F333162

General Info

Members Datasets Scaffolds Average Seq Length
221 142 438 132

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100356416|Ga0070695_1003564161
Length 133
Sequence VKYILMMTGTKADFDWYAAWPNQDLQAQFAFMHALNRELKDSGALVAAEGLAFPDEARVVRAGSDGEPVVSKGVTFPESKEFLAGFWIVDVESPEQAYRIAARASAAPGPGGKPGNIPIEVRQIMGGTPRDTP

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 7.24
Rhizosphere 88.69
Stem 0
Stem Tuber 0
Unclassified 17.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100356416 3300005545 Bacteria 1097
2 Ga0068869_100134090 3300005334 Bacteria 1906
3 Ga0070660_101499448 3300005339 Bacteria 573
4 Ga0070668_100299076 3300005347 Bacteria 1349
5 Ga0070675_100005983 3300005354 Bacteria 9321
6 Ga0070673_101058391 3300005364 Bacteria 757
7 Ga0070667_100328592 3300005367 Bacteria 1381
8 Ga0070667_100788308 3300005367 Bacteria 882
9 Ga0070667_101195946 3300005367 Bacteria 711
10 Ga0070710_11091186 3300005437 Unclassified 585
11 Ga0070705_100050541 3300005440 Bacteria 2419
12 Ga0070694_100881121 3300005444 Unclassified 738
13 Ga0070708_100414085 3300005445 Bacteria 1271
14 Ga0070708_100752889 3300005445 Bacteria 916
15 Ga0070663_100839934 3300005455 Bacteria 790
16 Ga0070681_11005232 3300005458 Bacteria 754
17 Ga0068867_100502063 3300005459 Bacteria 1043
18 Ga0070685_10435667 3300005466 Bacteria 915
19 Ga0070707_100193727 3300005468 Bacteria 1982
20 Ga0070707_100342674 3300005468 Bacteria 1452
21 Ga0070698_100126663 3300005471 Bacteria 2511
22 Ga0070698_101119983 3300005471 Bacteria 736
23 Ga0070697_100093888 3300005536 Bacteria 2485
24 Ga0070697_100794786 3300005536 Unclassified 837
25 Ga0070686_100000040 3300005544 Bacteria 104772
26 Ga0070686_100088197 3300005544 Bacteria 2070
27 Ga0070695_100057058 3300005545 Bacteria 2522
28 Ga0070693_100543768 3300005547 Bacteria 830
29 Ga0070665_100001095 3300005548 Bacteria 33482
30 Ga0070665_100273752 3300005548 Bacteria 1690
31 Ga0070665_100369972 3300005548 Bacteria 1440
32 Ga0070704_100027822 3300005549 Bacteria 3755
33 Ga0070704_100305183 3300005549 Bacteria 1328
34 Ga0068855_100132125 3300005563 Bacteria 2850
35 Ga0070664_102311743 3300005564 Bacteria 510
36 Ga0068859_100193901 3300005617 Bacteria 2116
37 Ga0068859_100311434 3300005617 Bacteria 1668
38 Ga0068864_100405146 3300005618 Bacteria 1297
39 Ga0068861_100009046 3300005719 Bacteria 6866
40 Ga0068861_100486998 3300005719 Bacteria 1112
41 Ga0068861_101392627 3300005719 Unclassified 685
42 Ga0068863_100030868 3300005841 Bacteria 5118
43 Ga0068858_100181523 3300005842 Bacteria 1987
44 Ga0068858_100185771 3300005842 Bacteria 1963
45 Ga0068858_101480136 3300005842 Unclassified 669
46 Ga0068860_100770066 3300005843 Bacteria 975
47 Ga0068860_100890135 3300005843 Bacteria 906
48 Ga0070717_10586666 3300006028 Bacteria 1011
49 Ga0070715_10032660 3300006163 Bacteria 2122
50 Ga0097621_100179302 3300006237 Bacteria 1830
