F333247

General Info

Members Datasets Scaffolds Average Seq Length
221 117 442 212

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100357595|Ga0097621_1003575952
Length 220
Sequence MGRRREVSGSLNLLIGLAMGLNLLALGSSRLPSLVRAMSLQGMVLGLMPVLIEHETLTWQILAVSLATMVGKGVVIPNLLRRAMRAANIEREIQPFIGLIPSLLLGAGGTIAAMVIAGHLPLLPEHQGMLLVPGAIASVLTGFILLIGRAKAISQVCGYLILENGIYLFGLLLIHSTPFLVESGILLDITVGVFVIGIIVDRIQRAFDSLDTRKLTTLHE

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
61 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
62 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
63 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
64 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
65 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
66 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
73 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.1
Stem 0
Stem Tuber 0
Unclassified 14.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100357595 3300006237 Bacteria 1300
2 rootH2_10031556 3300003320 Bacteria 11678
3 Ga0070683_100026868 3300005329 Bacteria 5188
4 Ga0070690_100243321 3300005330 Bacteria 1269
5 Ga0070689_100095771 3300005340 Bacteria 2345
6 Ga0070689_100511604 3300005340 Unclassified 1030
7 Ga0070687_100310820 3300005343 Bacteria 1003
8 Ga0070675_100055018 3300005354 Bacteria 3275
9 Ga0070675_100147391 3300005354 Bacteria 2016
10 Ga0070714_100008520 3300005435 Bacteria 8016
11 Ga0070713_100908107 3300005436 Bacteria 847
12 Ga0070705_100104052 3300005440 Bacteria 1799
13 Ga0070705_100431040 3300005440 Bacteria 984
14 Ga0070694_100001722 3300005444 Bacteria 12887
15 Ga0070694_100362891 3300005444 Bacteria 1125
16 Ga0070707_100428672 3300005468 Unclassified 1283
17 Ga0070698_100001600 3300005471 Bacteria 25186
18 Ga0070686_100002365 3300005544 Bacteria 10395
19 Ga0070665_101098778 3300005548 Bacteria 807
20 Ga0070704_100015137 3300005549 Bacteria 4837
21 Ga0068855_100023090 3300005563 Bacteria 7454
22 Ga0068855_100523678 3300005563 Bacteria 1286
23 Ga0068857_100099477 3300005577 Bacteria 2609
24 Ga0068856_100000641 3300005614 Bacteria 38028
25 Ga0068856_100022908 3300005614 Bacteria 6074
26 Ga0068856_100094064 3300005614 Unclassified 2984
27 Ga0068859_100127790 3300005617 Unclassified 2612
28 Ga0068859_100247608 3300005617 Bacteria 1872
29 Ga0075428_100174040 3300006844 Bacteria 2332
30 Ga0075429_100264589 3300006880 Unclassified 1506
31 Ga0097620_100127778 3300006931 Unclassified 2612
32 Ga0097620_100247609 3300006931 Bacteria 1872
33 Ga0105240_10466998 3300009093 Bacteria 1409
34 Ga0111539_10755201 3300009094 Unclassified 1132
35 Ga0114129_10575846 3300009147 Unclassified 1461
36 Ga0105237_10615102 3300009545 Bacteria 1093
37 Ga0157369_10121338 3300013105 Bacteria 2773
38 Ga0163163_10156636 3300014325 Bacteria 2322
39 Ga0163163_10220510 3300014325 Bacteria 1945
40 Ga0163163_10837091 3300014325 Bacteria 983
41 Ga0163163_11175732 3300014325 Unclassified 830
42 Ga0157376_10763283 3300014969 Bacteria 977
43 Ga0207695_10368751 3300025913 Unclassified 1322
