F333460
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 221 | 120 | 216 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300026078|Ga0207702_10510215|Ga0207702_105102152 |
| Length | 197 |
| Sequence | MSANYNNSAWFYDKLSVLIYGRVLIDAQVYLLHFIPPSANILIVGGGTGGILEEITRIHSSGLQITYIEIAADMMALSKRRNTGAAIENVPLLAGFDIIITAFLFDNFREQTLSKIFVHLHGLLKTDGLWLNADFQLTGKWWQKLLLKSMFLFFKIVCQIEASRLPDIDRQFEQHGYKVIAEKMFFGDFVISRVYNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 3 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 4 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 5 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 59 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 91 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 92 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 93 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 94 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 95 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 96 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 97 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 98 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 117 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 118 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 119 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 120 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.74 |
| Metatranscriptomes | 0 |
| Isolates | 2.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.79 |
| Nodule | 0 |
| Rhizoplane | 0.45 |
| Rhizosphere | 88.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10045404 | 3300001979 | Bacteria | 1297 |
| 2 | JGI24739J22299_10026941 | 3300001989 | Bacteria | 2012 |
| 3 | JGI24739J22299_10036831 | 3300001989 | Bacteria | 1650 |
| 4 | JGI24737J22298_10002824 | 3300001990 | Bacteria | 6152 |
| 5 | JGI24737J22298_10011035 | 3300001990 | Bacteria | 2967 |
| 6 | JGI24735J21928_10000007 | 3300002067 | Bacteria | 333510 |
| 7 | JGI24744J21845_10002357 | 3300002077 | Bacteria | 3853 |
| 8 | JGI25162J39368_1000258 | 3300002737 | Bacteria | 50724 |
| 9 | rootH1_10064563 | 3300003316 | Bacteria | 19914 |
| 10 | rootH2_10005722 | 3300003320 | Bacteria | 98526 |
| 11 | rootL2_10030660 | 3300003322 | Bacteria | 3002 |
| 12 | rootH1_10125197 | 3300003323 | Bacteria | 1622 |
| 13 | rootH1_10167677 | 3300003323 | Bacteria | 4343 |
| 14 | rootH1_10170080 | 3300003323 | Unclassified | 1582 |
| 15 | Ga0070658_10000060 | 3300005327 | Bacteria | 112561 |
| 16 | Ga0070676_10000379 | 3300005328 | Bacteria | 20605 |
| 17 | Ga0070680_100009363 | 3300005336 | Bacteria | 7525 |
| 18 | Ga0068868_100181090 | 3300005338 | Bacteria | 1748 |
| 19 | Ga0070660_100036977 | 3300005339 | Bacteria | 3700 |
| 20 | Ga0070660_100112136 | 3300005339 | Bacteria | 2171 |
| 21 | Ga0070675_100223276 | 3300005354 | Bacteria | 1641 |
| 22 | Ga0070673_100002736 | 3300005364 | Bacteria | 10822 |
| 23 | Ga0070673_100465230 | 3300005364 | Bacteria | 1139 |
| 24 | Ga0070659_100006505 | 3300005366 | Bacteria | 8434 |
| 25 | Ga0070678_100023309 | 3300005456 | Bacteria | 4123 |
| 26 | Ga0070662_100000087 | 3300005457 | Bacteria | 50586 |
| 27 | Ga0070681_10016091 | 3300005458 | Bacteria | 7456 |
| 28 | Ga0068867_100001240 | 3300005459 | Bacteria | 17574 |
| 29 | Ga0070679_100022395 | 3300005530 | Bacteria | 6176 |
| 30 | Ga0070679_100212823 | 3300005530 | Bacteria | 1896 |
| 31 | Ga0068853_100012565 | 3300005539 | Bacteria | 6889 |
| 32 | Ga0070665_100000264 | 3300005548 | Bacteria | 85867 |
| 33 | Ga0068855_100000149 | 3300005563 | Bacteria | 89273 |
| 34 | Ga0068855_100072767 | 3300005563 | Bacteria | 3994 |
| 35 | Ga0068855_100096053 | 3300005563 | Bacteria | 3416 |
| 36 | Ga0068855_100531394 | 3300005563 | Bacteria | 1275 |
| 37 | Ga0068855_100643613 | 3300005563 | Unclassified | 1139 |
| 38 | Ga0068855_100701568 | 3300005563 | Unclassified | 1083 |
| 39 | Ga0068856_100000120 | 3300005614 | Bacteria | 78280 |
| 40 | Ga0068856_100088949 | 3300005614 | Bacteria | 3071 |
| 41 | Ga0068856_100111011 | 3300005614 | Bacteria | 2739 |
