F333460

General Info

Members Datasets Scaffolds Average Seq Length
221 120 216 207

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10510215|Ga0207702_105102152
Length 197
Sequence MSANYNNSAWFYDKLSVLIYGRVLIDAQVYLLHFIPPSANILIVGGGTGGILEEITRIHSSGLQITYIEIAADMMALSKRRNTGAAIENVPLLAGFDIIITAFLFDNFREQTLSKIFVHLHGLLKTDGLWLNADFQLTGKWWQKLLLKSMFLFFKIVCQIEASRLPDIDRQFEQHGYKVIAEKMFFGDFVISRVYNR

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
112 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
119 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
120 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 0
Rhizoplane 0.45
Rhizosphere 88.24
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10045404 3300001979 Bacteria 1297
2 JGI24739J22299_10026941 3300001989 Bacteria 2012
3 JGI24739J22299_10036831 3300001989 Bacteria 1650
4 JGI24737J22298_10002824 3300001990 Bacteria 6152
5 JGI24737J22298_10011035 3300001990 Bacteria 2967
6 JGI24735J21928_10000007 3300002067 Bacteria 333510
7 JGI24744J21845_10002357 3300002077 Bacteria 3853
8 JGI25162J39368_1000258 3300002737 Bacteria 50724
9 rootH1_10064563 3300003316 Bacteria 19914
10 rootH2_10005722 3300003320 Bacteria 98526
11 rootL2_10030660 3300003322 Bacteria 3002
12 rootH1_10125197 3300003323 Bacteria 1622
13 rootH1_10167677 3300003323 Bacteria 4343
14 rootH1_10170080 3300003323 Unclassified 1582
15 Ga0070658_10000060 3300005327 Bacteria 112561
16 Ga0070676_10000379 3300005328 Bacteria 20605
17 Ga0070680_100009363 3300005336 Bacteria 7525
18 Ga0068868_100181090 3300005338 Bacteria 1748
19 Ga0070660_100036977 3300005339 Bacteria 3700
20 Ga0070660_100112136 3300005339 Bacteria 2171
21 Ga0070675_100223276 3300005354 Bacteria 1641
22 Ga0070673_100002736 3300005364 Bacteria 10822
23 Ga0070673_100465230 3300005364 Bacteria 1139
24 Ga0070659_100006505 3300005366 Bacteria 8434
25 Ga0070678_100023309 3300005456 Bacteria 4123
26 Ga0070662_100000087 3300005457 Bacteria 50586
27 Ga0070681_10016091 3300005458 Bacteria 7456
28 Ga0068867_100001240 3300005459 Bacteria 17574
29 Ga0070679_100022395 3300005530 Bacteria 6176
30 Ga0070679_100212823 3300005530 Bacteria 1896
31 Ga0068853_100012565 3300005539 Bacteria 6889
32 Ga0070665_100000264 3300005548 Bacteria 85867
33 Ga0068855_100000149 3300005563 Bacteria 89273
34 Ga0068855_100072767 3300005563 Bacteria 3994
35 Ga0068855_100096053 3300005563 Bacteria 3416
36 Ga0068855_100531394 3300005563 Bacteria 1275
37 Ga0068855_100643613 3300005563 Unclassified 1139
38 Ga0068855_100701568 3300005563 Unclassified 1083
39 Ga0068856_100000120 3300005614 Bacteria 78280
40 Ga0068856_100088949 3300005614 Bacteria 3071
41 Ga0068856_100111011 3300005614 Bacteria 2739
42 Ga0068856_100169830 3300005614 Bacteria 2193
43 Ga0068856_100594010 3300005614 Bacteria 1128
44 Ga0068852_100000389 3300005616 Bacteria 29439
45 Ga0068870_10150518 3300005840 Bacteria 1370
46 Ga0068858_100342836 3300005842 Bacteria 1430
47 Ga0075366_10000344 3300006195 Bacteria 21320
48 Ga0075366_10055890 3300006195 Bacteria 2344
49 Ga0097621_100000232 3300006237 Bacteria 37391
50 Ga0068871_100000800 3300006358 Bacteria 21155
51 Ga0068865_100000510 3300006881 Bacteria 21693
52 Ga0105240_10000200 3300009093 Bacteria 121941
53 Ga0105240_10007404 3300009093 Bacteria 15955
