ga0075434_100336765
291 Ga0075434_100569986
292 Ga0068865_100139259
293 Ga0075436_100020704
294 Ga0075436_100053446
295 Ga0075436_100261551
296 Ga0097620_100232412
297 Ga0075435_100001374
298 Ga0075435_100030372
299 Ga0075435_100054474
300 Ga0075435_100060643
301 Ga0111539_10135970
302 Ga0114129_10003195
303 Ga0114129_10010283
304 Ga0114129_10039742
305 Ga0114129_10557547
306 Ga0114129_10580581
307 Ga0114129_11147255
308 Ga0105243_10431451
309 Ga0105241_10403619
310 Ga0105242_10810773
311 Ga0105249_10110046
312 Ga0157374_10010438
313 Ga0157378_10092952
314 Ga0163162_10035239
315 Ga0163162_10312698
316 Ga0157372_10011807
317 Ga0163163_10487298
318 Ga0157379_10160720
319 Ga0207697_10005660
320 Ga0207697_10045681
321 Ga0207642_10042847
322 Ga0207642_10078398
323 Ga0207642_10164398
324 Ga0207688_10210086
325 Ga0207680_10127381
326 Ga0207645_10002294
327 Ga0207684_10350118
328 Ga0207684_10651635
329 Ga0207707_10087629
330 Ga0207660_10385250
331 Ga0207657_10015184
332 Ga0207652_10209392
333 Ga0207646_10264199
334 Ga0207646_10277492
335 Ga0207644_10321726
336 Ga0207706_10039326
337 Ga0207706_10132920
338 Ga0207686_10340747
339 Ga0207670_10326377
340 Ga0207704_10234475
341 Ga0207691_10271693
342 Ga0207679_10182686
343 Ga0207640_10446935
344 Ga0207678_10073283
345 Ga0207702_10413127
346 Ga0207674_10459439
347 Ga0207683_10028123
348 Ga0207683_10350404
349 Ga0209983_1014229
350 Ga0209971_1011159
351 Ga0209998_10021973
352 Ga0209974_10013836
353 Ga0207428_10244159
354 Ga0268266_10131086
355 Ga0268265_10014789
356 Ga0268264_10223807
357 Ga0307410_10442064
358 Ga0307412_10306033
359 Ga0307409_100339465
360 Ga0307416_100006859
361 Ga0373945_0033247
362 Ga0373931_0047501
363 Ga0373931_0114953
364 Ga0373935_0299335
365 Ga0373925_0147321
366 Ga0451576_0634903
367 Ga0451576_0853876
368 Ga0495638_0023392
369 Ga0495580_0004750
370 Ga0495580_0051776
371 Ga0495594_0141632
372 Ga0496101_0287801
373 Ga0496104_0024251
374 Ga0496105_0119262
375 Ga0496106_0030133
376 Ga0496112_0253059
377 Ga0496113_0010147
378 Ga0496114_0279155
379 Ga0496114_0468347
380 Ga0501036_0030902
381 Ga0501038_0015679
382 Ga0501039_0005296
383 Ga0501040_0000256
384 Ga0501041_0010793
385 Ga0501041_0044034
386 Ga0501042_0000111
387 Ga0501046_0047679
388 Ga0501046_0182052
389 Ga0501068_0016734
390 Ga0501071_0004221
391 Ga0501072_0000400
392 Ga0501072_0109864
393 Ga0501074_0113547
394 Ga0501075_0002289
395 Ga0501075_0045182
396 Ga0501075_0058569
397 Ga0501076_0000082
398 Ga0501076_0015300
399 Ga0501077_0000386
400 Ga0501079_0000078
401 Ga0501079_0029844
402 Ga0501080_0090595
403 Ga0501081_0000256
404 Ga0501081_0018988
405 Ga0501083_0142200
406 Ga0501083_0143322
407 Ga0501035_0031709
408 Ga0501035_0440546
409 Ga0501045_0216979
410 Ga0501045_0255629
411 nmdc:mga05p37_138504_c1
412 nmdc:mga05p37_184056_c1
413 nmdc:mga05p37_406401_c1
414 nmdc:mga05p37_6316_c1
415 nmdc:mga05p37_67698_c1
416 nmdc:mga05p37_8233_c1
417 nmdc:mga09592_602435_c1
418 nmdc:mga06r32_335804_c1
419 nmdc:mga08y16_69975_c1
420 nmdc:mga0n895_119788_c1
421 nmdc:mga0n895_171353_c1
422 nmdc:mga0n895_359061_c1
423 nmdc:mga0n895_3665_c1
424 nmdc:mga0n895_522948_c1
425 nmdc:mga0n895_56446_c1
426 nmdc:mga0n895_57564_c1
427 nmdc:mga0rr50_102681_c1
428 nmdc:mga0rr50_44151_c1
429 nmdc:mga0rr50_75593_c1
430 nmdc:mga08x19_43788_c1
431 nmdc:mga08x19_82024_c1
432 nmdc:mga0a205_118805_c1
433 nmdc:mga0a205_218231_c1
434 nmdc:mga0a205_65028_c1
435 nmdc:mga0a205_8510_c1
436 Ga0501084_0000285
437 Ga0501084_0631402
438 Ga0501082_0010241
439 Ga0501082_0404386
440 Ga0530510_0013823
441 Ga0530510_0036913
442 Ga0530510_0476600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

92

183

0.96

PF13649

Methyltransf_25

Methyltransferase domain

91

179

0.93

PF13847

Methyltransf_31

Methyltransferase domain

85

195

0.93

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

77

195

0.86

PF08242

Methyltransf_12

Methyltransferase domain

92

181

0.84

PF13489

Methyltransf_23

Methyltransferase domain

66

221

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.824 33 146
4qtt-assembly2.cif.gz_D structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (apo-form) 0.8097 28 197
3e23-assembly1.cif.gz_A crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299 0.809 7 269
1dus-assembly1.cif.gz_A mj0882-a hypothetical protein from m. jannaschii 0.807 34 144
6isv-assembly1.cif.gz_B structure of acetophenone reductase from geotrichum candidum nbrc 4597 in complex with nad 0.8044 25 135
ID Description Score Start End Superfamily
af_Q54LU3_44_217_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9439 33 139 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9122 43 143 3.40.50.150
af_Q4D3E1_216_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9076 29 78 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9023 41 96 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9013 32 96 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V6B0P3-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9892 4 191 GO:0008757
AF-A0A1F4AI07-F1-model_v4 Ubiquinone biosynthesis methyltransferase UbiE 0.9872 4 269 GO:0008757
GO:0032259
AF-A0A261KSC8-F1-model_v4 Methyltransferase type 11 0.9831 1 269 GO:0008757
GO:0032259
AF-A0A261KSC8-F1-model_v4 Methyltransferase type 11 0.9795 1 269 GO:0008757
GO:0032259
AF-A0A158A1Y9-F1-model_v4 Methyltransferase type 11 0.9791 2 269 GO:0008757
GO:0032259

Map