F333459

General Info

Members Datasets Scaffolds Average Seq Length
221 141 440 276

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10384855|Ga0207702_103848552
Length 286
Sequence MAAPGAFEPTPPPQAAPPLAPSTQNEPVVVFEDVSIGFGPEPLLQRISFTIRRGETRILLGPAGVGKSVLLKLVNGLLRPTAGRIFVFGQEVSAMREEDLFEVRRSIGTVFQEGALFDSLTVRDNVGYRLIEEHVPDDEIEARVTEALQFVEMAHTLDKFPSELSGGMRRRVAIARAIVSNPQLLLYDSPTAGLDPITSTTIIELVMKQRDVSHTTSLVVTHRLQDAFVLATHHFSRVKNDMEPLPPGQLDPHTSFLMLHQGRLVFDGTTEQLVRSDDPFIRQYLS

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
86 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 0.45
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 17.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_10384855 3300026078 Bacteria 1350
2 Ga0070683_100093306 3300005329 Bacteria 2828
3 Ga0070670_100143685 3300005331 Unclassified 2064
4 Ga0070680_100184623 3300005336 Bacteria 1757
5 Ga0070689_100156957 3300005340 Bacteria 1837
6 Ga0070671_100083808 3300005355 Bacteria 2666
7 Ga0070674_100254738 3300005356 Bacteria 1380
8 Ga0070673_100027585 3300005364 Bacteria 4211
9 Ga0070688_100044326 3300005365 Unclassified 2745
10 Ga0070667_100523748 3300005367 Unclassified 1088
11 Ga0070709_10039238 3300005434 Bacteria 2905
12 Ga0070678_100115971 3300005456 Bacteria 2104
13 Ga0070681_10309242 3300005458 Bacteria 1490
14 Ga0070685_10102608 3300005466 Unclassified 1749
15 Ga0070699_100264612 3300005518 Unclassified 1538
16 Ga0070679_100104425 3300005530 Bacteria 2820
17 Ga0070679_100645031 3300005530 Bacteria 1002
18 Ga0070684_100000021 3300005535 Bacteria 132928
19 Ga0070684_100190038 3300005535 Bacteria 1868
20 Ga0070684_100319017 3300005535 Bacteria 1427
21 Ga0070696_100002588 3300005546 Bacteria 11989
22 Ga0070664_100452547 3300005564 Bacteria 1179
23 Ga0068859_100173086 3300005617 Unclassified 2240
24 Ga0068863_100086747 3300005841 Bacteria 2966
25 Ga0068860_100134088 3300005843 Unclassified 2378
26 Ga0081540_1009127 3300005983 Bacteria 6846
27 Ga0070717_10109150 3300006028 Bacteria 2358
28 Ga0097621_100253364 3300006237 Bacteria 1542
29 Ga0068871_100327629 3300006358 Bacteria 1350
30 Ga0075431_100004955 3300006847 Bacteria 13104
31 Ga0075429_100309869 3300006880 Unclassified 1382
32 Ga0075436_100000256 3300006914 Bacteria 33232
33 Ga0075436_100308292 3300006914 Bacteria 1135
34 Ga0097620_100173092 3300006931 Unclassified 2240
35 Ga0105240_10000948 3300009093 Bacteria 51646
36 Ga0105240_10097423 3300009093 Bacteria 3584
37 Ga0105240_10328301 3300009093 Bacteria 1742
38 Ga0105240_10632478 3300009093 Bacteria 1175
39 Ga0105245_10399885 3300009098 Bacteria 1372
40 Ga0114129_10063002 3300009147 Bacteria 5180
41 Ga0114129_10346286 3300009147 Bacteria 1970
42 Ga0105242_10129919 3300009176 Unclassified 2173
43 Ga0105242_10305453 3300009176 Unclassified 1454
44 Ga0105248_10000202 3300009177 Bacteria 68757
45 Ga0105248_10009850 3300009177 Bacteria 10527
46 Ga0105248_10105728 3300009177 Bacteria 3174
47 Ga0105248_10434585 3300009177 Bacteria 1478