54 Ga0105240_10008463 3300009093 Bacteria 14714
55 Ga0105240_10036086 3300009093 Bacteria 6364
56 Ga0105240_10062388 3300009093 Bacteria 4640
57 Ga0105240_10174199 3300009093 Bacteria 2545
58 Ga0105240_10407890 3300009093 Bacteria 1529
59 Ga0105240_10804755 3300009093 Bacteria 1018
60 Ga0105241_10001408 3300009174 Bacteria 18413
61 Ga0105241_10006234 3300009174 Bacteria 8792
62 Ga0105241_10007543 3300009174 Bacteria 7998
63 Ga0105241_10037605 3300009174 Bacteria 3647
64 Ga0105241_10181902 3300009174 Bacteria 1744
65 Ga0105242_10694174 3300009176 Unclassified 995
66 Ga0105237_10000239 3300009545 Bacteria 78319
67 Ga0105237_10000535 3300009545 Bacteria 53620
68 Ga0105237_10002670 3300009545 Bacteria 21900
69 Ga0105237_10011509 3300009545 Bacteria 9360
70 Ga0105237_10032829 3300009545 Bacteria 5256
71 Ga0105237_10071642 3300009545 Bacteria 3460
72 Ga0105237_10162339 3300009545 Bacteria 2233
73 Ga0105237_10928862 3300009545 Unclassified 877
74 Ga0105238_10380734 3300009551 Bacteria 1402
75 Ga0105239_10000009 3300010375 Bacteria 361182
76 Ga0105239_10000049 3300010375 Bacteria 177578
77 Ga0105239_10000478 3300010375 Bacteria 58328
78 Ga0105239_10001375 3300010375 Bacteria 32635
79 Ga0105239_10002795 3300010375 Bacteria 21842
80 Ga0105239_10022097 3300010375 Bacteria 7012
81 Ga0105239_10074642 3300010375 Bacteria 3728
82 Ga0105239_10140170 3300010375 Bacteria 2694
83 Ga0105246_10103325 3300011119 Bacteria 2079
84 Ga0157373_10002483 3300013100 Bacteria 14049
85 Ga0157373_10123467 3300013100 Bacteria 1820
86 Ga0157371_10000342 3300013102 Bacteria 59948
87 Ga0157371_10070857 3300013102 Bacteria 2468
88 Ga0157370_10177472 3300013104 Bacteria 1980
89 Ga0157369_10140693 3300013105 Bacteria 2553
90 Ga0157369_10232006 3300013105 Bacteria 1930
91 Ga0157369_10266201 3300013105 Bacteria 1787
92 Ga0157374_10001298 3300013296 Bacteria 21266
93 Ga0157374_10004160 3300013296 Bacteria 12146
94 Ga0157374_10033892 3300013296 Bacteria 4662
95 Ga0157374_10052571 3300013296 Bacteria 3795
96 Ga0157374_10143905 3300013296 Bacteria 2315
97 Ga0157374_10900218 3300013296 Bacteria 902
98 Ga0157378_10007809 3300013297 Bacteria 9339
99 Ga0157378_10025066 3300013297 Bacteria 5253
100 Ga0163162_10000008 3300013306 Bacteria 316194
101 Ga0163162_10001653 3300013306 Bacteria 20900
102 Ga0163162_10004414 3300013306 Bacteria 13540
103 Ga0157372_10003547 3300013307 Bacteria 16808
104 Ga0157372_10008722 3300013307 Bacteria 10768
105 Ga0157372_10020857 3300013307 Bacteria 7074
106 Ga0157372_10832023 3300013307 Unclassified 1072
107 Ga0157375_10001485 3300013308 Bacteria 20130
108 Ga0182007_10024229 3300015262 Bacteria 2125
109 Ga0209437_100361 3300025233 Bacteria 50797
110 Ga0209026_1002624 3300025250 Bacteria 6563
111 Ga0209129_1005588 3300025258 Bacteria 4382
112 Ga0209233_1000520 3300025261 Bacteria 22249
113 Ga0209455_1007053 3300025272 Bacteria 3225
114 Ga0207647_10000546 3300025904 Bacteria 29990
115 Ga0207647_10000588 3300025904 Bacteria 28282
116 Ga0207647_10059986 3300025904 Bacteria 2326
117 Ga0207647_10083320 3300025904 Bacteria 1915
118 Ga0207645_10000948 3300025907 Bacteria 24090
119 Ga0207643_10176049 3300025908 Bacteria 1293
120 Ga0207705_10000233 3300025909 Bacteria 55125