44 Ga0207671_10469848 3300025914 Unclassified 1002
45 Ga0207662_10447691 3300025918 Unclassified 882
46 Ga0207659_10143587 3300025926 Bacteria 1856
47 Ga0207700_10509263 3300025928 Unclassified 1066
48 Ga0207700_10722430 3300025928 Bacteria 890
49 Ga0207664_10013692 3300025929 Bacteria 5832
50 Ga0207670_10029912 3300025936 Bacteria 3474
51 Ga0207670_10462831 3300025936 Bacteria 1024
52 Ga0207661_10131889 3300025944 Unclassified 2141
53 Ga0207667_10031151 3300025949 Bacteria 5760
54 Ga0207667_10662380 3300025949 Unclassified 1049
55 Ga0207708_10497986 3300026075 Unclassified 1021
56 Ga0207708_10922956 3300026075 Bacteria 756
57 Ga0207702_10002532 3300026078 Bacteria 17191
58 Ga0207702_10017384 3300026078 Bacteria 5950
59 Ga0207702_10041394 3300026078 Bacteria 3863
60 Ga0207676_11232484 3300026095 Unclassified 742
61 Ga0207674_10282430 3300026116 Unclassified 1608
62 Ga0265337_1001077 3300028556 Bacteria 14073
63 Ga0265337_1010831 3300028556 Bacteria 3172
64 Ga0265319_1001725 3300028563 Bacteria 12582
65 Ga0265319_1005070 3300028563 Bacteria 6402
66 Ga0265319_1027314 3300028563 Bacteria 2026
67 Ga0265318_10003813 3300028577 Bacteria 7475
68 Ga0265318_10022784 3300028577 Bacteria 2501
69 Ga0265318_10069050 3300028577 Unclassified 1310
70 Ga0265318_10077005 3300028577 Viruses 1233
71 Ga0265323_10016058 3300028653 Bacteria 2931
72 Ga0265323_10124276 3300028653 Unclassified 839
73 Ga0265338_10000070 3300028800 Bacteria 185904
74 Ga0265338_10001270 3300028800 Bacteria 41574
75 Ga0265338_10001853 3300028800 Bacteria 33209
76 Ga0265338_10003238 3300028800 Bacteria 23176
77 Ga0265338_10024756 3300028800 Bacteria 6119
78 Ga0265338_10026693 3300028800 Bacteria 5814
79 Ga0265338_10028583 3300028800 Bacteria 5556
80 Ga0265338_10044693 3300028800 Bacteria 4084
81 Ga0265338_10267866 3300028800 Bacteria 1253
82 Ga0265338_10320986 3300028800 Bacteria 1121
83 Ga0265324_10000318 3300029957 Bacteria 35429
84 Ga0265324_10001213 3300029957 Bacteria 15275
85 Ga0265324_10004871 3300029957 Bacteria 5912
86 Ga0265324_10007188 3300029957 Bacteria 4546
87 Ga0265324_10035426 3300029957 Bacteria 1737
88 Ga0265324_10070091 3300029957 Bacteria 1194
89 Ga0265324_10100086 3300029957 Unclassified 985
90 Ga0265328_10013956 3300031239 Bacteria 3170
91 Ga0265328_10044979 3300031239 Unclassified 1624
92 Ga0265328_10158667 3300031239 Bacteria 852
93 Ga0265320_10001765 3300031240 Bacteria 15332
94 Ga0265320_10019588 3300031240 Bacteria 3695
95 Ga0265320_10021075 3300031240 Bacteria 3515
96 Ga0265320_10024822 3300031240 Bacteria 3162
97 Ga0265320_10032853 3300031240 Bacteria 2653
98 Ga0265320_10053001 3300031240 Bacteria 1962
99 Ga0265320_10073700 3300031240 Bacteria 1604
100 Ga0265325_10002995 3300031241 Bacteria 11209
101 Ga0265325_10026739 3300031241 Bacteria 3123
102 Ga0265325_10107566 3300031241 Bacteria 1359
103 Ga0265340_10011274 3300031247 Bacteria 4758
104 Ga0265339_10053263 3300031249 Bacteria 2201
105 Ga0265339_10056136 3300031249 Bacteria 2133
106 Ga0265339_10091362 3300031249 Bacteria 1595
