F333479

General Info

Members Datasets Scaffolds Average Seq Length
221 190 442 95

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10043971|Ga0307517_100439716
Length 112
Sequence MSTGTPLNEEFTAELIKSPNAGGWTYLVWPESVAFFGTRGLVKVRGTIDGHPFRSSFMALGDGTHKLPVKADLRKVIDKGEGDQVTVRLEERINSWRVPLRDTAAAPPRPPA

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
111 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
114 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
115 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
169 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
182 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
183 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
184 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
187 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
188 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.45
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.55
Nodule 0
Rhizoplane 3.17
Rhizosphere 70.59
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10043971 3300028786 Bacteria 4739
2 SwRhRL2b_contig_1013487 2162886007 Bacteria 49455
3 JGI24740J21852_10008633 3300001979 Bacteria 4048
4 JGI24740J21852_10055280 3300001979 Bacteria 1117
5 JGI24739J22299_10100524 3300001989 Bacteria 873
6 JGI24735J21928_10060851 3300002067 Bacteria 1085
7 JGI24748J21848_1005740 3300002074 Bacteria 1442
8 JGI25162J39368_1000130 3300002737 Bacteria 83005
9 JGI25158J39367_1004539 3300002739 Bacteria 2079
10 JGI25153J46596_10014625 3300003215 Bacteria 3250
11 rootH1_10119457 3300003316 Bacteria 1413
12 JGI25160J50197_1001284 3300003354 Bacteria 12741
13 JGI25160J50197_1016663 3300003354 Bacteria 2358
14 JGI25160J50197_1080417 3300003354 Unclassified 605
15 Ga0007429J51699_1081826 3300003579 Bacteria 772
16 Ga0055526_1003716 3300003771 Bacteria 9532
17 Ga0055528_1001323 3300003790 Bacteria 15478
18 Ga0055543_1008436 3300004625 Unclassified 2282
19 Ga0065165_1000069 3300005262 Bacteria 170089
20 Ga0065704_10070168 3300005289 Bacteria 171820
21 Ga0068868_100822185 3300005338 Bacteria 840
22 Ga0070671_100062576 3300005355 Bacteria 3098
23 Ga0070667_100059177 3300005367 Bacteria 3241
24 Ga0070714_101091772 3300005435 Bacteria 777
25 Ga0070713_100597110 3300005436 Bacteria 1048
26 Ga0070700_100406599 3300005441 Bacteria 1025
27 Ga0070708_100663069 3300005445 Bacteria 983
28 Ga0070663_100297563 3300005455 Bacteria 1291
29 Ga0070662_100606963 3300005457 Bacteria 921
30 Ga0070679_101594836 3300005530 Bacteria 600
31 Ga0070697_101063652 3300005536 Bacteria 720
32 Ga0068855_101029591 3300005563 Bacteria 864
33 Ga0068854_100250887 3300005578 Bacteria 1413
34 Ga0068856_100575818 3300005614 Bacteria 1147
35 Ga0068863_101229578 3300005841 Bacteria 755
36 Ga0068858_100747938 3300005842 Bacteria 952
37 Ga0068860_102193765 3300005843 Bacteria 573
38 Ga0068862_102613536 3300005844 Bacteria 517
39 Ga0081455_10064269 3300005937 Bacteria 3074
40 Ga0081455_10771974 3300005937 Bacteria 606