| 42 | Ga0068856_100169830 | 3300005614 | Bacteria | 2193 |
| 43 | Ga0068856_100594010 | 3300005614 | Bacteria | 1128 |
| 44 | Ga0068852_100000389 | 3300005616 | Bacteria | 29439 |
| 45 | Ga0068870_10150518 | 3300005840 | Bacteria | 1370 |
| 46 | Ga0068858_100342836 | 3300005842 | Bacteria | 1430 |
| 47 | Ga0075366_10000344 | 3300006195 | Bacteria | 21320 |
| 48 | Ga0075366_10055890 | 3300006195 | Bacteria | 2344 |
| 49 | Ga0097621_100000232 | 3300006237 | Bacteria | 37391 |
| 50 | Ga0068871_100000800 | 3300006358 | Bacteria | 21155 |
| 51 | Ga0068865_100000510 | 3300006881 | Bacteria | 21693 |
| 52 | Ga0105240_10000200 | 3300009093 | Bacteria | 121941 |
| 53 | Ga0105240_10007404 | 3300009093 | Bacteria | 15955 |
| 54 | Ga0105240_10008463 | 3300009093 | Bacteria | 14714 |
| 55 | Ga0105240_10036086 | 3300009093 | Bacteria | 6364 |
| 56 | Ga0105240_10062388 | 3300009093 | Bacteria | 4640 |
| 57 | Ga0105240_10174199 | 3300009093 | Bacteria | 2545 |
| 58 | Ga0105240_10407890 | 3300009093 | Bacteria | 1529 |
| 59 | Ga0105240_10804755 | 3300009093 | Bacteria | 1018 |
| 60 | Ga0105241_10001408 | 3300009174 | Bacteria | 18413 |
| 61 | Ga0105241_10006234 | 3300009174 | Bacteria | 8792 |
| 62 | Ga0105241_10007543 | 3300009174 | Bacteria | 7998 |
| 63 | Ga0105241_10037605 | 3300009174 | Bacteria | 3647 |
| 64 | Ga0105241_10181902 | 3300009174 | Bacteria | 1744 |
| 65 | Ga0105242_10694174 | 3300009176 | Unclassified | 995 |
| 66 | Ga0105237_10000239 | 3300009545 | Bacteria | 78319 |
| 67 | Ga0105237_10000535 | 3300009545 | Bacteria | 53620 |
| 68 | Ga0105237_10002670 | 3300009545 | Bacteria | 21900 |
| 69 | Ga0105237_10011509 | 3300009545 | Bacteria | 9360 |
| 70 | Ga0105237_10032829 | 3300009545 | Bacteria | 5256 |
| 71 | Ga0105237_10071642 | 3300009545 | Bacteria | 3460 |
| 72 | Ga0105237_10162339 | 3300009545 | Bacteria | 2233 |
| 73 | Ga0105237_10928862 | 3300009545 | Unclassified | 877 |
| 74 | Ga0105238_10380734 | 3300009551 | Bacteria | 1402 |
| 75 | Ga0105239_10000009 | 3300010375 | Bacteria | 361182 |
| 76 | Ga0105239_10000049 | 3300010375 | Bacteria | 177578 |
| 77 | Ga0105239_10000478 | 3300010375 | Bacteria | 58328 |
| 78 | Ga0105239_10001375 | 3300010375 | Bacteria | 32635 |
| 79 | Ga0105239_10002795 | 3300010375 | Bacteria | 21842 |
| 80 | Ga0105239_10022097 | 3300010375 | Bacteria | 7012 |
| 81 | Ga0105239_10074642 | 3300010375 | Bacteria | 3728 |
| 82 | Ga0105239_10140170 | 3300010375 | Bacteria | 2694 |
| 83 | Ga0105246_10103325 | 3300011119 | Bacteria | 2079 |
| 84 | Ga0157373_10002483 | 3300013100 | Bacteria | 14049 |
| 85 | Ga0157373_10123467 | 3300013100 | Bacteria | 1820 |
| 86 | Ga0157371_10000342 | 3300013102 | Bacteria | 59948 |
| 87 | Ga0157371_10070857 | 3300013102 | Bacteria | 2468 |
| 88 | Ga0157370_10177472 | 3300013104 | Bacteria | 1980 |
| 89 | Ga0157369_10140693 | 3300013105 | Bacteria | 2553 |
| 90 | Ga0157369_10232006 | 3300013105 | Bacteria | 1930 |
| 91 | Ga0157369_10266201 | 3300013105 | Bacteria | 1787 |
| 92 | Ga0157374_10001298 | 3300013296 | Bacteria | 21266 |
| 93 | Ga0157374_10004160 | 3300013296 | Bacteria | 12146 |
| 94 | Ga0157374_10033892 | 3300013296 | Bacteria | 4662 |
| 95 | Ga0157374_10052571 | 3300013296 | Bacteria | 3795 |
| 96 | Ga0157374_10143905 | 3300013296 | Bacteria | 2315 |
| 97 | Ga0157374_10900218 | 3300013296 | Bacteria | 902 |
| 98 | Ga0157378_10007809 | 3300013297 | Bacteria | 9339 |
| 99 | Ga0157378_10025066 | 3300013297 | Bacteria | 5253 |
| 100 | Ga0163162_10000008 | 3300013306 | Bacteria | 316194 |
| 101 | Ga0163162_10001653 | 3300013306 | Bacteria | 20900 |
| 102 | Ga0163162_10004414 | 3300013306 | Bacteria | 13540 |
| 103 | Ga0157372_10003547 | 3300013307 | Bacteria | 16808 |
| 104 | Ga0157372_10008722 | 3300013307 | Bacteria | 10768 |
| 105 | Ga0157372_10020857 | 3300013307 | Bacteria | 7074 |
| 106 | Ga0157372_10832023 | 3300013307 | Unclassified | 1072 |
| 107 | Ga0157375_10001485 | 3300013308 | Bacteria | 20130 |
| 108 | Ga0182007_10024229 | 3300015262 | Bacteria | 2125 |