51 Ga0068871_100071749 3300006358 Bacteria 2849
52 Ga0075428_100481750 3300006844 Bacteria 1328
53 Ga0075433_10262299 3300006852 Unclassified 1531
54 Ga0075429_100047446 3300006880 Bacteria 3737
55 Ga0068865_100154327 3300006881 Bacteria 1745
56 Ga0068865_100345418 3300006881 Bacteria 1204
57 Ga0097620_100193905 3300006931 Bacteria 2116
58 Ga0097620_100311426 3300006931 Bacteria 1668
59 Ga0105240_10093670 3300009093 Bacteria 3666
60 Ga0105240_10450619 3300009093 Unclassified 1440
61 Ga0105245_10019367 3300009098 Bacteria 5960
62 Ga0105245_10033247 3300009098 Bacteria 4569
63 Ga0105245_12714128 3300009098 Unclassified 548
64 Ga0114129_10076413 3300009147 Bacteria 4662
65 Ga0114129_10084489 3300009147 Bacteria 4407
66 Ga0114129_10118078 3300009147 Bacteria 3654
67 Ga0114129_10284678 3300009147 Bacteria 2208
68 Ga0105243_10470857 3300009148 Bacteria 1183
69 Ga0105243_10559510 3300009148 Bacteria 1094
70 Ga0105243_12997250 3300009148 Unclassified 512
71 Ga0105241_10011300 3300009174 Bacteria 6546
72 Ga0105241_10391538 3300009174 Bacteria 1217
73 Ga0105241_10430704 3300009174 Bacteria 1163
74 Ga0105242_10002522 3300009176 Bacteria 14359
75 Ga0105242_11675156 3300009176 Bacteria 671
76 Ga0105248_10046282 3300009177 Bacteria 4875
77 Ga0105248_10128911 3300009177 Bacteria 2854
78 Ga0105248_10217056 3300009177 Bacteria 2154
79 Ga0105248_10292762 3300009177 Bacteria 1833
80 Ga0105237_10209771 3300009545 Bacteria 1948
81 Ga0105237_11866129 3300009545 Unclassified 609
82 Ga0105238_10000034 3300009551 Bacteria 168690
83 Ga0105238_10244597 3300009551 Bacteria 1772
84 Ga0105238_10359260 3300009551 Bacteria 1446
85 Ga0105249_10375613 3300009553 Bacteria 1446
86 Ga0105249_10959481 3300009553 Bacteria 923
87 Ga0105239_10016102 3300010375 Bacteria 8272
88 Ga0105239_10364715 3300010375 Bacteria 1632
89 Ga0105239_11851080 3300010375 Unclassified 700
90 Ga0157370_10541525 3300013104 Bacteria 1067
91 Ga0157369_10141935 3300013105 Bacteria 2541
92 Ga0157374_10097300 3300013296 Bacteria 2816
93 Ga0157374_10335681 3300013296 Bacteria 1500
94 Ga0157378_10030722 3300013297 Bacteria 4744
95 Ga0157378_10330193 3300013297 Unclassified 1484
96 Ga0157378_10412905 3300013297 Bacteria 1333
97 Ga0163162_10063008 3300013306 Bacteria 3749
98 Ga0157375_10043930 3300013308 Bacteria 4337
99 Ga0163163_10033031 3300014325 Bacteria 5002
100 Ga0163163_11258952 3300014325 Bacteria 802
101 Ga0157379_10019840 3300014968 Bacteria 5939
102 Ga0157376_10007035 3300014969 Bacteria 7985
103 Ga0157376_10635414 3300014969 Unclassified 1066
104 Ga0157376_10659546 3300014969 Bacteria 1047
105 Ga0213874_10055875 3300021377 Bacteria 1224
106 Ga0213875_10092515 3300021388 Unclassified 1410
107 Ga0207680_10522457 3300025903 Bacteria 846
108 Ga0207654_10174046 3300025911 Bacteria 1400
109 Ga0207654_10279142 3300025911 Bacteria 1129
110 Ga0207654_10559727 3300025911 Unclassified 813