41 Ga0070717_10729767 3300006028 Bacteria 900
42 Ga0075363_100039917 3300006048 Bacteria 2473
43 Ga0097621_100513237 3300006237 Bacteria 1087
44 Ga0075370_10077638 3300006353 Bacteria 1906
45 Ga0068871_100471225 3300006358 Bacteria 1128
46 Ga0075428_100001851 3300006844 Bacteria 22659
47 Ga0075428_102417494 3300006844 Unclassified 539
48 Ga0075430_100006538 3300006846 Bacteria 9830
49 Ga0075431_100377993 3300006847 Bacteria 1421
50 Ga0075433_10490821 3300006852 Bacteria 1081
51 Ga0105240_11484679 3300009093 Bacteria 711
52 Ga0111539_10755333 3300009094 Bacteria 1132
53 Ga0105245_10434741 3300009098 Bacteria 1318
54 Ga0105247_10336565 3300009101 Bacteria 1057
55 Ga0114129_10002328 3300009147 Bacteria 26370
56 Ga0105242_11166518 3300009176 Unclassified 788
57 Ga0105249_12088589 3300009553 Bacteria 639
58 Ga0105239_10000690 3300010375 Bacteria 48107
59 Ga0105239_10001435 3300010375 Bacteria 31777
60 Ga0105239_11355566 3300010375 Bacteria 821
61 Ga0105239_12126256 3300010375 Bacteria 652
62 Ga0157370_10947945 3300013104 Unclassified 780
63 Ga0157378_10001255 3300013297 Bacteria 22855
64 Ga0157378_12079154 3300013297 Unclassified 618
65 Ga0157372_10016314 3300013307 Bacteria 7971
66 Ga0157372_10750373 3300013307 Unclassified 1135
67 Ga0157375_10789072 3300013308 Bacteria 1099
68 Ga0163163_13287421 3300014325 Unclassified 504
69 Ga0157379_10896611 3300014968 Bacteria 841
70 Ga0163161_10256682 3300017792 Bacteria 1364
71 Ga0163161_10406397 3300017792 Bacteria 1093
72 Ga0209436_102194 3300025208 Bacteria 6080
73 Ga0209437_100089 3300025233 Bacteria 250476
74 Ga0209129_1006585 3300025258 Bacteria 3704
75 Ga0209673_1000551 3300025273 Bacteria 60318
76 Ga0209673_1021652 3300025273 Unclassified 2242
77 Ga0209130_1001119 3300025284 Bacteria 19701
78 Ga0209564_1005244 3300025295 Bacteria 7492
79 Ga0209564_1023034 3300025295 Bacteria 2179
80 Ga0209758_1001301 3300025297 Bacteria 30586
81 Ga0209050_1003416 3300025298 Bacteria 11748
82 Ga0207426_1000446 3300025302 Bacteria 66148
83 Ga0207426_1006653 3300025302 Unclassified 4972
84 Ga0207426_1019922 3300025302 Bacteria 2339
85 Ga0209051_1010783 3300025303 Bacteria 4574
86 Ga0209257_1011645 3300025304 Bacteria 4199
87 Ga0207692_10400959 3300025898 Bacteria 855
88 Ga0207642_10171997 3300025899 Bacteria 1173
89 Ga0207680_10330488 3300025903 Bacteria 1067
90 Ga0207647_10374444 3300025904 Bacteria 804
91 Ga0207645_10000046 3300025907 Bacteria 85043
92 Ga0207654_10008194 3300025911 Bacteria 5271
93 Ga0207695_10255836 3300025913 Unclassified 1650
94 Ga0207671_10002593 3300025914 Bacteria 19092
95 Ga0207671_10063075 3300025914 Bacteria 2753
96 Ga0207671_10965860 3300025914 Bacteria 672
97 Ga0207686_10037308 3300025934 Bacteria 2932
98 Ga0207704_10000058 3300025938 Bacteria 77010
99 Ga0207665_11077392 3300025939 Bacteria 640
100 Ga0207689_11818632 3300025942 Bacteria 503
101 Ga0207667_10921209 3300025949 Bacteria 865
102 Ga0207651_10042578 3300025960 Bacteria 3023
103 Ga0207640_10014912 3300025981 Bacteria 4485