121 Ga0207705_10542468 3300025909 Unclassified 904
122 Ga0207654_10002745 3300025911 Bacteria 8932
123 Ga0207654_10040423 3300025911 Bacteria 2628
124 Ga0207654_10062453 3300025911 Bacteria 2183
125 Ga0207654_10105401 3300025911 Bacteria 1744
126 Ga0207707_10014234 3300025912 Bacteria 6929
127 Ga0207695_10000055 3300025913 Bacteria 382776
128 Ga0207695_10002312 3300025913 Bacteria 28435
129 Ga0207695_10014913 3300025913 Bacteria 9174
130 Ga0207695_10024138 3300025913 Bacteria 6849
131 Ga0207695_10047707 3300025913 Bacteria 4529
132 Ga0207671_10000486 3300025914 Bacteria 53864
133 Ga0207671_10003169 3300025914 Bacteria 16617
134 Ga0207671_10023027 3300025914 Bacteria 4701
135 Ga0207671_10131330 3300025914 Bacteria 1922
136 Ga0207660_10003190 3300025917 Bacteria 10727
137 Ga0207657_10019623 3300025919 Bacteria 6412
138 Ga0207657_10156563 3300025919 Bacteria 1853
139 Ga0207652_10045573 3300025921 Bacteria 3739
140 Ga0207694_10673303 3300025924 Bacteria 872
141 Ga0207659_10131866 3300025926 Bacteria 1930
142 Ga0207690_10017824 3300025932 Bacteria 4345
143 Ga0207706_10000013 3300025933 Bacteria 188236
144 Ga0207686_10522531 3300025934 Bacteria 924
145 Ga0207704_10000015 3300025938 Bacteria 163572
146 Ga0207667_10000496 3300025949 Bacteria 51954
147 Ga0207667_10022904 3300025949 Bacteria 6887
148 Ga0207667_10052574 3300025949 Bacteria 4289
149 Ga0207667_10324196 3300025949 Bacteria 1573
150 Ga0207667_10468040 3300025949 Bacteria 1280
151 Ga0207667_10893364 3300025949 Unclassified 881
152 Ga0207651_10417137 3300025960 Bacteria 1145
153 Ga0207640_10008780 3300025981 Bacteria 5626
154 Ga0207677_10193698 3300026023 Bacteria 1610
155 Ga0207703_10017187 3300026035 Bacteria 5644
156 Ga0207639_10007478 3300026041 Bacteria 7452
157 Ga0207639_10010733 3300026041 Bacteria 6345
158 Ga0207702_10000195 3300026078 Bacteria 71757
159 Ga0207702_10010514 3300026078 Bacteria 7739
160 Ga0207702_10037643 3300026078 Bacteria 4050
161 Ga0207702_10510215 3300026078 Bacteria 1173
162 Ga0207648_10009896 3300026089 Bacteria 9088
163 Ga0207683_10006713 3300026121 Bacteria 9846
164 Ga0268266_10000268 3300028379 Bacteria 85976
165 Ga0265327_10175675 3300031251 Bacteria 982
166 Ga0307509_10145762 3300031507 Bacteria 2294
167 Ga0395899_0048207 3300037312 Bacteria 3171
168 Ga0395900_0002139 3300037418 Bacteria 22114
169 Ga0395900_0006696 3300037418 Bacteria 11971
170 Ga0395900_0031521 3300037418 Bacteria 5448
171 Ga0395900_0230690 3300037418 Bacteria 1862
172 Ga0395898_0018916 3300037466 Bacteria 7018
173 Ga0395898_0106648 3300037466 Bacteria 2687
174 Ga0395898_0665997 3300037466 Bacteria 983
175 Ga0395905_0000973 3300037471 Bacteria 36728
176 Ga0395905_0008395 3300037471 Bacteria 10184
177 Ga0395905_0712176 3300037471 Bacteria 906
178 Ga0395901_0048840 3300038443 Bacteria 4395
179 Ga0395901_0061272 3300038443 Bacteria 3915
180 Ga0395901_0216346 3300038443 Bacteria 2004
181 Ga0436361_0980329 3300039447 Bacteria 4074
182 Ga0439448_0004560 3300042005 Bacteria 3912
183 Ga0495638_0296008 3300046460 Bacteria 873
184 Ga0495651_0053211 3300046462 Bacteria 3118
185 Ga0495583_0098319 3300046506 Bacteria 1251
186 Ga0495606_0000034 3300046507 Bacteria 247705
187 Ga0495606_0009021 3300046507 Bacteria 8523
188 Ga0495610_0001483 3300046512 Bacteria 20663