107 Ga0265339_10135345 3300031249 Bacteria 1257
108 Ga0265327_10000037 3300031251 Bacteria 293502
109 Ga0265327_10005255 3300031251 Bacteria 10906
110 Ga0265327_10006542 3300031251 Bacteria 9274
111 Ga0265327_10025034 3300031251 Bacteria 3489
112 Ga0265327_10076876 3300031251 Bacteria 1658
113 Ga0265327_10102262 3300031251 Bacteria 1381
114 Ga0265316_10011090 3300031344 Bacteria 8163
115 Ga0265316_10014083 3300031344 Bacteria 7060
116 Ga0265316_10021981 3300031344 Bacteria 5390
117 Ga0265313_10001134 3300031595 Bacteria 25446
118 Ga0265313_10002400 3300031595 Bacteria 16224
119 Ga0265313_10005027 3300031595 Bacteria 9867
120 Ga0265313_10010219 3300031595 Bacteria 5972
121 Ga0265313_10050488 3300031595 Bacteria 1995
122 Ga0265314_10034652 3300031711 Bacteria 3686
123 Ga0265314_10038513 3300031711 Bacteria 3452
124 Ga0265342_10007765 3300031712 Bacteria 7807
125 Ga0265342_10008033 3300031712 Bacteria 7631
126 Ga0265342_10168229 3300031712 Bacteria 1208
127 Ga0373930_0000914 3300034816 Bacteria 4212
128 Ga0373926_0185474 3300035083 Unclassified 798
129 Ga0373928_0000157 3300035084 Bacteria 12999
130 Ga0373929_0000534 3300035085 Bacteria 7314
131 Ga0373944_0083037 3300035089 Bacteria 1061
132 Ga0373951_0005388 3300035091 Bacteria 2975
133 Ga0373923_0097533 3300035111 Bacteria 1293
134 Ga0373932_0000009 3300035112 Bacteria 156439
135 Ga0373945_0041392 3300035116 Bacteria 1665
136 Ga0373953_0073281 3300035117 Bacteria 1415
137 Ga0373957_0003480 3300035120 Bacteria 4659
138 Ga0373955_0101610 3300035172 Bacteria 1651
139 Ga0373962_0000011 3300035242 Bacteria 52540
140 Ga0373924_0038230 3300035410 Bacteria 1957
141 Ga0373931_0000030 3300035691 Bacteria 116251
142 Ga0373935_0029657 3300035692 Bacteria 3386
143 Ga0373935_0142962 3300035692 Bacteria 1618
144 Ga0373935_0593195 3300035692 Bacteria 810
145 Ga0373927_0005759 3300035695 Bacteria 8507
146 Ga0373927_0015425 3300035695 Bacteria 5050
147 Ga0373933_0104770 3300035724 Unclassified 1758
148 Ga0373947_0252675 3300035725 Bacteria 1166
149 Ga0373937_0075348 3300036401 Bacteria 3114
150 Ga0373925_0000423 3300037068 Bacteria 42927
151 Ga0373925_0081333 3300037068 Bacteria 2463
152 Ga0451577_0001253 3300042876 Bacteria 35102
153 Ga0451577_0002685 3300042876 Bacteria 20750
154 Ga0451577_0004425 3300042876 Bacteria 14827
155 Ga0451577_0016524 3300042876 Bacteria 6832
156 Ga0451577_0017242 3300042876 Bacteria 6676
157 Ga0451577_0096666 3300042876 Bacteria 2637
158 Ga0451577_0101633 3300042876 Bacteria 2569
159 Ga0451577_0192491 3300042876 Bacteria 1840
160 Ga0451577_0291770 3300042876 Bacteria 1478
161 Ga0451577_0358169 3300042876 Unclassified 1323
162 Ga0451577_0581993 3300042876 Bacteria 1016
163 Ga0451577_0870197 3300042876 Bacteria 812
164 Ga0451577_0907582 3300042876 Bacteria 793
165 Ga0466969_0196951 3300044656 Bacteria 919
166 Ga0453683_0001205 3300044673 Bacteria 23299
167 Ga0453683_0019705 3300044673 Bacteria 4318
168 Ga0466966_0027203 3300044684 Bacteria 3730
169 Ga0453684_0000001 3300044712 Bacteria 2623166