104 Ga0207658_10178597 3300025986 Bacteria 1755
105 Ga0207658_10259694 3300025986 Bacteria 1480
106 Ga0207677_10005069 3300026023 Bacteria 7118
107 Ga0207677_10213112 3300026023 Bacteria 1544
108 Ga0207639_10151677 3300026041 Bacteria 1942
109 Ga0207678_10366210 3300026067 Bacteria 1244
110 Ga0207702_10642148 3300026078 Bacteria 1043
111 Ga0207648_10002693 3300026089 Bacteria 18903
112 Ga0207683_10099783 3300026121 Bacteria 2592
113 Ga0268265_10620436 3300028380 Bacteria 1036
114 Ga0265318_10170737 3300028577 Unclassified 797
115 Ga0307517_10002971 3300028786 Bacteria 26793
116 Ga0307515_10000106 3300028794 Bacteria 197218
117 Ga0265338_10017141 3300028800 Bacteria 7827
118 Ga0307511_10035952 3300030521 Bacteria 4314
119 Ga0307512_10125070 3300030522 Bacteria 1636
120 Ga0307513_10002975 3300031456 Bacteria 23106
121 Ga0307509_10055491 3300031507 Bacteria 4210
122 Ga0307508_10189317 3300031616 Bacteria 1659
123 Ga0307516_10658731 3300031730 Bacteria 702
124 Ga0307407_11119197 3300031903 Bacteria 613
125 Ga0307409_100842290 3300031995 Bacteria 927
126 Ga0307409_102106351 3300031995 Bacteria 594
127 Ga0307414_11770541 3300032004 Unclassified 576
128 Ga0307507_10049807 3300033179 Bacteria 4053
129 Ga0307507_10119956 3300033179 Bacteria 2108
130 Ga0307510_10003365 3300033180 Bacteria 18633
131 Ga0307510_10030278 3300033180 Bacteria 6136
132 Ga0307510_10241534 3300033180 Bacteria 1300
133 Ga0439465_0010823 3300041413 Bacteria 2862
134 Ga0451795_1325564 3300041456 Bacteria 511
135 Ga0451800_1056744 3300041459 Bacteria 983
136 Ga0451853_4073358 3300041512 Bacteria 636
137 Ga0439431_0026323 3300041997 Bacteria 1425
138 Ga0439445_0084284 3300042004 Bacteria 890
139 Ga0439440_0018924 3300042993 Bacteria 1530
140 Ga0466966_0135729 3300044684 Bacteria 1505
141 Ga0466963_0915209 3300044694 Bacteria 618
142 Ga0466968_0717342 3300044735 Unclassified 511
143 Ga0466958_0013985 3300045836 Bacteria 4577
144 Ga0495592_0065486 3300046454 Bacteria 2660
145 Ga0495629_0379762 3300046459 Bacteria 961
146 Ga0495638_0186595 3300046460 Bacteria 1179
147 Ga0495641_0392096 3300046461 Bacteria 630
148 Ga0495651_0020897 3300046462 Bacteria 5082
149 Ga0495653_0213472 3300046463 Bacteria 1302
150 Ga0495582_0185949 3300046473 Bacteria 1184
151 Ga0495662_0001234 3300046476 Bacteria 12592
152 Ga0495664_0000236 3300046477 Bacteria 26604
153 Ga0495585_0088539 3300046492 Bacteria 1670
154 Ga0495608_0427294 3300046511 Bacteria 808
155 Ga0495616_0010157 3300046513 Bacteria 5463
156 Ga0495618_0023081 3300046514 Bacteria 3844
157 Ga0495631_0014049 3300046518 Bacteria 3870
158 Ga0495652_0023380 3300046529 Bacteria 5477
159 Ga0495652_0437931 3300046529 Bacteria 918
160 Ga0495640_0094570 3300046533 Bacteria 1968
161 Ga0495587_0048132 3300046536 Bacteria 2525
162 Ga0495656_0109765 3300046615 Bacteria 1288
163 Ga0495668_0264380 3300046616 Bacteria 942
164 Ga0495634_0003864 3300046642 Bacteria 11894
165 Ga0495625_0184873 3300046660 Bacteria 1383
166 Ga0495625_0198533 3300046660 Bacteria 1325