48 Ga0105237_10017548 3300009545 Bacteria 7418
49 Ga0105237_10275413 3300009545 Bacteria 1685
50 Ga0105249_10116156 3300009553 Unclassified 2536
51 Ga0105239_10171190 3300010375 Bacteria 2428
52 Ga0105239_11076104 3300010375 Bacteria 925
53 Ga0157370_10104617 3300013104 Bacteria 2650
54 Ga0157369_10126337 3300013105 Bacteria 2711
55 Ga0163162_10892811 3300013306 Bacteria 1002
56 Ga0157372_10040496 3300013307 Bacteria 5147
57 Ga0157372_10355480 3300013307 Bacteria 1707
58 Ga0157375_10131247 3300013308 Bacteria 2625
59 Ga0163163_10147989 3300014325 Unclassified 2393
60 Ga0163163_10832588 3300014325 Unclassified 986
61 Ga0157376_10139474 3300014969 Unclassified 2173
62 Ga0157376_10175870 3300014969 Bacteria 1953
63 Ga0157376_10230097 3300014969 Unclassified 1721
64 Ga0213872_10005340 3300021361 Bacteria 6631
65 Ga0213872_10018683 3300021361 Bacteria 3195
66 Ga0207699_10286032 3300025906 Bacteria 1147
67 Ga0207705_10308047 3300025909 Bacteria 1215
68 Ga0207654_10224241 3300025911 Bacteria 1248
69 Ga0207695_10015965 3300025913 Bacteria 8815
70 Ga0207695_10038282 3300025913 Bacteria 5165
71 Ga0207695_10095310 3300025913 Bacteria 2980
72 Ga0207671_10017790 3300025914 Bacteria 5470
73 Ga0207694_10091036 3300025924 Bacteria 2407
74 Ga0207650_10224547 3300025925 Bacteria 1513
75 Ga0207700_10036640 3300025928 Bacteria 3545
76 Ga0207664_10006282 3300025929 Bacteria 8165
77 Ga0207644_10084469 3300025931 Bacteria 2353
78 Ga0207686_10045489 3300025934 Bacteria 2701
79 Ga0207686_10280314 3300025934 Bacteria 1230
80 Ga0207670_10070414 3300025936 Unclassified 2416
81 Ga0207670_10106964 3300025936 Bacteria 2008
82 Ga0207669_10212301 3300025937 Bacteria 1414
83 Ga0207665_10113534 3300025939 Bacteria 1906
84 Ga0207665_10376377 3300025939 Bacteria 1077
85 Ga0207711_10000007 3300025941 Bacteria 759410
86 Ga0207711_10000018 3300025941 Bacteria 431036
87 Ga0207711_10005672 3300025941 Bacteria 10545
88 Ga0207711_10117235 3300025941 Bacteria 2374
89 Ga0207711_10596270 3300025941 Bacteria 1031
90 Ga0207661_10000010 3300025944 Bacteria 375338
91 Ga0207661_10108812 3300025944 Bacteria 2341
92 Ga0207679_10547645 3300025945 Bacteria 1038
93 Ga0207712_10119037 3300025961 Unclassified 1995
94 Ga0207641_10181420 3300026088 Bacteria 1928
95 Ga0207648_10150928 3300026089 Bacteria 2050
96 Ga0207676_10062500 3300026095 Bacteria 2954
97 Ga0207683_10182832 3300026121 Bacteria 1901
98 Ga0268264_10113453 3300028381 Unclassified 2378
99 Ga0265323_10000356 3300028653 Bacteria 26275
100 Ga0265338_10009052 3300028800 Bacteria 11977
101 Ga0265338_10143966 3300028800 Bacteria 1862
102 Ga0265330_10033953 3300031235 Bacteria 2280
103 Ga0265332_10089240 3300031238 Unclassified 1304
104 Ga0265328_10042543 3300031239 Bacteria 1672
105 Ga0265320_10017441 3300031240 Bacteria 3985
106 Ga0265325_10026996 3300031241 Bacteria 3107
107 Ga0265329_10073279 3300031242 Bacteria 1084
108 Ga0265340_10035248 3300031247 Bacteria 2486