111 Ga0207695_10047125 3300025913 Bacteria 4564
112 Ga0207695_10300690 3300025913 Bacteria 1496
113 Ga0207657_11063652 3300025919 Bacteria 619
114 Ga0207646_10104361 3300025922 Bacteria 2542
115 Ga0207646_10278123 3300025922 Bacteria 1513
116 Ga0207681_10637682 3300025923 Bacteria 883
117 Ga0207681_11874235 3300025923 Bacteria 500
118 Ga0207694_10000042 3300025924 Bacteria 177961
119 Ga0207694_10036917 3300025924 Bacteria 3750
120 Ga0207694_11428608 3300025924 Unclassified 584
121 Ga0207659_10055408 3300025926 Bacteria 2836
122 Ga0207687_10106318 3300025927 Bacteria 2074
123 Ga0207687_10697223 3300025927 Bacteria 862
124 Ga0207687_11711840 3300025927 Bacteria 539
125 Ga0207686_10084797 3300025934 Bacteria 2076
126 Ga0207709_10409957 3300025935 Bacteria 1038
127 Ga0207709_11603491 3300025935 Bacteria 541
128 Ga0207704_10242547 3300025938 Bacteria 1347
129 Ga0207704_10286486 3300025938 Bacteria 1255
130 Ga0207711_10219825 3300025941 Bacteria 1737
131 Ga0207711_10476966 3300025941 Unclassified 1162
132 Ga0207679_11956665 3300025945 Unclassified 534
133 Ga0207651_11630341 3300025960 Bacteria 581
134 Ga0207712_10691676 3300025961 Bacteria 889
135 Ga0207668_10457711 3300025972 Bacteria 1090
136 Ga0207658_11493383 3300025986 Bacteria 618
137 Ga0207677_10158509 3300026023 Unclassified 1755
138 Ga0207677_10312999 3300026023 Bacteria 1302
139 Ga0207703_10123573 3300026035 Bacteria 2225
140 Ga0207703_10173289 3300026035 Bacteria 1899
141 Ga0207703_11755599 3300026035 Bacteria 597
142 Ga0207678_10798629 3300026067 Bacteria 833
143 Ga0207702_10071535 3300026078 Bacteria 2987
144 Ga0207641_10008092 3300026088 Bacteria 8710
145 Ga0207641_10031141 3300026088 Bacteria 4423
146 Ga0207641_10383177 3300026088 Bacteria 1347
147 Ga0207648_10192119 3300026089 Bacteria 1810
148 Ga0207676_10032782 3300026095 Bacteria 3919
149 Ga0207675_100029490 3300026118 Bacteria 5112
150 Ga0207675_100547863 3300026118 Bacteria 1156
151 Ga0207675_101777622 3300026118 Unclassified 636
152 Ga0268266_10010020 3300028379 Bacteria 8316
153 Ga0268266_10089789 3300028379 Bacteria 2692
154 Ga0268265_11047457 3300028380 Unclassified 808
155 Ga0268264_10407568 3300028381 Bacteria 1308
156 Ga0268264_10831574 3300028381 Bacteria 924
157 Ga0265760_10066797 3300031090 Unclassified 1099
158 Ga0307509_10411618 3300031507 Bacteria 1056
159 Ga0307509_10560062 3300031507 Bacteria 820
160 Ga0307408_100210649 3300031548 Bacteria 1579
161 Ga0373930_0026487 3300034816 Bacteria 1169
162 Ga0373926_0123315 3300035083 Bacteria 978
163 Ga0373944_0090473 3300035089 Bacteria 1022
164 Ga0373927_0067760 3300035695 Bacteria 2309
165 Ga0373933_0139258 3300035724 Unclassified 1531
166 Ga0373933_0277431 3300035724 Unclassified 1083
167 Ga0373947_0718971 3300035725 Bacteria 681
168 Ga0373937_0086382 3300036401 Bacteria 2903
169 Ga0373925_0006818 3300037068 Bacteria 8365
170 Ga0436364_0160673 3300037853 Unclassified 1881