| 109 | Ga0209437_100361 | 3300025233 | Bacteria | 50797 |
| 110 | Ga0209026_1002624 | 3300025250 | Bacteria | 6563 |
| 111 | Ga0209129_1005588 | 3300025258 | Bacteria | 4382 |
| 112 | Ga0209233_1000520 | 3300025261 | Bacteria | 22249 |
| 113 | Ga0209455_1007053 | 3300025272 | Bacteria | 3225 |
| 114 | Ga0207647_10000546 | 3300025904 | Bacteria | 29990 |
| 115 | Ga0207647_10000588 | 3300025904 | Bacteria | 28282 |
| 116 | Ga0207647_10059986 | 3300025904 | Bacteria | 2326 |
| 117 | Ga0207647_10083320 | 3300025904 | Bacteria | 1915 |
| 118 | Ga0207645_10000948 | 3300025907 | Bacteria | 24090 |
| 119 | Ga0207643_10176049 | 3300025908 | Bacteria | 1293 |
| 120 | Ga0207705_10000233 | 3300025909 | Bacteria | 55125 |
| 121 | Ga0207705_10542468 | 3300025909 | Unclassified | 904 |
| 122 | Ga0207654_10002745 | 3300025911 | Bacteria | 8932 |
| 123 | Ga0207654_10040423 | 3300025911 | Bacteria | 2628 |
| 124 | Ga0207654_10062453 | 3300025911 | Bacteria | 2183 |
| 125 | Ga0207654_10105401 | 3300025911 | Bacteria | 1744 |
| 126 | Ga0207707_10014234 | 3300025912 | Bacteria | 6929 |
| 127 | Ga0207695_10000055 | 3300025913 | Bacteria | 382776 |
| 128 | Ga0207695_10002312 | 3300025913 | Bacteria | 28435 |
| 129 | Ga0207695_10014913 | 3300025913 | Bacteria | 9174 |
| 130 | Ga0207695_10024138 | 3300025913 | Bacteria | 6849 |
| 131 | Ga0207695_10047707 | 3300025913 | Bacteria | 4529 |
| 132 | Ga0207671_10000486 | 3300025914 | Bacteria | 53864 |
| 133 | Ga0207671_10003169 | 3300025914 | Bacteria | 16617 |
| 134 | Ga0207671_10023027 | 3300025914 | Bacteria | 4701 |
| 135 | Ga0207671_10131330 | 3300025914 | Bacteria | 1922 |
| 136 | Ga0207660_10003190 | 3300025917 | Bacteria | 10727 |
| 137 | Ga0207657_10019623 | 3300025919 | Bacteria | 6412 |
| 138 | Ga0207657_10156563 | 3300025919 | Bacteria | 1853 |
| 139 | Ga0207652_10045573 | 3300025921 | Bacteria | 3739 |
| 140 | Ga0207694_10673303 | 3300025924 | Bacteria | 872 |
| 141 | Ga0207659_10131866 | 3300025926 | Bacteria | 1930 |
| 142 | Ga0207690_10017824 | 3300025932 | Bacteria | 4345 |
| 143 | Ga0207706_10000013 | 3300025933 | Bacteria | 188236 |
| 144 | Ga0207686_10522531 | 3300025934 | Bacteria | 924 |
| 145 | Ga0207704_10000015 | 3300025938 | Bacteria | 163572 |
| 146 | Ga0207667_10000496 | 3300025949 | Bacteria | 51954 |
| 147 | Ga0207667_10022904 | 3300025949 | Bacteria | 6887 |
| 148 | Ga0207667_10052574 | 3300025949 | Bacteria | 4289 |
| 149 | Ga0207667_10324196 | 3300025949 | Bacteria | 1573 |
| 150 | Ga0207667_10468040 | 3300025949 | Bacteria | 1280 |
| 151 | Ga0207667_10893364 | 3300025949 | Unclassified | 881 |
| 152 | Ga0207651_10417137 | 3300025960 | Bacteria | 1145 |
| 153 | Ga0207640_10008780 | 3300025981 | Bacteria | 5626 |
| 154 | Ga0207677_10193698 | 3300026023 | Bacteria | 1610 |
| 155 | Ga0207703_10017187 | 3300026035 | Bacteria | 5644 |
| 156 | Ga0207639_10007478 | 3300026041 | Bacteria | 7452 |
| 157 | Ga0207639_10010733 | 3300026041 | Bacteria | 6345 |
| 158 | Ga0207702_10000195 | 3300026078 | Bacteria | 71757 |
| 159 | Ga0207702_10010514 | 3300026078 | Bacteria | 7739 |
| 160 | Ga0207702_10037643 | 3300026078 | Bacteria | 4050 |
| 161 | Ga0207702_10510215 | 3300026078 | Bacteria | 1173 |
| 162 | Ga0207648_10009896 | 3300026089 | Bacteria | 9088 |
| 163 | Ga0207683_10006713 | 3300026121 | Bacteria | 9846 |
| 164 | Ga0268266_10000268 | 3300028379 | Bacteria | 85976 |
| 165 | Ga0265327_10175675 | 3300031251 | Bacteria | 982 |
| 166 | Ga0307509_10145762 | 3300031507 | Bacteria | 2294 |
| 167 | Ga0395899_0048207 | 3300037312 | Bacteria | 3171 |
| 168 | Ga0395900_0002139 | 3300037418 | Bacteria | 22114 |
| 169 | Ga0395900_0006696 | 3300037418 | Bacteria | 11971 |
| 170 | Ga0395900_0031521 | 3300037418 | Bacteria | 5448 |
| 171 | Ga0395900_0230690 | 3300037418 | Bacteria | 1862 |
| 172 | Ga0395898_0018916 | 3300037466 | Bacteria | 7018 |
| 173 | Ga0395898_0106648 | 3300037466 | Bacteria | 2687 |
| 174 | Ga0395898_0665997 | 3300037466 | Bacteria | 983 |
| 175 | Ga0395905_0000973 | 3300037471 | Bacteria | 36728 |