109 Ga0265339_10139536 3300031249 Bacteria 1234
110 Ga0265331_10033346 3300031250 Bacteria 2546
111 Ga0265331_10055302 3300031250 Bacteria 1888
112 Ga0265316_10007187 3300031344 Bacteria 10520
113 Ga0265316_10009841 3300031344 Bacteria 8771
114 Ga0265316_10024162 3300031344 Bacteria 5099
115 Ga0265316_10024756 3300031344 Bacteria 5018
116 Ga0265316_10036096 3300031344 Bacteria 3998
117 Ga0265316_10061613 3300031344 Bacteria 2913
118 Ga0265316_10066806 3300031344 Bacteria 2781
119 Ga0265316_10099688 3300031344 Bacteria 2209
120 Ga0265314_10003697 3300031711 Bacteria 14662
121 Ga0265314_10040012 3300031711 Bacteria 3370
122 Ga0265342_10009214 3300031712 Bacteria 6985
123 Ga0265342_10117023 3300031712 Bacteria 1504
124 Ga0265342_10190030 3300031712 Unclassified 1121
125 Ga0316576_10002543 3300031727 Bacteria 10397
126 Ga0316577_10000403 3300031733 Bacteria 16625
127 Ga0316585_10026068 3300032137 Bacteria 1816
128 Ga0373934_0128936 3300035086 Bacteria 1031
129 Ga0373945_0077098 3300035116 Bacteria 1271
130 Ga0373943_0032124 3300035170 Unclassified 2494
131 Ga0316574_0106420 3300035398 Bacteria 1797
132 Ga0373935_0073979 3300035692 Bacteria 2202
133 Ga0373927_0000993 3300035695 Bacteria 21601
134 Ga0373927_0023286 3300035695 Unclassified 4057
135 Ga0373933_0251194 3300035724 Bacteria 1139
136 Ga0373947_0000335 3300035725 Bacteria 26517
137 Ga0373947_0165639 3300035725 Bacteria 1432
138 Ga0373947_0234349 3300035725 Bacteria 1210
139 Ga0373937_0494096 3300036401 Bacteria 1162
140 Ga0316584_0000036 3300036712 Bacteria 48276
141 Ga0373925_0000144 3300037068 Bacteria 75731
142 Ga0373925_0052653 3300037068 Bacteria 3042
143 Ga0373925_0104104 3300037068 Bacteria 2185
144 Ga0395900_0101714 3300037418 Bacteria 2952
145 Ga0436364_0759549 3300037853 Unclassified 2605
146 Ga0436364_0860470 3300037853 Bacteria 2709
147 Ga0436365_0667260 3300039437 Unclassified 2854
148 Ga0436365_0998595 3300039437 Unclassified 3709
149 Ga0436360_0439396 3300039438 Bacteria 2372
150 Ga0436360_0830281 3300039438 Bacteria 1685
151 Ga0436361_0048108 3300039447 Bacteria 29517
152 Ga0436361_0335338 3300039447 Bacteria 2528
153 Ga0436361_0339934 3300039447 Bacteria 3243
154 Ga0436361_0859821 3300039447 Bacteria 3577
155 Ga0436363_1544625 3300039450 Unclassified 1512
156 Ga0451577_0001774 3300042876 Bacteria 27754
157 Ga0466959_0109339 3300045049 Bacteria 1974
158 Ga0451576_0109598 3300045051 Bacteria 2873
159 Ga0495592_0029886 3300046454 Bacteria 4122
160 Ga0495592_0199018 3300046454 Bacteria 1353
161 Ga0495651_0014735 3300046462 Bacteria 6046
162 Ga0495580_0007894 3300046472 Bacteria 8512
163 Ga0495580_0021923 3300046472 Bacteria 4709
164 Ga0495580_0035188 3300046472 Bacteria 3602
165 Ga0495580_0164528 3300046472 Bacteria 1535
166 Ga0495580_0204728 3300046472 Bacteria 1359
167 Ga0495580_0297793 3300046472 Unclassified 1099
168 Ga0495582_0022017 3300046473 Bacteria 3487
169 Ga0495662_0018715 3300046476 Unclassified 3353