189 Ga0495616_0019482 3300046513 Bacteria 3702
190 Ga0495648_0032988 3300046524 Bacteria 3389
191 Ga0495652_0182009 3300046529 Bacteria 1612
192 Ga0495652_0221888 3300046529 Bacteria 1420
193 Ga0495609_0175208 3300046538 Bacteria 904
194 Ga0495625_0056873 3300046660 Bacteria 2783
195 Ga0495625_0150832 3300046660 Bacteria 1563
196 Ga0495661_0005466 3300046665 Bacteria 9014
197 Ga0495671_0064577 3300046692 Bacteria 1802
198 Ga0495649_0000014 3300046694 Bacteria 287408
199 Ga0495683_0006705 3300047323 Bacteria 6271
200 Ga0495687_003250 3300047443 Bacteria 11988
201 Ga0495687_078971 3300047443 Bacteria 1295
202 Ga0495687_134399 3300047443 Bacteria 870
203 Ga0495687_134996 3300047443 Bacteria 867
204 Ga0495673_0029306 3300047469 Bacteria 2599
205 Ga0495686_0000112 3300047472 Bacteria 168354
206 Ga0495686_0000319 3300047472 Bacteria 79929
207 Ga0495686_0219800 3300047472 Bacteria 1081
208 Ga0495678_002573 3300049459 Bacteria 12146
209 nmdc:mga0k408_134740_c1 3300050493 Bacteria 1467
210 nmdc:mga0k408_281_c2 3300050493 Bacteria 21573
211 nmdc:mga0k408_313052_c1 3300050493 Unclassified 937
212 nmdc:mga0k408_53220_c1 3300050493 Bacteria 1056
213 nmdc:mga07m45_393793_c1 3300050496 Bacteria 804
214 Ga0500608_000282 3300053122 Bacteria 19738
215 Ga0500624_000621 3300053157 Bacteria 9532
216 Ga0500634_0049181 3300053161 Bacteria 2274

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0150832 Ga0495625_0150832_1004_1552 176
2 3300038443 Ga0395901_0048840 Ga0395901_0048840_52_597 179
3 3300013296 Ga0157374_10143905 Ga0157374_101439052 181
4 3300046506 Ga0495583_0098319 Ga0495583_0098319_671_1240 189
5 3300003323 rootH1_10167677 rootH1_101676772 190
6 3300050493 nmdc:mga0k408_313052_c1 nmdc:mga0k408_313052_c1_338_910 190
7 3300005614 Ga0068856_100594010 Ga0068856_1005940102 197
8 3300026078 Ga0207702_10510215 Ga0207702_105102152 197
9 3300005840 Ga0068870_10150518 Ga0068870_101505182 200
10 3300009093 Ga0105240_10008463 Ga0105240_100084634 200
11 3300025908 Ga0207643_10176049 Ga0207643_101760491 200
12 3300025913 Ga0207695_10024138 Ga0207695_100241384 200
13 3300025949 Ga0207667_10052574 Ga0207667_100525742 200
14 iso_pu_bacteria 2919437846 2919440293 201
15 iso_pu_bacteria 2599185184 2599479774 203
16 iso_pu_bacteria 2928078545 2928083667 203
17 iso_pu_bacteria 2928147474 2928152109 203
18 iso_pu_bacteria 2932082852 2932087001 203
19 3300005336 Ga0070680_100009363 Ga0070680_1000093633 205
20 3300005338 Ga0068868_100181090 Ga0068868_1001810902 205
21 3300005339 Ga0070660_100112136 Ga0070660_1001121361 205
22 3300005364 Ga0070673_100465230 Ga0070673_1004652302 205
23 3300005457 Ga0070662_100000087 Ga0070662_10000008735 205
24 3300005458 Ga0070681_10016091 Ga0070681_100160913 205
25 3300005530 Ga0070679_100022395 Ga0070679_1000223954 205
26 3300005563 Ga0068855_100531394 Ga0068855_1005313942 205
27 3300005563 Ga0068855_100643613 Ga0068855_1006436132 205
28 3300005614 Ga0068856_100169830 Ga0068856_1001698302 205
29 3300005842 Ga0068858_100342836 Ga0068858_1003428362 205
30 3300006195 Ga0075366_10000344 Ga0075366_100003447 205
31 3300009093 Ga0105240_10007404 Ga0105240_100074042 205
32 3300009093 Ga0105240_10174199 Ga0105240_101741993 205
33 3300009093 Ga0105240_10407890 Ga0105240_104078902 205