| 176 | Ga0395905_0008395 | 3300037471 | Bacteria | 10184 |
| 177 | Ga0395905_0712176 | 3300037471 | Bacteria | 906 |
| 178 | Ga0395901_0048840 | 3300038443 | Bacteria | 4395 |
| 179 | Ga0395901_0061272 | 3300038443 | Bacteria | 3915 |
| 180 | Ga0395901_0216346 | 3300038443 | Bacteria | 2004 |
| 181 | Ga0436361_0980329 | 3300039447 | Bacteria | 4074 |
| 182 | Ga0439448_0004560 | 3300042005 | Bacteria | 3912 |
| 183 | Ga0495638_0296008 | 3300046460 | Bacteria | 873 |
| 184 | Ga0495651_0053211 | 3300046462 | Bacteria | 3118 |
| 185 | Ga0495583_0098319 | 3300046506 | Bacteria | 1251 |
| 186 | Ga0495606_0000034 | 3300046507 | Bacteria | 247705 |
| 187 | Ga0495606_0009021 | 3300046507 | Bacteria | 8523 |
| 188 | Ga0495610_0001483 | 3300046512 | Bacteria | 20663 |
| 189 | Ga0495616_0019482 | 3300046513 | Bacteria | 3702 |
| 190 | Ga0495648_0032988 | 3300046524 | Bacteria | 3389 |
| 191 | Ga0495652_0182009 | 3300046529 | Bacteria | 1612 |
| 192 | Ga0495652_0221888 | 3300046529 | Bacteria | 1420 |
| 193 | Ga0495609_0175208 | 3300046538 | Bacteria | 904 |
| 194 | Ga0495625_0056873 | 3300046660 | Bacteria | 2783 |
| 195 | Ga0495625_0150832 | 3300046660 | Bacteria | 1563 |
| 196 | Ga0495661_0005466 | 3300046665 | Bacteria | 9014 |
| 197 | Ga0495671_0064577 | 3300046692 | Bacteria | 1802 |
| 198 | Ga0495649_0000014 | 3300046694 | Bacteria | 287408 |
| 199 | Ga0495683_0006705 | 3300047323 | Bacteria | 6271 |
| 200 | Ga0495687_003250 | 3300047443 | Bacteria | 11988 |
| 201 | Ga0495687_078971 | 3300047443 | Bacteria | 1295 |
| 202 | Ga0495687_134399 | 3300047443 | Bacteria | 870 |
| 203 | Ga0495687_134996 | 3300047443 | Bacteria | 867 |
| 204 | Ga0495673_0029306 | 3300047469 | Bacteria | 2599 |
| 205 | Ga0495686_0000112 | 3300047472 | Bacteria | 168354 |
| 206 | Ga0495686_0000319 | 3300047472 | Bacteria | 79929 |
| 207 | Ga0495686_0219800 | 3300047472 | Bacteria | 1081 |
| 208 | Ga0495678_002573 | 3300049459 | Bacteria | 12146 |
| 209 | nmdc:mga0k408_134740_c1 | 3300050493 | Bacteria | 1467 |
| 210 | nmdc:mga0k408_281_c2 | 3300050493 | Bacteria | 21573 |
| 211 | nmdc:mga0k408_313052_c1 | 3300050493 | Unclassified | 937 |
| 212 | nmdc:mga0k408_53220_c1 | 3300050493 | Bacteria | 1056 |
| 213 | nmdc:mga07m45_393793_c1 | 3300050496 | Bacteria | 804 |
| 214 | Ga0500608_000282 | 3300053122 | Bacteria | 19738 |
| 215 | Ga0500624_000621 | 3300053157 | Bacteria | 9532 |
| 216 | Ga0500634_0049181 | 3300053161 | Bacteria | 2274 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046660 | Ga0495625_0150832 | Ga0495625_0150832_1004_1552 | 176 |
| 2 | 3300038443 | Ga0395901_0048840 | Ga0395901_0048840_52_597 | 179 |
| 3 | 3300013296 | Ga0157374_10143905 | Ga0157374_101439052 | 181 |
| 4 | 3300046506 | Ga0495583_0098319 | Ga0495583_0098319_671_1240 | 189 |
| 5 | 3300003323 | rootH1_10167677 | rootH1_101676772 | 190 |
| 6 | 3300050493 | nmdc:mga0k408_313052_c1 | nmdc:mga0k408_313052_c1_338_910 | 190 |
| 7 | 3300005614 | Ga0068856_100594010 | Ga0068856_1005940102 | 197 |
| 8 | 3300026078 | Ga0207702_10510215 | Ga0207702_105102152 | 197 |
| 9 | 3300005840 | Ga0068870_10150518 | Ga0068870_101505182 | 200 |
| 10 | 3300009093 | Ga0105240_10008463 | Ga0105240_100084634 | 200 |
| 11 | 3300025908 | Ga0207643_10176049 | Ga0207643_101760491 | 200 |
| 12 | 3300025913 | Ga0207695_10024138 | Ga0207695_100241384 | 200 |
| 13 | 3300025949 | Ga0207667_10052574 | Ga0207667_100525742 | 200 |
| 14 | iso_pu_bacteria | 2919437846 | 2919440293 | 201 |
| 15 | iso_pu_bacteria | 2599185184 | 2599479774 | 203 |
| 16 | iso_pu_bacteria | 2928078545 | 2928083667 | 203 |
| 17 | iso_pu_bacteria | 2928147474 | 2928152109 | 203 |
| 18 | iso_pu_bacteria | 2932082852 | 2932087001 | 203 |
| 19 | 3300005336 | Ga0070680_100009363 | Ga0070680_1000093633 | 205 |
| 20 | 3300005338 | Ga0068868_100181090 | Ga0068868_1001810902 | 205 |
| 21 | 3300005339 | Ga0070660_100112136 | Ga0070660_1001121361 | 205 |
| 22 | 3300005364 | Ga0070673_100465230 | Ga0070673_1004652302 | 205 |