170 Ga0495664_0018760 3300046477 Bacteria 3969
171 Ga0495664_0202072 3300046477 Bacteria 1204
172 Ga0495608_0106255 3300046511 Bacteria 1807
173 Ga0495618_0053958 3300046514 Bacteria 2542
174 Ga0495628_0066590 3300046516 Unclassified 2815
175 Ga0495628_0109663 3300046516 Bacteria 2124
176 Ga0495630_0039924 3300046517 Bacteria 3508
177 Ga0495666_0117202 3300046526 Bacteria 1249
178 Ga0495652_0029243 3300046529 Bacteria 4842
179 Ga0495652_0352575 3300046529 Bacteria 1054
180 Ga0495665_0024096 3300046531 Unclassified 3269
181 Ga0495640_0110193 3300046533 Bacteria 1799
182 Ga0495587_0030444 3300046536 Bacteria 3273
183 Ga0495645_0005943 3300046543 Bacteria 8435
184 Ga0495645_0011588 3300046543 Bacteria 6208
185 Ga0495645_0092561 3300046543 Bacteria 2159
186 Ga0495645_0296479 3300046543 Bacteria 1058
187 Ga0495667_0052634 3300046559 Unclassified 2681
188 Ga0495667_0065080 3300046559 Bacteria 2385
189 Ga0495667_0066171 3300046559 Bacteria 2363
190 Ga0495634_0041197 3300046642 Bacteria 3137
191 Ga0495635_0030315 3300046663 Bacteria 3758
192 Ga0495657_0053681 3300046675 Bacteria 2696
193 Ga0495657_0266966 3300046675 Bacteria 1027
194 Ga0495599_0024591 3300046678 Unclassified 3766
195 Ga0495623_0046042 3300046679 Unclassified 2769
196 Ga0495613_0118390 3300046689 Bacteria 1904
197 Ga0495613_0183474 3300046689 Unclassified 1481
198 Ga0495624_0142481 3300046690 Bacteria 1468
199 Ga0495600_0036919 3300046809 Bacteria 3176
200 Ga0495600_0042047 3300046809 Bacteria 2979
201 Ga0495604_0055334 3300047317 Bacteria 3058
202 Ga0495604_0065140 3300047317 Unclassified 2775
203 Ga0495674_0034283 3300047319 Unclassified 4591
204 Ga0495674_0081668 3300047319 Unclassified 2772
205 Ga0495674_0207734 3300047319 Bacteria 1623
206 Ga0495674_0375342 3300047319 Bacteria 1151
207 Ga0495675_0043687 3300047444 Bacteria 2855
208 Ga0495675_0062063 3300047444 Bacteria 2367
209 Ga0495684_0006172 3300047471 Bacteria 9333
210 Ga0495684_0022143 3300047471 Bacteria 4893
211 Ga0495684_0038112 3300047471 Bacteria 3686
212 Ga0495602_0358688 3300048088 Bacteria 1050
213 Ga0496109_0321746 3300048912 Bacteria 1460
214 nmdc:mga09592_291021_c1 3300050508 Bacteria 1416
215 nmdc:mga09592_384061_c1 3300050508 Bacteria 1214
216 nmdc:mga08x19_1766_c1 3300050514 Bacteria 13306
217 nmdc:mga08x19_205102_c1 3300050514 Bacteria 1352
218 nmdc:mga08x19_97296_c1 3300050514 Bacteria 1949
219 Ga0495601_0071924 3300053077 Bacteria 2209
220 Ga0500616_0150602 3300053153 Bacteria 1077
221 Ga0207702_10384855
222 Ga0070683_100093306
223 Ga0070670_100143685
224 Ga0070680_100184623
225 Ga0070689_100156957
226 Ga0070671_100083808
227 Ga0070674_100254738
228 Ga0070673_100027585
229 Ga0070688_100044326
230 Ga0070667_100523748
231 Ga0070709_10039238
232 Ga0070678_100115971
233 Ga0070681_10309242
234 Ga0070685_10102608
235 Ga0070699_100264612
236 Ga0070679_100104425
237 Ga0070679_100645031
238 Ga0070684_100000021
239 Ga0070684_100190038
240 Ga0070684_100319017
241 Ga0070696_100002588