34 3300009093 Ga0105240_10804755 Ga0105240_108047551 205
35 3300009174 Ga0105241_10007543 Ga0105241_100075432 205
36 3300009545 Ga0105237_10071642 Ga0105237_100716423 205
37 3300009545 Ga0105237_10162339 Ga0105237_101623391 205
38 3300010375 Ga0105239_10000049 Ga0105239_1000004910 205
39 3300010375 Ga0105239_10002795 Ga0105239_1000279511 205
40 3300010375 Ga0105239_10140170 Ga0105239_101401701 205
41 3300011119 Ga0105246_10103325 Ga0105246_101033252 205
42 3300013100 Ga0157373_10123467 Ga0157373_101234672 205
43 3300013105 Ga0157369_10232006 Ga0157369_102320062 205
44 3300013296 Ga0157374_10033892 Ga0157374_100338926 205
45 3300013307 Ga0157372_10020857 Ga0157372_100208577 205
46 3300013308 Ga0157375_10001485 Ga0157375_1000148516 205
47 3300015262 Ga0182007_10024229 Ga0182007_100242291 205
48 3300025272 Ga0209455_1007053 Ga0209455_10070532 205
49 3300025904 Ga0207647_10000546 Ga0207647_1000054625 205
50 3300025911 Ga0207654_10040423 Ga0207654_100404232 205
51 3300025912 Ga0207707_10014234 Ga0207707_100142346 205
52 3300025913 Ga0207695_10002312 Ga0207695_1000231221 205
53 3300025917 Ga0207660_10003190 Ga0207660_100031909 205
54 3300025919 Ga0207657_10156563 Ga0207657_101565632 205
55 3300025933 Ga0207706_10000013 Ga0207706_1000001343 205
56 3300025949 Ga0207667_10468040 Ga0207667_104680402 205
57 3300025949 Ga0207667_10893364 Ga0207667_108933641 205
58 3300025960 Ga0207651_10417137 Ga0207651_104171372 205
59 3300026023 Ga0207677_10193698 Ga0207677_101936982 205
60 3300046513 Ga0495616_0019482 Ga0495616_0019482_2517_3134 205
61 3300047443 Ga0495687_078971 Ga0495687_078971_579_1196 205
62 3300050493 nmdc:mga0k408_134740_c1 nmdc:mga0k408_134740_c1_668_1285 205
63 3300050493 nmdc:mga0k408_281_c2 nmdc:mga0k408_281_c2_6048_6665 205
64 3300050496 nmdc:mga07m45_393793_c1 nmdc:mga07m45_393793_c1_110_727 205
65 3300053122 Ga0500608_000282 Ga0500608_000282_7133_7750 205
66 3300053157 Ga0500624_000621 Ga0500624_000621_5116_5733 205
67 3300053161 Ga0500634_0049181 Ga0500634_0049181_233_850 205
68 3300003323 rootH1_10125197 rootH1_101251972 206
69 3300005327 Ga0070658_10000060 Ga0070658_1000006054 206
70 3300005339 Ga0070660_100036977 Ga0070660_1000369772 206
71 3300005614 Ga0068856_100000120 Ga0068856_10000012061 206
72 3300005614 Ga0068856_100111011 Ga0068856_1001110111 206
73 3300009093 Ga0105240_10062388 Ga0105240_100623884 206
74 3300009174 Ga0105241_10181902 Ga0105241_101819022 206
75 3300009545 Ga0105237_10002670 Ga0105237_100026701 206
76 3300009545 Ga0105237_10928862 Ga0105237_109288622 206
77 3300010375 Ga0105239_10000009 Ga0105239_10000009254 206
78 3300013306 Ga0163162_10001653 Ga0163162_1000165316 206
79 3300025909 Ga0207705_10000233 Ga0207705_1000023354 206
80 3300025911 Ga0207654_10105401 Ga0207654_101054012 206
81 3300025913 Ga0207695_10047707 Ga0207695_100477074 206
82 3300025914 Ga0207671_10003169 Ga0207671_1000316910 206
83 3300025919 Ga0207657_10019623 Ga0207657_100196233 206
84 3300026078 Ga0207702_10000195 Ga0207702_100001959 206
85 3300026078 Ga0207702_10010514 Ga0207702_100105148 206
86 3300037418 Ga0395900_0002139 Ga0395900_0002139_20079_20699 206
87 3300037418 Ga0395900_0230690 Ga0395900_0230690_795_1415 206
88 3300046462 Ga0495651_0053211 Ga0495651_0053211_722_1342 206