171 Ga0436364_1227584 3300037853 Bacteria 894
172 Ga0436365_1521306 3300039437 Bacteria 2261
173 Ga0436360_0774922 3300039438 Unclassified 2690
174 Ga0436360_0941068 3300039438 Unclassified 849
175 Ga0436360_1299073 3300039438 Bacteria 550
176 Ga0436361_0661194 3300039447 Unclassified 794
177 Ga0436362_0122743 3300039453 Bacteria 1150
178 Ga0451853_0814674 3300041512 Bacteria 635
179 Ga0466957_0320376 3300044842 Bacteria 1046
180 Ga0451576_0858564 3300045051 Bacteria 953
181 Ga0495651_0683483 3300046462 Bacteria 641
182 Ga0495628_0446531 3300046516 Unclassified 940
183 Ga0495630_0953108 3300046517 Bacteria 653
184 Ga0495643_0000043 3300046522 Bacteria 226821
185 Ga0495652_0726513 3300046529 Bacteria 666
186 Ga0495587_0030826 3300046536 Bacteria 3251
187 Ga0495669_0022742 3300046684 Bacteria 2724
188 Ga0495600_0394556 3300046809 Unclassified 862
189 Ga0495676_0597178 3300047321 Bacteria 719
190 Ga0495684_0462428 3300047471 Unclassified 879
191 Ga0495602_0354690 3300048088 Bacteria 1058
192 Ga0496100_0038310 3300048903 Bacteria 3037
193 Ga0496101_0023993 3300048904 Bacteria 4219
194 Ga0496102_0358308 3300048905 Bacteria 1373
195 Ga0496103_0283559 3300048906 Bacteria 1065
196 Ga0496104_0721212 3300048907 Bacteria 904
197 Ga0496105_0587075 3300048908 Bacteria 866
198 Ga0496106_0025112 3300048909 Bacteria 4432
199 Ga0496106_0164574 3300048909 Unclassified 1755
200 Ga0496107_0125466 3300048910 Bacteria 1893
201 Ga0496107_0192617 3300048910 Bacteria 1515
202 Ga0496108_1538061 3300048911 Unclassified 552
203 Ga0496109_0169162 3300048912 Bacteria 2050
204 Ga0496109_1376341 3300048912 Unclassified 641
205 Ga0496112_1212015 3300048915 Bacteria 671
206 Ga0496114_0206836 3300048917 Unclassified 1720
207 Ga0496115_0200972 3300048918 Bacteria 1646
208 nmdc:mga05p37_133983_c1 3300050507 Bacteria 3039
209 nmdc:mga05p37_416790_c1 3300050507 Bacteria 1564
210 nmdc:mga05p37_418334_c1 3300050507 Bacteria 1560
211 nmdc:mga05p37_847397_c1 3300050507 Unclassified 993
212 nmdc:mga09592_92778_c1 3300050508 Bacteria 2581
213 nmdc:mga0n895_1783935_c1 3300050512 Bacteria 576
214 nmdc:mga0a205_1074566_c1 3300050515 Unclassified 652
215 Ga0495601_0238684 3300053077 Unclassified 1187
216 Ga0495612_0357302 3300053078 Bacteria 660
217 Ga0495595_0175440 3300053084 Bacteria 1062
218 Ga0495619_0174191 3300053085 Bacteria 1488
219 Ga0500554_017303 3300053102 Bacteria 1924
220 Ga0070695_100356416
221 Ga0068869_100134090
222 Ga0070660_101499448
223 Ga0070668_100299076
224 Ga0070675_100005983
225 Ga0070673_101058391
226 Ga0070667_100328592
227 Ga0070667_100788308
228 Ga0070667_101195946
229 Ga0070710_11091186
230 Ga0070705_100050541
231 Ga0070694_100881121
232 Ga0070708_100414085
233 Ga0070708_100752889
234 Ga0070663_100839934
235 Ga0070681_11005232
236 Ga0068867_100502063
237 Ga0070685_10435667
238 Ga0070707_100193727
239 Ga0070707_100342674
240 Ga0070698_100126663