167 Ga0495635_0061423 3300046663 Bacteria 2581
168 Ga0495588_0637936 3300046674 Bacteria 557
169 Ga0495657_0022591 3300046675 Bacteria 4503
170 Ga0495599_0198440 3300046678 Bacteria 1233
171 Ga0495646_0000835 3300046680 Bacteria 17392
172 Ga0495658_0057289 3300046683 Bacteria 2225
173 Ga0495613_0000319 3300046689 Bacteria 43656
174 Ga0495613_0121819 3300046689 Bacteria 1873
175 Ga0495671_0003760 3300046692 Bacteria 9222
176 Ga0495649_0127508 3300046694 Bacteria 1344
177 Ga0495649_0380432 3300046694 Bacteria 710
178 Ga0495600_0021716 3300046809 Bacteria 4115
179 Ga0495581_0020514 3300047315 Bacteria 3835
180 Ga0495604_0006154 3300047317 Bacteria 9521
181 Ga0495676_0016697 3300047321 Bacteria 6502
182 Ga0495676_0554495 3300047321 Bacteria 751
183 Ga0495683_0148880 3300047323 Bacteria 1091
184 Ga0495675_0123443 3300047444 Bacteria 1612
185 Ga0495681_0001776 3300047470 Bacteria 15890
186 Ga0495593_0008280 3300047673 Bacteria 6050
187 Ga0495602_0127088 3300048088 Bacteria 2040
188 Ga0495614_0014620 3300048089 Bacteria 3432
189 Ga0495626_0355720 3300048091 Bacteria 571
190 Ga0496107_0617425 3300048910 Unclassified 801
191 Ga0496108_0565308 3300048911 Bacteria 992
192 Ga0496112_1288020 3300048915 Bacteria 647
193 Ga0496113_0434039 3300048916 Bacteria 1055
194 Ga0496114_0977925 3300048917 Bacteria 729
195 Ga0495678_025684 3300049459 Bacteria 2526
196 Ga0501075_0105674 3300049591 Bacteria 2140
197 Ga0501251_050999 3300049681 Bacteria 656
198 Ga0501241_008460 3300049758 Bacteria 1878
199 nmdc:mga03n38_3371_c1 3300050490 Bacteria 1682
200 nmdc:mga00v17_766161_c1 3300050491 Bacteria 616
201 nmdc:mga07m45_15334_c1 3300050496 Bacteria 4091
202 nmdc:mga07m45_177248_c1 3300050496 Bacteria 1239
203 nmdc:mga05p37_137318_c1 3300050507 Bacteria 2997
204 nmdc:mga0qj67_16844_c1 3300050509 Bacteria 5550
205 nmdc:mga06r32_20101_c1 3300050510 Bacteria 2009
206 nmdc:mga08y16_239579_c1 3300050511 Bacteria 1875
207 nmdc:mga0sz30_41430_c1 3300050516 Bacteria 1936
208 Ga0495655_0018817 3300053083 Bacteria 1524
209 Ga0495595_0649062 3300053084 Bacteria 540
210 Ga0495619_0061198 3300053085 Bacteria 2505
211 Ga0500640_082552 3300053095 Bacteria 1360
212 Ga0500572_013605 3300053111 Bacteria 2017
213 Ga0500608_000492 3300053122 Bacteria 14790
214 Ga0500652_040977 3300053131 Bacteria 1863
215 Ga0500568_0179498 3300053139 Bacteria 778
216 Ga0500568_0218499 3300053139 Bacteria 696
217 Ga0500586_134671 3300053145 Bacteria 853
218 Ga0500624_023542 3300053157 Bacteria 1010
219 Ga0500636_0398835 3300053177 Bacteria 639
220 Ga0501084_0734926 3300054114 Bacteria 832
221 2929926278 2929921140 Bacteria 8649150
222 Ga0307517_10043971
223 SwRhRL2b_contig_1013487
224 JGI24740J21852_10008633
225 JGI24740J21852_10055280
226 JGI24739J22299_10100524
227 JGI24735J21928_10060851
228 JGI24748J21848_1005740
229 JGI25162J39368_1000130
230 JGI25158J39367_1004539
231 JGI25153J46596_10014625
232 rootH1_10119457
233 JGI25160J50197_1001284
234 JGI25160J50197_1016663
235 JGI25160J50197_1080417