89 3300046507 Ga0495606_0000034 Ga0495606_0000034_156027_156647 206
90 3300046512 Ga0495610_0001483 Ga0495610_0001483_16568_17188 206
91 3300046529 Ga0495652_0221888 Ga0495652_0221888_193_813 206
92 3300046538 Ga0495609_0175208 Ga0495609_0175208_151_771 206
93 3300046665 Ga0495661_0005466 Ga0495661_0005466_7186_7806 206
94 3300046692 Ga0495671_0064577 Ga0495671_0064577_294_914 206
95 3300046694 Ga0495649_0000014 Ga0495649_0000014_106326_106946 206
96 3300047443 Ga0495687_003250 Ga0495687_003250_207_827 206
97 3300047469 Ga0495673_0029306 Ga0495673_0029306_236_856 206
98 3300049459 Ga0495678_002573 Ga0495678_002573_3151_3771 206
99 3300001979 JGI24740J21852_10045404 JGI24740J21852_100454042 207
100 3300001989 JGI24739J22299_10026941 JGI24739J22299_100269412 207
101 3300001989 JGI24739J22299_10036831 JGI24739J22299_100368312 207
102 3300001990 JGI24737J22298_10002824 JGI24737J22298_100028244 207
103 3300001990 JGI24737J22298_10011035 JGI24737J22298_100110353 207
104 3300002067 JGI24735J21928_10000007 JGI24735J21928_10000007186 207
105 3300002077 JGI24744J21845_10002357 JGI24744J21845_100023574 207
106 3300002737 JGI25162J39368_1000258 JGI25162J39368_100025841 207
107 3300003316 rootH1_10064563 rootH1_100645635 207
108 3300003320 rootH2_10005722 rootH2_1000572224 207
109 3300003322 rootL2_10030660 rootL2_100306602 207
110 3300003323 rootH1_10170080 rootH1_101700802 207
111 3300005328 Ga0070676_10000379 Ga0070676_100003796 207
112 3300005354 Ga0070675_100223276 Ga0070675_1002232762 207
113 3300005364 Ga0070673_100002736 Ga0070673_1000027369 207
114 3300005366 Ga0070659_100006505 Ga0070659_1000065053 207
115 3300005456 Ga0070678_100023309 Ga0070678_1000233093 207
116 3300005459 Ga0068867_100001240 Ga0068867_1000012409 207
117 3300005530 Ga0070679_100212823 Ga0070679_1002128232 207
118 3300005539 Ga0068853_100012565 Ga0068853_1000125653 207
119 3300005548 Ga0070665_100000264 Ga0070665_10000026468 207
120 3300005563 Ga0068855_100000149 Ga0068855_10000014912 207
121 3300005563 Ga0068855_100072767 Ga0068855_1000727674 207
122 3300005563 Ga0068855_100096053 Ga0068855_1000960532 207
123 3300005563 Ga0068855_100701568 Ga0068855_1007015681 207
124 3300005614 Ga0068856_100088949 Ga0068856_1000889492 207
125 3300005616 Ga0068852_100000389 Ga0068852_1000003899 207
126 3300006195 Ga0075366_10055890 Ga0075366_100558903 207
127 3300006237 Ga0097621_100000232 Ga0097621_10000023214 207
128 3300006358 Ga0068871_100000800 Ga0068871_10000080022 207
129 3300006881 Ga0068865_100000510 Ga0068865_10000051014 207
130 3300009093 Ga0105240_10000200 Ga0105240_1000020051 207
131 3300009093 Ga0105240_10036086 Ga0105240_100360863 207
132 3300009174 Ga0105241_10001408 Ga0105241_100014089 207
133 3300009174 Ga0105241_10006234 Ga0105241_100062347 207
134 3300009174 Ga0105241_10037605 Ga0105241_100376053 207
135 3300009176 Ga0105242_10694174 Ga0105242_106941742 207
136 3300009545 Ga0105237_10000239 Ga0105237_100002395 207
137 3300009545 Ga0105237_10000535 Ga0105237_1000053533 207
138 3300009545 Ga0105237_10011509 Ga0105237_100115099 207
139 3300009545 Ga0105237_10032829 Ga0105237_100328294 207
140 3300009551 Ga0105238_10380734 Ga0105238_103807341 207
141 3300010375 Ga0105239_10000478 Ga0105239_1000047813 207