241 Ga0070698_101119983
242 Ga0070697_100093888
243 Ga0070697_100794786
244 Ga0070686_100000040
245 Ga0070686_100088197
246 Ga0070695_100057058
247 Ga0070693_100543768
248 Ga0070665_100001095
249 Ga0070665_100273752
250 Ga0070665_100369972
251 Ga0070704_100027822
252 Ga0070704_100305183
253 Ga0068855_100132125
254 Ga0070664_102311743
255 Ga0068859_100193901
256 Ga0068859_100311434
257 Ga0068864_100405146
258 Ga0068861_100009046
259 Ga0068861_100486998
260 Ga0068861_101392627
261 Ga0068863_100030868
262 Ga0068858_100181523
263 Ga0068858_100185771
264 Ga0068858_101480136
265 Ga0068860_100770066
266 Ga0068860_100890135
267 Ga0070717_10586666
268 Ga0070715_10032660
269 Ga0097621_100179302
270 Ga0068871_100071749
271 Ga0075428_100481750
272 Ga0075433_10262299
273 Ga0075429_100047446
274 Ga0068865_100154327
275 Ga0068865_100345418
276 Ga0097620_100193905
277 Ga0097620_100311426
278 Ga0105240_10093670
279 Ga0105240_10450619
280 Ga0105245_10019367
281 Ga0105245_10033247
282 Ga0105245_12714128
283 Ga0114129_10076413
284 Ga0114129_10084489
285 Ga0114129_10118078
286 Ga0114129_10284678
287 Ga0105243_10470857
288 Ga0105243_10559510
289 Ga0105243_12997250
290 Ga0105241_10011300
291 Ga0105241_10391538
292 Ga0105241_10430704
293 Ga0105242_10002522
294 Ga0105242_11675156
295 Ga0105248_10046282
296 Ga0105248_10128911
297 Ga0105248_10217056
298 Ga0105248_10292762
299 Ga0105237_10209771
300 Ga0105237_11866129
301 Ga0105238_10000034
302 Ga0105238_10244597
303 Ga0105238_10359260
304 Ga0105249_10375613
305 Ga0105249_10959481
306 Ga0105239_10016102
307 Ga0105239_10364715
308 Ga0105239_11851080
309 Ga0157370_10541525
310 Ga0157369_10141935
311 Ga0157374_10097300
312 Ga0157374_10335681
313 Ga0157378_10030722
314 Ga0157378_10330193
315 Ga0157378_10412905
316 Ga0163162_10063008
317 Ga0157375_10043930
318 Ga0163163_10033031
319 Ga0163163_11258952
320 Ga0157379_10019840
321 Ga0157376_10007035
322 Ga0157376_10635414
323 Ga0157376_10659546
324 Ga0213874_10055875
325 Ga0213875_10092515
326 Ga0207680_10522457
327 Ga0207654_10174046
328 Ga0207654_10279142
329 Ga0207654_10559727
330 Ga0207695_10047125
331 Ga0207695_10300690
332 Ga0207657_11063652
333 Ga0207646_10104361
334 Ga0207646_10278123
335 Ga0207681_10637682
336 Ga0207681_11874235
337 Ga0207694_10000042
338 Ga0207694_10036917
339 Ga0207694_11428608
340 Ga0207659_10055408
341 Ga0207687_10106318
342 Ga0207687_10697223
343 Ga0207687_11711840
344 Ga0207686_10084797
345 Ga0207709_10409957
346 Ga0207709_11603491
347 Ga0207704_10242547
348 Ga0207704_10286486
349 Ga0207711_10219825
350 Ga0207711_10476966
351 Ga0207679_11956665
352 Ga0207651_11630341
353 Ga0207712_10691676
354 Ga0207668_10457711
355 Ga0207658_11493383
356 Ga0207677_10158509
357 Ga0207677_10312999
358 Ga0207703_10123573
359 Ga0207703_10173289
360 Ga0207703_11755599
361 Ga0207678_10798629
362 Ga0207702_10071535
363 Ga0207641_10008092