242 Ga0070664_100452547
243 Ga0068859_100173086
244 Ga0068863_100086747
245 Ga0068860_100134088
246 Ga0081540_1009127
247 Ga0070717_10109150
248 Ga0097621_100253364
249 Ga0068871_100327629
250 Ga0075431_100004955
251 Ga0075429_100309869
252 Ga0075436_100000256
253 Ga0075436_100308292
254 Ga0097620_100173092
255 Ga0105240_10000948
256 Ga0105240_10097423
257 Ga0105240_10328301
258 Ga0105240_10632478
259 Ga0105245_10399885
260 Ga0114129_10063002
261 Ga0114129_10346286
262 Ga0105242_10129919
263 Ga0105242_10305453
264 Ga0105248_10000202
265 Ga0105248_10009850
266 Ga0105248_10105728
267 Ga0105248_10434585
268 Ga0105237_10017548
269 Ga0105237_10275413
270 Ga0105249_10116156
271 Ga0105239_10171190
272 Ga0105239_11076104
273 Ga0157370_10104617
274 Ga0157369_10126337
275 Ga0163162_10892811
276 Ga0157372_10040496
277 Ga0157372_10355480
278 Ga0157375_10131247
279 Ga0163163_10147989
280 Ga0163163_10832588
281 Ga0157376_10139474
282 Ga0157376_10175870
283 Ga0157376_10230097
284 Ga0213872_10005340
285 Ga0213872_10018683
286 Ga0207699_10286032
287 Ga0207705_10308047
288 Ga0207654_10224241
289 Ga0207695_10015965
290 Ga0207695_10038282
291 Ga0207695_10095310
292 Ga0207671_10017790
293 Ga0207694_10091036
294 Ga0207650_10224547
295 Ga0207700_10036640
296 Ga0207664_10006282
297 Ga0207644_10084469
298 Ga0207686_10045489
299 Ga0207686_10280314
300 Ga0207670_10070414
301 Ga0207670_10106964
302 Ga0207669_10212301
303 Ga0207665_10113534
304 Ga0207665_10376377
305 Ga0207711_10000007
306 Ga0207711_10000018
307 Ga0207711_10005672
308 Ga0207711_10117235
309 Ga0207711_10596270
310 Ga0207661_10000010
311 Ga0207661_10108812
312 Ga0207679_10547645
313 Ga0207712_10119037
314 Ga0207641_10181420
315 Ga0207648_10150928
316 Ga0207676_10062500
317 Ga0207683_10182832
318 Ga0268264_10113453
319 Ga0265323_10000356
320 Ga0265338_10009052
321 Ga0265338_10143966
322 Ga0265330_10033953
323 Ga0265332_10089240
324 Ga0265328_10042543
325 Ga0265320_10017441
326 Ga0265325_10026996
327 Ga0265329_10073279
328 Ga0265340_10035248
329 Ga0265339_10139536
330 Ga0265331_10033346
331 Ga0265331_10055302
332 Ga0265316_10007187
333 Ga0265316_10009841
334 Ga0265316_10024162
335 Ga0265316_10024756
336 Ga0265316_10036096
337 Ga0265316_10061613
338 Ga0265316_10066806
339 Ga0265316_10099688
340 Ga0265314_10003697
341 Ga0265314_10040012
342 Ga0265342_10009214
343 Ga0265342_10117023
344 Ga0265342_10190030
345 Ga0316576_10002543
346 Ga0316577_10000403
347 Ga0316585_10026068
348 Ga0373934_0128936
349 Ga0373945_0077098
350 Ga0373943_0032124
351 Ga0316574_0106420
352 Ga0373935_0073979
353 Ga0373927_0000993
354 Ga0373927_0023286
355 Ga0373933_0251194
356 Ga0373947_0000335
357 Ga0373947_0165639
358 Ga0373947_0234349
359 Ga0373937_0494096
360 Ga0316584_0000036
361 Ga0373925_0000144
362 Ga0373925_0052653
363 Ga0373925_0104104
364 Ga0395900_0101714
365 Ga0436364_0759549
366 Ga0436364_0860470
367 Ga0436365_0667260
368 Ga0436365_0998595
369 Ga0436360_0439396
370 Ga0436360_0830281