142 3300010375 Ga0105239_10001375 Ga0105239_100013754 207
143 3300010375 Ga0105239_10022097 Ga0105239_100220974 207
144 3300010375 Ga0105239_10074642 Ga0105239_100746424 207
145 3300013100 Ga0157373_10002483 Ga0157373_100024837 207
146 3300013102 Ga0157371_10000342 Ga0157371_100003424 207
147 3300013102 Ga0157371_10070857 Ga0157371_100708572 207
148 3300013104 Ga0157370_10177472 Ga0157370_101774722 207
149 3300013105 Ga0157369_10140693 Ga0157369_101406933 207
150 3300013105 Ga0157369_10266201 Ga0157369_102662012 207
151 3300013296 Ga0157374_10001298 Ga0157374_100012986 207
152 3300013296 Ga0157374_10004160 Ga0157374_100041609 207
153 3300013296 Ga0157374_10052571 Ga0157374_100525713 207
154 3300013296 Ga0157374_10900218 Ga0157374_109002181 207
155 3300013297 Ga0157378_10007809 Ga0157378_100078098 207
156 3300013297 Ga0157378_10025066 Ga0157378_100250665 207
157 3300013306 Ga0163162_10000008 Ga0163162_10000008126 207
158 3300013306 Ga0163162_10004414 Ga0163162_1000441410 207
159 3300013307 Ga0157372_10003547 Ga0157372_100035473 207
160 3300013307 Ga0157372_10008722 Ga0157372_100087229 207
161 3300013307 Ga0157372_10832023 Ga0157372_108320232 207
162 3300025233 Ga0209437_100361 Ga0209437_1003612 207
163 3300025250 Ga0209026_1002624 Ga0209026_10026247 207
164 3300025258 Ga0209129_1005588 Ga0209129_10055884 207
165 3300025261 Ga0209233_1000520 Ga0209233_100052020 207
166 3300025904 Ga0207647_10000588 Ga0207647_100005881 207
167 3300025904 Ga0207647_10059986 Ga0207647_100599863 207
168 3300025904 Ga0207647_10083320 Ga0207647_100833202 207
169 3300025907 Ga0207645_10000948 Ga0207645_100009482 207
170 3300025909 Ga0207705_10542468 Ga0207705_105424681 207
171 3300025911 Ga0207654_10002745 Ga0207654_100027454 207
172 3300025911 Ga0207654_10062453 Ga0207654_100624532 207
173 3300025913 Ga0207695_10000055 Ga0207695_1000005551 207
174 3300025913 Ga0207695_10014913 Ga0207695_100149132 207
175 3300025914 Ga0207671_10000486 Ga0207671_1000048631 207
176 3300025914 Ga0207671_10023027 Ga0207671_100230272 207
177 3300025914 Ga0207671_10131330 Ga0207671_101313301 207
178 3300025921 Ga0207652_10045573 Ga0207652_100455734 207
179 3300025924 Ga0207694_10673303 Ga0207694_106733032 207
180 3300025926 Ga0207659_10131866 Ga0207659_101318662 207
181 3300025932 Ga0207690_10017824 Ga0207690_100178244 207
182 3300025934 Ga0207686_10522531 Ga0207686_105225312 207
183 3300025938 Ga0207704_10000015 Ga0207704_10000015114 207
184 3300025949 Ga0207667_10000496 Ga0207667_1000049612 207
185 3300025949 Ga0207667_10022904 Ga0207667_100229044 207
186 3300025949 Ga0207667_10324196 Ga0207667_103241962 207
187 3300025981 Ga0207640_10008780 Ga0207640_100087806 207
188 3300026035 Ga0207703_10017187 Ga0207703_100171875 207
189 3300026041 Ga0207639_10007478 Ga0207639_100074784 207
190 3300026041 Ga0207639_10010733 Ga0207639_100107335 207
191 3300026078 Ga0207702_10037643 Ga0207702_100376432 207
192 3300026089 Ga0207648_10009896 Ga0207648_100098968 207
193 3300026121 Ga0207683_10006713 Ga0207683_100067136 207
194 3300028379 Ga0268266_10000268 Ga0268266_1000026867 207
195 3300031251 Ga0265327_10175675 Ga0265327_101756752 207
196 3300031507 Ga0307509_10145762 Ga0307509_101457622 207
197 3300037312 Ga0395899_0048207 Ga0395899_0048207_1041_1667 207