236 Ga0007429J51699_1081826
237 Ga0055526_1003716
238 Ga0055528_1001323
239 Ga0055543_1008436
240 Ga0065165_1000069
241 Ga0065704_10070168
242 Ga0068868_100822185
243 Ga0070671_100062576
244 Ga0070667_100059177
245 Ga0070714_101091772
246 Ga0070713_100597110
247 Ga0070700_100406599
248 Ga0070708_100663069
249 Ga0070663_100297563
250 Ga0070662_100606963
251 Ga0070679_101594836
252 Ga0070697_101063652
253 Ga0068855_101029591
254 Ga0068854_100250887
255 Ga0068856_100575818
256 Ga0068863_101229578
257 Ga0068858_100747938
258 Ga0068860_102193765
259 Ga0068862_102613536
260 Ga0081455_10064269
261 Ga0081455_10771974
262 Ga0070717_10729767
263 Ga0075363_100039917
264 Ga0097621_100513237
265 Ga0075370_10077638
266 Ga0068871_100471225
267 Ga0075428_100001851
268 Ga0075428_102417494
269 Ga0075430_100006538
270 Ga0075431_100377993
271 Ga0075433_10490821
272 Ga0105240_11484679
273 Ga0111539_10755333
274 Ga0105245_10434741
275 Ga0105247_10336565
276 Ga0114129_10002328
277 Ga0105242_11166518
278 Ga0105249_12088589
279 Ga0105239_10000690
280 Ga0105239_10001435
281 Ga0105239_11355566
282 Ga0105239_12126256
283 Ga0157370_10947945
284 Ga0157378_10001255
285 Ga0157378_12079154
286 Ga0157372_10016314
287 Ga0157372_10750373
288 Ga0157375_10789072
289 Ga0163163_13287421
290 Ga0157379_10896611
291 Ga0163161_10256682
292 Ga0163161_10406397
293 Ga0209436_102194
294 Ga0209437_100089
295 Ga0209129_1006585
296 Ga0209673_1000551
297 Ga0209673_1021652
298 Ga0209130_1001119
299 Ga0209564_1005244
300 Ga0209564_1023034
301 Ga0209758_1001301
302 Ga0209050_1003416
303 Ga0207426_1000446
304 Ga0207426_1006653
305 Ga0207426_1019922
306 Ga0209051_1010783
307 Ga0209257_1011645
308 Ga0207692_10400959
309 Ga0207642_10171997
310 Ga0207680_10330488
311 Ga0207647_10374444
312 Ga0207645_10000046
313 Ga0207654_10008194
314 Ga0207695_10255836
315 Ga0207671_10002593
316 Ga0207671_10063075
317 Ga0207671_10965860
318 Ga0207686_10037308
319 Ga0207704_10000058
320 Ga0207665_11077392
321 Ga0207689_11818632
322 Ga0207667_10921209
323 Ga0207651_10042578
324 Ga0207640_10014912
325 Ga0207658_10178597
326 Ga0207658_10259694
327 Ga0207677_10005069
328 Ga0207677_10213112
329 Ga0207639_10151677
330 Ga0207678_10366210
331 Ga0207702_10642148
332 Ga0207648_10002693
333 Ga0207683_10099783
334 Ga0268265_10620436
335 Ga0265318_10170737
336 Ga0307517_10002971
337 Ga0307515_10000106
338 Ga0265338_10017141
339 Ga0307511_10035952
340 Ga0307512_10125070
341 Ga0307513_10002975
342 Ga0307509_10055491
343 Ga0307508_10189317
344 Ga0307516_10658731
345 Ga0307407_11119197
346 Ga0307409_100842290
347 Ga0307409_102106351
348 Ga0307414_11770541
349 Ga0307507_10049807
350 Ga0307507_10119956
351 Ga0307510_10003365
352 Ga0307510_10030278
353 Ga0307510_10241534
354 Ga0439465_0010823
355 Ga0451795_1325564
356 Ga0451800_1056744
357 Ga0451853_4073358
358 Ga0439431_0026323
359 Ga0439445_0084284
360 Ga0439440_0018924
361 Ga0466966_0135729
362 Ga0466963_0915209
363 Ga0466968_0717342
364 Ga0466958_0013985
365 Ga0495592_0065486