| 23 | 3300005457 | Ga0070662_100000087 | Ga0070662_10000008735 | 205 |
| 24 | 3300005458 | Ga0070681_10016091 | Ga0070681_100160913 | 205 |
| 25 | 3300005530 | Ga0070679_100022395 | Ga0070679_1000223954 | 205 |
| 26 | 3300005563 | Ga0068855_100531394 | Ga0068855_1005313942 | 205 |
| 27 | 3300005563 | Ga0068855_100643613 | Ga0068855_1006436132 | 205 |
| 28 | 3300005614 | Ga0068856_100169830 | Ga0068856_1001698302 | 205 |
| 29 | 3300005842 | Ga0068858_100342836 | Ga0068858_1003428362 | 205 |
| 30 | 3300006195 | Ga0075366_10000344 | Ga0075366_100003447 | 205 |
| 31 | 3300009093 | Ga0105240_10007404 | Ga0105240_100074042 | 205 |
| 32 | 3300009093 | Ga0105240_10174199 | Ga0105240_101741993 | 205 |
| 33 | 3300009093 | Ga0105240_10407890 | Ga0105240_104078902 | 205 |
| 34 | 3300009093 | Ga0105240_10804755 | Ga0105240_108047551 | 205 |
| 35 | 3300009174 | Ga0105241_10007543 | Ga0105241_100075432 | 205 |
| 36 | 3300009545 | Ga0105237_10071642 | Ga0105237_100716423 | 205 |
| 37 | 3300009545 | Ga0105237_10162339 | Ga0105237_101623391 | 205 |
| 38 | 3300010375 | Ga0105239_10000049 | Ga0105239_1000004910 | 205 |
| 39 | 3300010375 | Ga0105239_10002795 | Ga0105239_1000279511 | 205 |
| 40 | 3300010375 | Ga0105239_10140170 | Ga0105239_101401701 | 205 |
| 41 | 3300011119 | Ga0105246_10103325 | Ga0105246_101033252 | 205 |
| 42 | 3300013100 | Ga0157373_10123467 | Ga0157373_101234672 | 205 |
| 43 | 3300013105 | Ga0157369_10232006 | Ga0157369_102320062 | 205 |
| 44 | 3300013296 | Ga0157374_10033892 | Ga0157374_100338926 | 205 |
| 45 | 3300013307 | Ga0157372_10020857 | Ga0157372_100208577 | 205 |
| 46 | 3300013308 | Ga0157375_10001485 | Ga0157375_1000148516 | 205 |
| 47 | 3300015262 | Ga0182007_10024229 | Ga0182007_100242291 | 205 |
| 48 | 3300025272 | Ga0209455_1007053 | Ga0209455_10070532 | 205 |
| 49 | 3300025904 | Ga0207647_10000546 | Ga0207647_1000054625 | 205 |
| 50 | 3300025911 | Ga0207654_10040423 | Ga0207654_100404232 | 205 |
| 51 | 3300025912 | Ga0207707_10014234 | Ga0207707_100142346 | 205 |
| 52 | 3300025913 | Ga0207695_10002312 | Ga0207695_1000231221 | 205 |
| 53 | 3300025917 | Ga0207660_10003190 | Ga0207660_100031909 | 205 |
| 54 | 3300025919 | Ga0207657_10156563 | Ga0207657_101565632 | 205 |
| 55 | 3300025933 | Ga0207706_10000013 | Ga0207706_1000001343 | 205 |
| 56 | 3300025949 | Ga0207667_10468040 | Ga0207667_104680402 | 205 |
| 57 | 3300025949 | Ga0207667_10893364 | Ga0207667_108933641 | 205 |
| 58 | 3300025960 | Ga0207651_10417137 | Ga0207651_104171372 | 205 |
| 59 | 3300026023 | Ga0207677_10193698 | Ga0207677_101936982 | 205 |
| 60 | 3300046513 | Ga0495616_0019482 | Ga0495616_0019482_2517_3134 | 205 |
| 61 | 3300047443 | Ga0495687_078971 | Ga0495687_078971_579_1196 | 205 |
| 62 | 3300050493 | nmdc:mga0k408_134740_c1 | nmdc:mga0k408_134740_c1_668_1285 | 205 |
| 63 | 3300050493 | nmdc:mga0k408_281_c2 | nmdc:mga0k408_281_c2_6048_6665 | 205 |
| 64 | 3300050496 | nmdc:mga07m45_393793_c1 | nmdc:mga07m45_393793_c1_110_727 | 205 |
| 65 | 3300053122 | Ga0500608_000282 | Ga0500608_000282_7133_7750 | 205 |
| 66 | 3300053157 | Ga0500624_000621 | Ga0500624_000621_5116_5733 | 205 |
| 67 | 3300053161 | Ga0500634_0049181 | Ga0500634_0049181_233_850 | 205 |
| 68 | 3300003323 | rootH1_10125197 | rootH1_101251972 | 206 |
| 69 | 3300005327 | Ga0070658_10000060 | Ga0070658_1000006054 | 206 |
| 70 | 3300005339 | Ga0070660_100036977 | Ga0070660_1000369772 | 206 |
| 71 | 3300005614 | Ga0068856_100000120 | Ga0068856_10000012061 | 206 |
| 72 | 3300005614 | Ga0068856_100111011 | Ga0068856_1001110111 | 206 |
| 73 | 3300009093 | Ga0105240_10062388 | Ga0105240_100623884 | 206 |
| 74 | 3300009174 | Ga0105241_10181902 | Ga0105241_101819022 | 206 |
| 75 | 3300009545 | Ga0105237_10002670 | Ga0105237_100026701 | 206 |
| 76 | 3300009545 | Ga0105237_10928862 | Ga0105237_109288622 | 206 |
| 77 | 3300010375 | Ga0105239_10000009 | Ga0105239_10000009254 | 206 |
| 78 | 3300013306 | Ga0163162_10001653 | Ga0163162_1000165316 | 206 |
| 79 | 3300025909 | Ga0207705_10000233 | Ga0207705_1000023354 | 206 |