371 Ga0436361_0048108
372 Ga0436361_0335338
373 Ga0436361_0339934
374 Ga0436361_0859821
375 Ga0436363_1544625
376 Ga0451577_0001774
377 Ga0466959_0109339
378 Ga0451576_0109598
379 Ga0495592_0029886
380 Ga0495592_0199018
381 Ga0495651_0014735
382 Ga0495580_0007894
383 Ga0495580_0021923
384 Ga0495580_0035188
385 Ga0495580_0164528
386 Ga0495580_0204728
387 Ga0495580_0297793
388 Ga0495582_0022017
389 Ga0495662_0018715
390 Ga0495664_0018760
391 Ga0495664_0202072
392 Ga0495608_0106255
393 Ga0495618_0053958
394 Ga0495628_0066590
395 Ga0495628_0109663
396 Ga0495630_0039924
397 Ga0495666_0117202
398 Ga0495652_0029243
399 Ga0495652_0352575
400 Ga0495665_0024096
401 Ga0495640_0110193
402 Ga0495587_0030444
403 Ga0495645_0005943
404 Ga0495645_0011588
405 Ga0495645_0092561
406 Ga0495645_0296479
407 Ga0495667_0052634
408 Ga0495667_0065080
409 Ga0495667_0066171
410 Ga0495634_0041197
411 Ga0495635_0030315
412 Ga0495657_0053681
413 Ga0495657_0266966
414 Ga0495599_0024591
415 Ga0495623_0046042
416 Ga0495613_0118390
417 Ga0495613_0183474
418 Ga0495624_0142481
419 Ga0495600_0036919
420 Ga0495600_0042047
421 Ga0495604_0055334
422 Ga0495604_0065140
423 Ga0495674_0034283
424 Ga0495674_0081668
425 Ga0495674_0207734
426 Ga0495674_0375342
427 Ga0495675_0043687
428 Ga0495675_0062063
429 Ga0495684_0006172
430 Ga0495684_0022143
431 Ga0495684_0038112
432 Ga0495602_0358688
433 Ga0496109_0321746
434 nmdc:mga09592_291021_c1
435 nmdc:mga09592_384061_c1
436 nmdc:mga08x19_1766_c1
437 nmdc:mga08x19_205102_c1
438 nmdc:mga08x19_97296_c1
439 Ga0495601_0071924
440 Ga0500616_0150602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

44

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9401 7 255
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.932 7 255
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.928 9 250
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.923 7 271
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.917 7 271
ID Description Score Start End Superfamily
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.943 10 249 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9339 7 270 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9331 22 271 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.928 9 254 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9247 7 255 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D3VDK4-F1-model_v4 Cell division ATP-binding protein FtsE 0.9564 7 161 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A831UKK4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9504 6 169 GO:0005524
GO:0016887
AF-A0A353M4F4-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD 0.941 42 204 GO:0005524
GO:0005886
GO:0016887
AF-A0A353M4F4-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD 0.9354 42 204 GO:0005524
GO:0005886
GO:0016887
AF-A0A3D3VDK4-F1-model_v4 Cell division ATP-binding protein FtsE 0.9327 7 161 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301

Map