170 Ga0453684_0023126 3300044712 Bacteria 9174
171 Ga0453684_0040538 3300044712 Bacteria 6321
172 Ga0453684_0062376 3300044712 Bacteria 4775
173 Ga0453684_0070653 3300044712 Bacteria 4420
174 Ga0453684_0213053 3300044712 Bacteria 2244
175 Ga0453684_0352124 3300044712 Bacteria 1660
176 Ga0451576_0003519 3300045051 Bacteria 21390
177 Ga0451576_0003943 3300045051 Bacteria 19801
178 Ga0451576_0035307 3300045051 Bacteria 5305
179 Ga0451576_0038871 3300045051 Bacteria 5036
180 Ga0451576_0115877 3300045051 Bacteria 2790
181 Ga0451576_0163287 3300045051 Bacteria 2324
182 Ga0451576_0165227 3300045051 Bacteria 2310
183 Ga0451576_0341983 3300045051 Bacteria 1566
184 Ga0495592_0017135 3300046454 Bacteria 5501
185 Ga0495651_0023050 3300046462 Bacteria 4842
186 Ga0495608_0007857 3300046511 Bacteria 7496
187 Ga0495608_0008024 3300046511 Bacteria 7420
188 Ga0495628_0029613 3300046516 Bacteria 4437
189 Ga0495630_0016246 3300046517 Bacteria 5438
190 Ga0495652_0106124 3300046529 Bacteria 2269
191 Ga0495586_0184193 3300046535 Unclassified 1182
192 Ga0495587_0031258 3300046536 Bacteria 3224
193 Ga0495667_0000137 3300046559 Bacteria 50461
194 Ga0495667_0035982 3300046559 Bacteria 3306
195 Ga0495657_0043747 3300046675 Bacteria 3051
196 Ga0495658_0203401 3300046683 Bacteria 1235
197 Ga0495658_0477640 3300046683 Bacteria 797
198 Ga0495600_0143640 3300046809 Bacteria 1548
199 Ga0495680_0028258 3300047322 Bacteria 4599
200 Ga0495684_0471892 3300047471 Unclassified 868
201 Ga0501031_0000363 3300049568 Bacteria 26427
202 Ga0501032_0039850 3300049569 Unclassified 3194
203 Ga0501033_0044306 3300049570 Unclassified 3312
204 Ga0501033_0293976 3300049570 Bacteria 1145
205 Ga0501037_0102429 3300049573 Bacteria 2065
206 Ga0501038_0475993 3300049574 Bacteria 958
207 Ga0501046_0625963 3300049580 Bacteria 762
208 Ga0501047_0004666 3300049581 Bacteria 12893
209 Ga0501047_0259240 3300049581 Unclassified 1587
210 Ga0501070_0217321 3300049586 Bacteria 1568
211 Ga0501074_0290042 3300049590 Unclassified 1163
212 Ga0501083_0003102 3300049744 Bacteria 11556
213 Ga0501035_0022429 3300049822 Bacteria 5798
214 Ga0501035_0253825 3300049822 Bacteria 1492
215 Ga0501044_0001696 3300049823 Bacteria 25845
216 Ga0501044_0033456 3300049823 Bacteria 5402
217 nmdc:mga09592_254791_c1 3300050508 Unclassified 1521
218 nmdc:mga08y16_681465_c1 3300050511 Unclassified 1029
219 Ga0495595_0006595 3300053084 Bacteria 4738
220 Ga0495619_0172428 3300053085 Bacteria 1496
221 2788434594 2786546940 Bacteria 6396474
222 Ga0097621_100357595
223 rootH2_10031556
224 Ga0070683_100026868
225 Ga0070690_100243321
226 Ga0070689_100095771
227 Ga0070689_100511604
228 Ga0070687_100310820
229 Ga0070675_100055018
230 Ga0070675_100147391
231 Ga0070714_100008520
232 Ga0070713_100908107
233 Ga0070705_100104052
234 Ga0070705_100431040
235 Ga0070694_100001722
236 Ga0070694_100362891
237 Ga0070707_100428672
238 Ga0070698_100001600
239 Ga0070686_100002365
240 Ga0070665_101098778
241 Ga0070704_100015137
242 Ga0068855_100023090
243 Ga0068855_100523678