| 80 | 3300025911 | Ga0207654_10105401 | Ga0207654_101054012 | 206 |
| 81 | 3300025913 | Ga0207695_10047707 | Ga0207695_100477074 | 206 |
| 82 | 3300025914 | Ga0207671_10003169 | Ga0207671_1000316910 | 206 |
| 83 | 3300025919 | Ga0207657_10019623 | Ga0207657_100196233 | 206 |
| 84 | 3300026078 | Ga0207702_10000195 | Ga0207702_100001959 | 206 |
| 85 | 3300026078 | Ga0207702_10010514 | Ga0207702_100105148 | 206 |
| 86 | 3300037418 | Ga0395900_0002139 | Ga0395900_0002139_20079_20699 | 206 |
| 87 | 3300037418 | Ga0395900_0230690 | Ga0395900_0230690_795_1415 | 206 |
| 88 | 3300046462 | Ga0495651_0053211 | Ga0495651_0053211_722_1342 | 206 |
| 89 | 3300046507 | Ga0495606_0000034 | Ga0495606_0000034_156027_156647 | 206 |
| 90 | 3300046512 | Ga0495610_0001483 | Ga0495610_0001483_16568_17188 | 206 |
| 91 | 3300046529 | Ga0495652_0221888 | Ga0495652_0221888_193_813 | 206 |
| 92 | 3300046538 | Ga0495609_0175208 | Ga0495609_0175208_151_771 | 206 |
| 93 | 3300046665 | Ga0495661_0005466 | Ga0495661_0005466_7186_7806 | 206 |
| 94 | 3300046692 | Ga0495671_0064577 | Ga0495671_0064577_294_914 | 206 |
| 95 | 3300046694 | Ga0495649_0000014 | Ga0495649_0000014_106326_106946 | 206 |
| 96 | 3300047443 | Ga0495687_003250 | Ga0495687_003250_207_827 | 206 |
| 97 | 3300047469 | Ga0495673_0029306 | Ga0495673_0029306_236_856 | 206 |
| 98 | 3300049459 | Ga0495678_002573 | Ga0495678_002573_3151_3771 | 206 |
| 99 | 3300001979 | JGI24740J21852_10045404 | JGI24740J21852_100454042 | 207 |
| 100 | 3300001989 | JGI24739J22299_10026941 | JGI24739J22299_100269412 | 207 |
| 101 | 3300001989 | JGI24739J22299_10036831 | JGI24739J22299_100368312 | 207 |
| 102 | 3300001990 | JGI24737J22298_10002824 | JGI24737J22298_100028244 | 207 |
| 103 | 3300001990 | JGI24737J22298_10011035 | JGI24737J22298_100110353 | 207 |
| 104 | 3300002067 | JGI24735J21928_10000007 | JGI24735J21928_10000007186 | 207 |
| 105 | 3300002077 | JGI24744J21845_10002357 | JGI24744J21845_100023574 | 207 |
| 106 | 3300002737 | JGI25162J39368_1000258 | JGI25162J39368_100025841 | 207 |
| 107 | 3300003316 | rootH1_10064563 | rootH1_100645635 | 207 |
| 108 | 3300003320 | rootH2_10005722 | rootH2_1000572224 | 207 |
| 109 | 3300003322 | rootL2_10030660 | rootL2_100306602 | 207 |
| 110 | 3300003323 | rootH1_10170080 | rootH1_101700802 | 207 |
| 111 | 3300005328 | Ga0070676_10000379 | Ga0070676_100003796 | 207 |
| 112 | 3300005354 | Ga0070675_100223276 | Ga0070675_1002232762 | 207 |
| 113 | 3300005364 | Ga0070673_100002736 | Ga0070673_1000027369 | 207 |
| 114 | 3300005366 | Ga0070659_100006505 | Ga0070659_1000065053 | 207 |
| 115 | 3300005456 | Ga0070678_100023309 | Ga0070678_1000233093 | 207 |
| 116 | 3300005459 | Ga0068867_100001240 | Ga0068867_1000012409 | 207 |
| 117 | 3300005530 | Ga0070679_100212823 | Ga0070679_1002128232 | 207 |
| 118 | 3300005539 | Ga0068853_100012565 | Ga0068853_1000125653 | 207 |
| 119 | 3300005548 | Ga0070665_100000264 | Ga0070665_10000026468 | 207 |
| 120 | 3300005563 | Ga0068855_100000149 | Ga0068855_10000014912 | 207 |
| 121 | 3300005563 | Ga0068855_100072767 | Ga0068855_1000727674 | 207 |
| 122 | 3300005563 | Ga0068855_100096053 | Ga0068855_1000960532 | 207 |
| 123 | 3300005563 | Ga0068855_100701568 | Ga0068855_1007015681 | 207 |
| 124 | 3300005614 | Ga0068856_100088949 | Ga0068856_1000889492 | 207 |
| 125 | 3300005616 | Ga0068852_100000389 | Ga0068852_1000003899 | 207 |
| 126 | 3300006195 | Ga0075366_10055890 | Ga0075366_100558903 | 207 |
| 127 | 3300006237 | Ga0097621_100000232 | Ga0097621_10000023214 | 207 |
| 128 | 3300006358 | Ga0068871_100000800 | Ga0068871_10000080022 | 207 |
| 129 | 3300006881 | Ga0068865_100000510 | Ga0068865_10000051014 | 207 |
| 130 | 3300009093 | Ga0105240_10000200 | Ga0105240_1000020051 | 207 |
| 131 | 3300009093 | Ga0105240_10036086 | Ga0105240_100360863 | 207 |
| 132 | 3300009174 | Ga0105241_10001408 | Ga0105241_100014089 | 207 |
| 133 | 3300009174 | Ga0105241_10006234 | Ga0105241_100062347 | 207 |
| 134 | 3300009174 | Ga0105241_10037605 | Ga0105241_100376053 | 207 |
| 135 | 3300009176 | Ga0105242_10694174 | Ga0105242_106941742 | 207 |