366 Ga0495629_0379762
367 Ga0495638_0186595
368 Ga0495641_0392096
369 Ga0495651_0020897
370 Ga0495653_0213472
371 Ga0495582_0185949
372 Ga0495662_0001234
373 Ga0495664_0000236
374 Ga0495585_0088539
375 Ga0495608_0427294
376 Ga0495616_0010157
377 Ga0495618_0023081
378 Ga0495631_0014049
379 Ga0495652_0023380
380 Ga0495652_0437931
381 Ga0495640_0094570
382 Ga0495587_0048132
383 Ga0495656_0109765
384 Ga0495668_0264380
385 Ga0495634_0003864
386 Ga0495625_0184873
387 Ga0495625_0198533
388 Ga0495635_0061423
389 Ga0495588_0637936
390 Ga0495657_0022591
391 Ga0495599_0198440
392 Ga0495646_0000835
393 Ga0495658_0057289
394 Ga0495613_0000319
395 Ga0495613_0121819
396 Ga0495671_0003760
397 Ga0495649_0127508
398 Ga0495649_0380432
399 Ga0495600_0021716
400 Ga0495581_0020514
401 Ga0495604_0006154
402 Ga0495676_0016697
403 Ga0495676_0554495
404 Ga0495683_0148880
405 Ga0495675_0123443
406 Ga0495681_0001776
407 Ga0495593_0008280
408 Ga0495602_0127088
409 Ga0495614_0014620
410 Ga0495626_0355720
411 Ga0496107_0617425
412 Ga0496108_0565308
413 Ga0496112_1288020
414 Ga0496113_0434039
415 Ga0496114_0977925
416 Ga0495678_025684
417 Ga0501075_0105674
418 Ga0501251_050999
419 Ga0501241_008460
420 nmdc:mga03n38_3371_c1
421 nmdc:mga00v17_766161_c1
422 nmdc:mga07m45_15334_c1
423 nmdc:mga07m45_177248_c1
424 nmdc:mga05p37_137318_c1
425 nmdc:mga0qj67_16844_c1
426 nmdc:mga06r32_20101_c1
427 nmdc:mga08y16_239579_c1
428 nmdc:mga0sz30_41430_c1
429 Ga0495655_0018817
430 Ga0495595_0649062
431 Ga0495619_0061198
432 Ga0500640_082552
433 Ga0500572_013605
434 Ga0500608_000492
435 Ga0500652_040977
436 Ga0500568_0179498
437 Ga0500568_0218499
438 Ga0500586_134671
439 Ga0500624_023542
440 Ga0500636_0398835
441 Ga0501084_0734926
442 2929926278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08922

DUF1905

Domain of unknown function (DUF1905)

11

89

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8854 6 90
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8567 6 90
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.7154 1 89
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.6876 1 89
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.6528 7 87
ID Description Score Start End Superfamily
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8869 6 90 2.40.30.100
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8573 6 90 2.40.30.100
af_Q84J39_168_262_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6708 23 80 2.40.330.10
af_O81778_126_238_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6604 4 85 2.40.330.10
5trdB02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Riboflavin kinase-like 0.6528 7 87 2.40.30.30
ID Description Score Start End GO Terms
AF-A0A6H2BEN3-F1-model_v4 deleted 1.002 3 90
AF-A0A7Y5XV38-F1-model_v4 DUF1905 domain-containing protein 1.001 6 90
AF-A0A6G9CRB0-F1-model_v4 DUF1905 domain-containing protein 1 3 90
AF-A0A542HDS8-F1-model_v4 deleted 1 6 90
AF-A0A7Y9NI26-F1-model_v4 DUF1905 domain-containing protein 0.9999 4 90

Map