244 Ga0068857_100099477
245 Ga0068856_100000641
246 Ga0068856_100022908
247 Ga0068856_100094064
248 Ga0068859_100127790
249 Ga0068859_100247608
250 Ga0075428_100174040
251 Ga0075429_100264589
252 Ga0097620_100127778
253 Ga0097620_100247609
254 Ga0105240_10466998
255 Ga0111539_10755201
256 Ga0114129_10575846
257 Ga0105237_10615102
258 Ga0157369_10121338
259 Ga0163163_10156636
260 Ga0163163_10220510
261 Ga0163163_10837091
262 Ga0163163_11175732
263 Ga0157376_10763283
264 Ga0207695_10368751
265 Ga0207671_10469848
266 Ga0207662_10447691
267 Ga0207659_10143587
268 Ga0207700_10509263
269 Ga0207700_10722430
270 Ga0207664_10013692
271 Ga0207670_10029912
272 Ga0207670_10462831
273 Ga0207661_10131889
274 Ga0207667_10031151
275 Ga0207667_10662380
276 Ga0207708_10497986
277 Ga0207708_10922956
278 Ga0207702_10002532
279 Ga0207702_10017384
280 Ga0207702_10041394
281 Ga0207676_11232484
282 Ga0207674_10282430
283 Ga0265337_1001077
284 Ga0265337_1010831
285 Ga0265319_1001725
286 Ga0265319_1005070
287 Ga0265319_1027314
288 Ga0265318_10003813
289 Ga0265318_10022784
290 Ga0265318_10069050
291 Ga0265318_10077005
292 Ga0265323_10016058
293 Ga0265323_10124276
294 Ga0265338_10000070
295 Ga0265338_10001270
296 Ga0265338_10001853
297 Ga0265338_10003238
298 Ga0265338_10024756
299 Ga0265338_10026693
300 Ga0265338_10028583
301 Ga0265338_10044693
302 Ga0265338_10267866
303 Ga0265338_10320986
304 Ga0265324_10000318
305 Ga0265324_10001213
306 Ga0265324_10004871
307 Ga0265324_10007188
308 Ga0265324_10035426
309 Ga0265324_10070091
310 Ga0265324_10100086
311 Ga0265328_10013956
312 Ga0265328_10044979
313 Ga0265328_10158667
314 Ga0265320_10001765
315 Ga0265320_10019588
316 Ga0265320_10021075
317 Ga0265320_10024822
318 Ga0265320_10032853
319 Ga0265320_10053001
320 Ga0265320_10073700
321 Ga0265325_10002995
322 Ga0265325_10026739
323 Ga0265325_10107566
324 Ga0265340_10011274
325 Ga0265339_10053263
326 Ga0265339_10056136
327 Ga0265339_10091362
328 Ga0265339_10135345
329 Ga0265327_10000037
330 Ga0265327_10005255
331 Ga0265327_10006542
332 Ga0265327_10025034
333 Ga0265327_10076876
334 Ga0265327_10102262
335 Ga0265316_10011090
336 Ga0265316_10014083
337 Ga0265316_10021981
338 Ga0265313_10001134
339 Ga0265313_10002400
340 Ga0265313_10005027
341 Ga0265313_10010219
342 Ga0265313_10050488
343 Ga0265314_10034652
344 Ga0265314_10038513
345 Ga0265342_10007765
346 Ga0265342_10008033
347 Ga0265342_10168229
348 Ga0373930_0000914
349 Ga0373926_0185474
350 Ga0373928_0000157
351 Ga0373929_0000534
352 Ga0373944_0083037
353 Ga0373951_0005388
354 Ga0373923_0097533
355 Ga0373932_0000009
356 Ga0373945_0041392
357 Ga0373953_0073281
358 Ga0373957_0003480
359 Ga0373955_0101610
360 Ga0373962_0000011
361 Ga0373924_0038230
362 Ga0373931_0000030
363 Ga0373935_0029657
364 Ga0373935_0142962
365 Ga0373935_0593195
366 Ga0373927_0005759
367 Ga0373927_0015425
368 Ga0373933_0104770
369 Ga0373947_0252675
370 Ga0373937_0075348
371 Ga0373925_0000423
372 Ga0373925_0081333
373 Ga0451577_0001253
374 Ga0451577_0002685
375 Ga0451577_0004425