| 136 | 3300009545 | Ga0105237_10000239 | Ga0105237_100002395 | 207 |
| 137 | 3300009545 | Ga0105237_10000535 | Ga0105237_1000053533 | 207 |
| 138 | 3300009545 | Ga0105237_10011509 | Ga0105237_100115099 | 207 |
| 139 | 3300009545 | Ga0105237_10032829 | Ga0105237_100328294 | 207 |
| 140 | 3300009551 | Ga0105238_10380734 | Ga0105238_103807341 | 207 |
| 141 | 3300010375 | Ga0105239_10000478 | Ga0105239_1000047813 | 207 |
| 142 | 3300010375 | Ga0105239_10001375 | Ga0105239_100013754 | 207 |
| 143 | 3300010375 | Ga0105239_10022097 | Ga0105239_100220974 | 207 |
| 144 | 3300010375 | Ga0105239_10074642 | Ga0105239_100746424 | 207 |
| 145 | 3300013100 | Ga0157373_10002483 | Ga0157373_100024837 | 207 |
| 146 | 3300013102 | Ga0157371_10000342 | Ga0157371_100003424 | 207 |
| 147 | 3300013102 | Ga0157371_10070857 | Ga0157371_100708572 | 207 |
| 148 | 3300013104 | Ga0157370_10177472 | Ga0157370_101774722 | 207 |
| 149 | 3300013105 | Ga0157369_10140693 | Ga0157369_101406933 | 207 |
| 150 | 3300013105 | Ga0157369_10266201 | Ga0157369_102662012 | 207 |
| 151 | 3300013296 | Ga0157374_10001298 | Ga0157374_100012986 | 207 |
| 152 | 3300013296 | Ga0157374_10004160 | Ga0157374_100041609 | 207 |
| 153 | 3300013296 | Ga0157374_10052571 | Ga0157374_100525713 | 207 |
| 154 | 3300013296 | Ga0157374_10900218 | Ga0157374_109002181 | 207 |
| 155 | 3300013297 | Ga0157378_10007809 | Ga0157378_100078098 | 207 |
| 156 | 3300013297 | Ga0157378_10025066 | Ga0157378_100250665 | 207 |
| 157 | 3300013306 | Ga0163162_10000008 | Ga0163162_10000008126 | 207 |
| 158 | 3300013306 | Ga0163162_10004414 | Ga0163162_1000441410 | 207 |
| 159 | 3300013307 | Ga0157372_10003547 | Ga0157372_100035473 | 207 |
| 160 | 3300013307 | Ga0157372_10008722 | Ga0157372_100087229 | 207 |
| 161 | 3300013307 | Ga0157372_10832023 | Ga0157372_108320232 | 207 |
| 162 | 3300025233 | Ga0209437_100361 | Ga0209437_1003612 | 207 |
| 163 | 3300025250 | Ga0209026_1002624 | Ga0209026_10026247 | 207 |
| 164 | 3300025258 | Ga0209129_1005588 | Ga0209129_10055884 | 207 |
| 165 | 3300025261 | Ga0209233_1000520 | Ga0209233_100052020 | 207 |
| 166 | 3300025904 | Ga0207647_10000588 | Ga0207647_100005881 | 207 |
| 167 | 3300025904 | Ga0207647_10059986 | Ga0207647_100599863 | 207 |
| 168 | 3300025904 | Ga0207647_10083320 | Ga0207647_100833202 | 207 |
| 169 | 3300025907 | Ga0207645_10000948 | Ga0207645_100009482 | 207 |
| 170 | 3300025909 | Ga0207705_10542468 | Ga0207705_105424681 | 207 |
| 171 | 3300025911 | Ga0207654_10002745 | Ga0207654_100027454 | 207 |
| 172 | 3300025911 | Ga0207654_10062453 | Ga0207654_100624532 | 207 |
| 173 | 3300025913 | Ga0207695_10000055 | Ga0207695_1000005551 | 207 |
| 174 | 3300025913 | Ga0207695_10014913 | Ga0207695_100149132 | 207 |
| 175 | 3300025914 | Ga0207671_10000486 | Ga0207671_1000048631 | 207 |
| 176 | 3300025914 | Ga0207671_10023027 | Ga0207671_100230272 | 207 |
| 177 | 3300025914 | Ga0207671_10131330 | Ga0207671_101313301 | 207 |
| 178 | 3300025921 | Ga0207652_10045573 | Ga0207652_100455734 | 207 |
| 179 | 3300025924 | Ga0207694_10673303 | Ga0207694_106733032 | 207 |
| 180 | 3300025926 | Ga0207659_10131866 | Ga0207659_101318662 | 207 |
| 181 | 3300025932 | Ga0207690_10017824 | Ga0207690_100178244 | 207 |
| 182 | 3300025934 | Ga0207686_10522531 | Ga0207686_105225312 | 207 |
| 183 | 3300025938 | Ga0207704_10000015 | Ga0207704_10000015114 | 207 |
| 184 | 3300025949 | Ga0207667_10000496 | Ga0207667_1000049612 | 207 |
| 185 | 3300025949 | Ga0207667_10022904 | Ga0207667_100229044 | 207 |
| 186 | 3300025949 | Ga0207667_10324196 | Ga0207667_103241962 | 207 |
| 187 | 3300025981 | Ga0207640_10008780 | Ga0207640_100087806 | 207 |
| 188 | 3300026035 | Ga0207703_10017187 | Ga0207703_100171875 | 207 |
| 189 | 3300026041 | Ga0207639_10007478 | Ga0207639_100074784 | 207 |
| 190 | 3300026041 | Ga0207639_10010733 | Ga0207639_100107335 | 207 |
| 191 | 3300026078 | Ga0207702_10037643 | Ga0207702_100376432 | 207 |
| 192 | 3300026089 | Ga0207648_10009896 | Ga0207648_100098968 | 207 |