364 Ga0207641_10031141
365 Ga0207641_10383177
366 Ga0207648_10192119
367 Ga0207676_10032782
368 Ga0207675_100029490
369 Ga0207675_100547863
370 Ga0207675_101777622
371 Ga0268266_10010020
372 Ga0268266_10089789
373 Ga0268265_11047457
374 Ga0268264_10407568
375 Ga0268264_10831574
376 Ga0265760_10066797
377 Ga0307509_10411618
378 Ga0307509_10560062
379 Ga0307408_100210649
380 Ga0373930_0026487
381 Ga0373926_0123315
382 Ga0373944_0090473
383 Ga0373927_0067760
384 Ga0373933_0139258
385 Ga0373933_0277431
386 Ga0373947_0718971
387 Ga0373937_0086382
388 Ga0373925_0006818
389 Ga0436364_0160673
390 Ga0436364_1227584
391 Ga0436365_1521306
392 Ga0436360_0774922
393 Ga0436360_0941068
394 Ga0436360_1299073
395 Ga0436361_0661194
396 Ga0436362_0122743
397 Ga0451853_0814674
398 Ga0466957_0320376
399 Ga0451576_0858564
400 Ga0495651_0683483
401 Ga0495628_0446531
402 Ga0495630_0953108
403 Ga0495643_0000043
404 Ga0495652_0726513
405 Ga0495587_0030826
406 Ga0495669_0022742
407 Ga0495600_0394556
408 Ga0495676_0597178
409 Ga0495684_0462428
410 Ga0495602_0354690
411 Ga0496100_0038310
412 Ga0496101_0023993
413 Ga0496102_0358308
414 Ga0496103_0283559
415 Ga0496104_0721212
416 Ga0496105_0587075
417 Ga0496106_0025112
418 Ga0496106_0164574
419 Ga0496107_0125466
420 Ga0496107_0192617
421 Ga0496108_1538061
422 Ga0496109_0169162
423 Ga0496109_1376341
424 Ga0496112_1212015
425 Ga0496114_0206836
426 Ga0496115_0200972
427 nmdc:mga05p37_133983_c1
428 nmdc:mga05p37_416790_c1
429 nmdc:mga05p37_418334_c1
430 nmdc:mga05p37_847397_c1
431 nmdc:mga09592_92778_c1
432 nmdc:mga0n895_1783935_c1
433 nmdc:mga0a205_1074566_c1
434 Ga0495601_0238684
435 Ga0495612_0357302
436 Ga0495595_0175440
437 Ga0495619_0174191
438 Ga0500554_017303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

111

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8128 1 121
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7359 1 121
5t2k-assembly1.cif.gz_D geobacillus stearothermophilus hemq with manganese-coproporphyrin iii 0.681 2 118
5t2k-assembly1.cif.gz_E geobacillus stearothermophilus hemq with manganese-coproporphyrin iii 0.68 2 118
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.6487 1 122
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8128 1 121 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7359 1 121 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7123 1 128 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6931 1 128 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6635 1 122 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A2U3KA91-F1-model_v4 DGPF domain protein 0.9179 1 127
AF-A0A2U3KA91-F1-model_v4 DGPF domain protein 0.8978 1 127
AF-A0A0K1Q4I0-F1-model_v4 DGPF domain protein 0.8883 1 125
AF-A0A7X0HA82-F1-model_v4 YCII-related domain-containing protein 0.8849 1 125
AF-A0A7W8A739-F1-model_v4 YCII-related domain-containing protein 0.8831 1 122

Map