376 Ga0451577_0016524
377 Ga0451577_0017242
378 Ga0451577_0096666
379 Ga0451577_0101633
380 Ga0451577_0192491
381 Ga0451577_0291770
382 Ga0451577_0358169
383 Ga0451577_0581993
384 Ga0451577_0870197
385 Ga0451577_0907582
386 Ga0466969_0196951
387 Ga0453683_0001205
388 Ga0453683_0019705
389 Ga0466966_0027203
390 Ga0453684_0000001
391 Ga0453684_0023126
392 Ga0453684_0040538
393 Ga0453684_0062376
394 Ga0453684_0070653
395 Ga0453684_0213053
396 Ga0453684_0352124
397 Ga0451576_0003519
398 Ga0451576_0003943
399 Ga0451576_0035307
400 Ga0451576_0038871
401 Ga0451576_0115877
402 Ga0451576_0163287
403 Ga0451576_0165227
404 Ga0451576_0341983
405 Ga0495592_0017135
406 Ga0495651_0023050
407 Ga0495608_0007857
408 Ga0495608_0008024
409 Ga0495628_0029613
410 Ga0495630_0016246
411 Ga0495652_0106124
412 Ga0495586_0184193
413 Ga0495587_0031258
414 Ga0495667_0000137
415 Ga0495667_0035982
416 Ga0495657_0043747
417 Ga0495658_0203401
418 Ga0495658_0477640
419 Ga0495600_0143640
420 Ga0495680_0028258
421 Ga0495684_0471892
422 Ga0501031_0000363
423 Ga0501032_0039850
424 Ga0501033_0044306
425 Ga0501033_0293976
426 Ga0501037_0102429
427 Ga0501038_0475993
428 Ga0501046_0625963
429 Ga0501047_0004666
430 Ga0501047_0259240
431 Ga0501070_0217321
432 Ga0501074_0290042
433 Ga0501083_0003102
434 Ga0501035_0022429
435 Ga0501035_0253825
436 Ga0501044_0001696
437 Ga0501044_0033456
438 nmdc:mga09592_254791_c1
439 nmdc:mga08y16_681465_c1
440 Ga0495595_0006595
441 Ga0495619_0172428
442 2788434594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e9g-assembly1.cif.gz_J mycobacterial respiratory complex i with both quinone positions modelled 0.5038 1 181
7mtq-assembly1.cif.gz_A cryoem structure of full-length mglu2 in inactive-state bound to antagonist ly341495 0.4504 96 193
7fd8-assembly1.cif.gz_B thermostabilised full length human mglur5-5m bound with l-quisqualic acid 0.4437 86 197
7r47-assembly1.cif.gz_M bovine complex i in the presence of im1761092, deactive class iii (composite map) 0.4386 4 168
7r4f-assembly1.cif.gz_M bovine complex i in the presence of im1761092, slack class i (composite map) 0.4357 4 169
ID Description Score Start End Superfamily
af_Q2FVZ3_1_83_1.10.287.90 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5626 98 168 1.10.287.90
af_P0AEW1_127_216_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5586 131 216 1.10.287.3510
af_P0AEW1_127_216_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5332 131 216 1.10.287.3510
af_Q2FVZ3_1_83_1.10.287.90 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4863 98 168 1.10.287.90
2rldC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.4525 102 195 1.20.1440.60
ID Description Score Start End GO Terms
AF-E1JX74-F1-model_v4 Putative hydrogenase-4 component E 0.9521 6 207 GO:0005886
AF-A0A550J5A1-F1-model_v4 Hydrogenase 0.9396 5 216 GO:0005886
AF-A0A1F9P3R1-F1-model_v4 Hydrogenase 0.9375 1 216 GO:0005886
AF-A0A7Y3K131-F1-model_v4 Hydrogenase 0.9371 5 216 GO:0005886
AF-A0A1Q7Z6Z8-F1-model_v4 Hydrogenase 0.933 8 216 GO:0005886

Map