198 3300037418 Ga0395900_0006696 Ga0395900_0006696_5644_6270 207
199 3300037418 Ga0395900_0031521 Ga0395900_0031521_1363_1992 207
200 3300037466 Ga0395898_0018916 Ga0395898_0018916_4600_5229 207
201 3300037466 Ga0395898_0106648 Ga0395898_0106648_2051_2677 207
202 3300037466 Ga0395898_0665997 Ga0395898_0665997_25_648 207
203 3300037471 Ga0395905_0000973 Ga0395905_0000973_22680_23306 207
204 3300037471 Ga0395905_0008395 Ga0395905_0008395_3799_4428 207
205 3300037471 Ga0395905_0712176 Ga0395905_0712176_263_886 207
206 3300038443 Ga0395901_0061272 Ga0395901_0061272_300_926 207
207 3300038443 Ga0395901_0216346 Ga0395901_0216346_144_767 207
208 3300039447 Ga0436361_0980329 Ga0436361_0980329_2671_3300 207
209 3300042005 Ga0439448_0004560 Ga0439448_0004560_1250_1879 207
210 3300046460 Ga0495638_0296008 Ga0495638_0296008_117_743 207
211 3300046507 Ga0495606_0009021 Ga0495606_0009021_449_1075 207
212 3300046524 Ga0495648_0032988 Ga0495648_0032988_873_1511 207
213 3300046529 Ga0495652_0182009 Ga0495652_0182009_866_1489 207
214 3300046660 Ga0495625_0056873 Ga0495625_0056873_803_1426 207
215 3300047323 Ga0495683_0006705 Ga0495683_0006705_5244_5885 207
216 3300047443 Ga0495687_134399 Ga0495687_134399_131_760 207
217 3300047443 Ga0495687_134996 Ga0495687_134996_131_757 207
218 3300047472 Ga0495686_0000112 Ga0495686_0000112_44853_45485 207
219 3300047472 Ga0495686_0000319 Ga0495686_0000319_49246_49872 207
220 3300047472 Ga0495686_0219800 Ga0495686_0219800_76_702 207
221 3300050493 nmdc:mga0k408_53220_c1 nmdc:mga0k408_53220_c1_221_847 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

42

131

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wlf-assembly1.cif.gz_A phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.8184 22 148
6wlf-assembly2.cif.gz_B phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.8169 22 148
6p3o-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with (s)-cis-n-methylstylopine and s-adenosylhomocysteine 0.8006 27 142
6p3n-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with s-adenosylmethionine 0.7947 27 142
5kpg-assembly1.cif.gz_A pavine n-methyltransferase in complex with s-adenosylhomocysteine ph 7 0.7871 21 142
ID Description Score Start End Superfamily
af_A0A1D6HKL4_97_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8306 29 143 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8298 29 148 3.40.50.150
af_Q6EQW4_99_328_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8139 29 79 3.40.50.150
af_D3ZQ63_181_335_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8059 41 151 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7997 29 148 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A5D8YRZ5-F1-model_v4 Class I SAM-dependent methyltransferase 0.9821 4 205 GO:0008168
GO:0032259
AF-A0A4Q3F895-F1-model_v4 Methyltransferase domain-containing protein 0.9702 1 207 GO:0008168
GO:0032259
AF-A0A3D8Y3Y6-F1-model_v4 Methyltransferase type 12 0.9685 1 207 GO:0008168
GO:0032259
AF-A0A512B7I2-F1-model_v4 Methyltransferase domain-containing protein 0.968 1 206
AF-A0A4U6D0P9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9675 1 207 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.4 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map