| 193 | 3300026121 | Ga0207683_10006713 | Ga0207683_100067136 | 207 |
| 194 | 3300028379 | Ga0268266_10000268 | Ga0268266_1000026867 | 207 |
| 195 | 3300031251 | Ga0265327_10175675 | Ga0265327_101756752 | 207 |
| 196 | 3300031507 | Ga0307509_10145762 | Ga0307509_101457622 | 207 |
| 197 | 3300037312 | Ga0395899_0048207 | Ga0395899_0048207_1041_1667 | 207 |
| 198 | 3300037418 | Ga0395900_0006696 | Ga0395900_0006696_5644_6270 | 207 |
| 199 | 3300037418 | Ga0395900_0031521 | Ga0395900_0031521_1363_1992 | 207 |
| 200 | 3300037466 | Ga0395898_0018916 | Ga0395898_0018916_4600_5229 | 207 |
| 201 | 3300037466 | Ga0395898_0106648 | Ga0395898_0106648_2051_2677 | 207 |
| 202 | 3300037466 | Ga0395898_0665997 | Ga0395898_0665997_25_648 | 207 |
| 203 | 3300037471 | Ga0395905_0000973 | Ga0395905_0000973_22680_23306 | 207 |
| 204 | 3300037471 | Ga0395905_0008395 | Ga0395905_0008395_3799_4428 | 207 |
| 205 | 3300037471 | Ga0395905_0712176 | Ga0395905_0712176_263_886 | 207 |
| 206 | 3300038443 | Ga0395901_0061272 | Ga0395901_0061272_300_926 | 207 |
| 207 | 3300038443 | Ga0395901_0216346 | Ga0395901_0216346_144_767 | 207 |
| 208 | 3300039447 | Ga0436361_0980329 | Ga0436361_0980329_2671_3300 | 207 |
| 209 | 3300042005 | Ga0439448_0004560 | Ga0439448_0004560_1250_1879 | 207 |
| 210 | 3300046460 | Ga0495638_0296008 | Ga0495638_0296008_117_743 | 207 |
| 211 | 3300046507 | Ga0495606_0009021 | Ga0495606_0009021_449_1075 | 207 |
| 212 | 3300046524 | Ga0495648_0032988 | Ga0495648_0032988_873_1511 | 207 |
| 213 | 3300046529 | Ga0495652_0182009 | Ga0495652_0182009_866_1489 | 207 |
| 214 | 3300046660 | Ga0495625_0056873 | Ga0495625_0056873_803_1426 | 207 |
| 215 | 3300047323 | Ga0495683_0006705 | Ga0495683_0006705_5244_5885 | 207 |
| 216 | 3300047443 | Ga0495687_134399 | Ga0495687_134399_131_760 | 207 |
| 217 | 3300047443 | Ga0495687_134996 | Ga0495687_134996_131_757 | 207 |
| 218 | 3300047472 | Ga0495686_0000112 | Ga0495686_0000112_44853_45485 | 207 |
| 219 | 3300047472 | Ga0495686_0000319 | Ga0495686_0000319_49246_49872 | 207 |
| 220 | 3300047472 | Ga0495686_0219800 | Ga0495686_0219800_76_702 | 207 |
| 221 | 3300050493 | nmdc:mga0k408_53220_c1 | nmdc:mga0k408_53220_c1_221_847 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wlf-assembly1.cif.gz_A | phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus | 0.8184 | 22 | 148 |
| 6wlf-assembly2.cif.gz_B | phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus | 0.8169 | 22 | 148 |
| 6p3o-assembly1.cif.gz_A-2 | tetrahydroprotoberberine n-methyltransferase in complex with (s)-cis-n-methylstylopine and s-adenosylhomocysteine | 0.8006 | 27 | 142 |
| 6p3n-assembly1.cif.gz_A-2 | tetrahydroprotoberberine n-methyltransferase in complex with s-adenosylmethionine | 0.7947 | 27 | 142 |
| 5kpg-assembly1.cif.gz_A | pavine n-methyltransferase in complex with s-adenosylhomocysteine ph 7 | 0.7871 | 21 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6HKL4_97_377_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8306 | 29 | 143 | 3.40.50.150 |
| af_K7KE15_1_124_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8298 | 29 | 148 | 3.40.50.150 |
| af_Q6EQW4_99_328_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8139 | 29 | 79 | 3.40.50.150 |
| af_D3ZQ63_181_335_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8059 | 41 | 151 | 3.40.50.150 |
| af_K7KE15_1_124_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7997 | 29 | 148 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5D8YRZ5-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9821 | 4 | 205 |
GO:0008168
GO:0032259 |
| AF-A0A4Q3F895-F1-model_v4 | Methyltransferase domain-containing protein | 0.9702 | 1 | 207 |
GO:0008168
GO:0032259 |
| AF-A0A3D8Y3Y6-F1-model_v4 | Methyltransferase type 12 | 0.9685 | 1 | 207 |
GO:0008168
GO:0032259 |
| AF-A0A512B7I2-F1-model_v4 | Methyltransferase domain-containing protein | 0.968 | 1 | 206 |
|
| AF-A0A4U6D0P9-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9675 | 1 | 207 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar