F332846

General Info

Members Datasets Scaffolds Average Seq Length
220 161 166 414

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3003930520|3003932479
Length 440
Sequence QTAVAPEIKAAPETMTAAFDEFMEAFEAFKDTNDRRLGEIEQKLTADVVTREKMDRISRAMDEQKRVLDQLALKKARPALGRGQPESIETAEHKAAFESYIRRGDETGLRELEAKAMSVGSASDGGYLVPDQTDTEIGRRLSAASPIRALATVRQVSSSVLKKPFATTGMASGWVAETAARPQTNAPQLAELTFPTMELYAMPAATAALLDDAAVEIESWIASEVDVVFSEQEGTAFVSGDGINKPKGFLSYTNVAEASWSWGNIGYIATGNAGAFKASGPSDTLIDTIYALKAGHRQNATFVMNRKTQAEIRKFKDADGNYLWRPPAAPGQAASLAGFPVSEAEDMPDITAGSFSIAFGDFRAGYLVVDRTGVRVLRDPYSAKPYVLIVFTLLLRILFAAVLGRADHEEHYPQTSVLVHPHEYGKADQRRQFAPPDGLV

Samples

Sample ID Description Type Environment
1 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
2 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
3 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
4 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
5 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
6 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
7 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
8 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
9 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
10 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
11 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
12 2643221558 Rhizobium sp. Root149 Isolate Unclassified
13 2643221599 Rhizobium sp. Root708 Isolate Unclassified
14 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
15 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
16 2643221688 Rhizobium sp. Root482 Isolate Unclassified
17 2643221718 Rhizobium sp. Root268 Isolate Unclassified
18 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
19 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
20 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
21 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
22 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
23 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
24 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
25 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
26 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
27 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
28 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
29 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
30 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
31 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
32 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
33 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
34 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
35 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
36 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
37 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
38 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
39 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
40 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
41 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
42 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
43 2996887358 Rhizobium sp. R711 Isolate Nodule
44 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
45 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
146 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
147 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 8005321885 Rhizobium sp. R72 Isolate Nodule
154 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
155 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
156 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
157 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
158 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
159 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
160 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
161 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.45
Metatranscriptomes 0
Isolates 24.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.09
Nodule 8.18
Rhizoplane 2.27
Rhizosphere 53.64
Stem 0
Stem Tuber 0
Unclassified 21.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000201 3300002773 Bacteria 39959
2 JGI25151J46595_10000798 3300003187 Bacteria 25290
3 JGI25153J46596_10000635 3300003215 Bacteria 21459
4 Ga0055524_1023392 3300003775 Bacteria 1991
5 Ga0055528_1000607 3300003790 Bacteria 26876
6 Ga0055528_1022477 3300003790 Bacteria 1963
7 Ga0055530_10017722 3300003791 Bacteria 2219
8 Ga0055531_10001997 3300003794 Bacteria 14175
9 Ga0058692_1001700 3300003856 Bacteria 7885
10 Ga0068869_100132649 3300005334 Bacteria 1916
11 Ga0070682_100050991 3300005337 Bacteria 2585
12 Ga0070689_100232482 3300005340 Bacteria 1516
13 Ga0070703_10000089 3300005406 Unclassified 45878
14 Ga0070708_100038262 3300005445 Bacteria 4191
15 Ga0070663_100052702 3300005455 Bacteria 2902
16 Ga0068858_100035824 3300005842 Bacteria 4602
17 Ga0081455_10016652 3300005937 Bacteria 7084
18 Ga0075364_10010169 3300006051 Bacteria 5674
19 Ga0075431_100011143 3300006847 Bacteria 9050
20 Ga0075429_100038223 3300006880 Bacteria 4179
21 Ga0068865_100059052 3300006881 Bacteria 2681
22 Ga0079104_1000010 3300006946 Bacteria 366021
23 Ga0099826_10027970 3300006948 Bacteria 4133
24 Ga0105250_10000554 3300009092 Unclassified 25400
25 Ga0105243_10014511 3300009148 Bacteria 5960
26 Ga0209129_1000125 3300025258 Bacteria 133506
27 Ga0209673_1000122 3300025273 Bacteria 170443
28 Ga0209673_1002166 3300025273 Bacteria 14522
29 Ga0209676_1011848 3300025292 Bacteria 3478
30 Ga0209025_1000933 3300025294 Bacteria 44572
31 Ga0209564_1002198 3300025295 Bacteria 16300
32 Ga0209758_1000008 3300025297 Bacteria 1215263
33 Ga0209758_1000121 3300025297 Bacteria 192028
34 Ga0209050_1003042 3300025298 Bacteria 12934
35 Ga0209256_1001197 3300025299 Bacteria 29055
36 Ga0209256_1002568 3300025299 Bacteria 14509
37 Ga0209051_1002622 3300025303 Bacteria 12628
38 Ga0209257_1006615 3300025304 Bacteria 7377
39 Ga0207643_10000162 3300025908 Unclassified 46217
40 Ga0207650_10005035 3300025925 Bacteria 9021
41 Ga0207709_10027104 3300025935 Bacteria 3297
42 Ga0207704_10037472 3300025938 Bacteria 2801
43 Ga0207703_10034632 3300026035 Bacteria 4008
44 Ga0207678_10016514 3300026067 Bacteria 6482
45 Ga0207708_10004546 3300026075 Bacteria 10211
46 Ga0209281_1000053 3300027111 Bacteria 309587
47 Ga0209371_1001344 3300027312 Bacteria 17077
48 Ga0268265_10000414 3300028380 Unclassified 45835
49 Ga0307515_10000115 3300028794 Bacteria 193697
50 Ga0307515_10003153 3300028794 Bacteria 34882
51 Ga0307515_10008302 3300028794 Bacteria 20264
52 Ga0265340_10006721 3300031247 Bacteria 6299
53 Ga0265339_10030272 3300031249 Bacteria 3066
54 Ga0307513_10001114 3300031456 Bacteria 38938
55 Ga0307513_10003751 3300031456 Bacteria 20507
56 Ga0265314_10018480 3300031711 Bacteria 5433
57 Ga0307516_10073460 3300031730 Bacteria 3277
58 Ga0307412_10176420 3300031911 Bacteria 1603
59 Ga0439465_0007332 3300041413 Bacteria 3502
60 Ga0450906_011660 3300042145 Bacteria 1640
61 Ga0495638_0029921 3300046460 Bacteria 3510
62 Ga0495638_0063123 3300046460 Bacteria 2285
63 Ga0495606_0010199 3300046507 Bacteria 7831
64 Ga0495606_0014290 3300046507 Bacteria 6208
65 Ga0495632_0004017 3300046519 Bacteria 10165
66 Ga0495632_0035006 3300046519 Bacteria 2566
67 Ga0495654_0000130 3300046530 Bacteria 81643
68 Ga0495597_0065246 3300046542 Bacteria 1580
69 Ga0495622_0002154 3300046557 Bacteria 9589
70 Ga0495633_0039186 3300046558 Bacteria 2262
71 Ga0495611_0154532 3300046648 Bacteria 1071
72 Ga0495686_0000613 3300047472 Bacteria 49253
73 Ga0495686_0001574 3300047472 Bacteria 24183
74 Ga0495686_0056401 3300047472 Bacteria 2455
75 Ga0496100_0166805 3300048903 Bacteria 1583
76 Ga0496102_0038107 3300048905 Bacteria 4337
77 Ga0496121_0000662 3300048924 Bacteria 64326
78 Ga0496121_0002450 3300048924 Bacteria 28361
79 Ga0496121_0014166 3300048924 Bacteria 8491
80 Ga0496121_0016253 3300048924 Bacteria 7697
81 Ga0496121_0016558 3300048924 Bacteria 7605
82 Ga0496121_0150594 3300048924 Bacteria 1712
83 Ga0496121_0213423 3300048924 Bacteria 1365
84 Ga0496122_0004312 3300048925 Bacteria 17816
85 Ga0496122_0032170 3300048925 Bacteria 4343
86 Ga0496122_0130912 3300048925 Bacteria 1594
87 Ga0496123_0032820 3300048926 Bacteria 3749
88 Ga0496123_0101627 3300048926 Bacteria 1671
89 Ga0496124_0018963 3300048927 Bacteria 6422
90 Ga0496124_0133785 3300048927 Bacteria 1966
91 Ga0495678_030144 3300049459 Bacteria 2272
92 Ga0501031_0003659 3300049568 Bacteria 9898
93 Ga0501032_0001523 3300049569 Bacteria 18474
94 Ga0501032_0025410 3300049569 Bacteria 4082
95 Ga0501033_0033983 3300049570 Bacteria 3827
96 Ga0501034_0000033 3300049571 Bacteria 243508
97 Ga0501034_0038563 3300049571 Bacteria 4837
98 Ga0501034_0224975 3300049571 Bacteria 1827
99 Ga0501034_0226589 3300049571 Bacteria 1820
100 Ga0501036_0000541 3300049572 Bacteria 27054
101 Ga0501036_0024696 3300049572 Bacteria 5067
102 Ga0501036_0098417 3300049572 Bacteria 2473
103 Ga0501037_0002782 3300049573 Bacteria 12666
104 Ga0501037_0093988 3300049573 Bacteria 2168
105 Ga0501038_0015843 3300049574 Bacteria 6850
106 Ga0501038_0043987 3300049574 Bacteria 3881
107 Ga0501039_0007943 3300049575 Bacteria 8082
108 Ga0501039_0053737 3300049575 Bacteria 3117
109 Ga0501040_0030773 3300049576 Bacteria 3626
110 Ga0501040_0112947 3300049576 Bacteria 1901
111 Ga0501042_0020836 3300049578 Bacteria 4564
112 Ga0501043_0236672 3300049579 Bacteria 1409
113 Ga0501043_0239086 3300049579 Bacteria 1401
114 Ga0501046_0042041 3300049580 Bacteria 3645
115 Ga0501047_0000339 3300049581 Bacteria 53287
116 Ga0501047_0002040 3300049581 Bacteria 19303
117 Ga0501047_0009380 3300049581 Bacteria 9245
118 Ga0501047_0010697 3300049581 Bacteria 8670
119 Ga0501047_0051474 3300049581 Bacteria 3980
120 Ga0501047_0314474 3300049581 Bacteria 1406
121 Ga0501048_0002404 3300049582 Bacteria 14284
122 Ga0501048_0003449 3300049582 Bacteria 12018
123 Ga0501067_0000670 3300049583 Bacteria 18436
124 Ga0501067_0006893 3300049583 Bacteria 6304
125 Ga0501070_0009335 3300049586 Bacteria 8294
126 Ga0501070_0038890 3300049586 Bacteria 3969
127 Ga0501073_0019342 3300049589 Bacteria 4916
128 Ga0501073_0062721 3300049589 Bacteria 2592
129 Ga0501073_0100525 3300049589 Bacteria 2008
130 Ga0501073_0192145 3300049589 Bacteria 1412
131 Ga0501074_0012788 3300049590 Bacteria 6101
132 Ga0501074_0050471 3300049590 Bacteria 3003
133 Ga0501075_0168449 3300049591 Bacteria 1671
134 Ga0501076_0093971 3300049592 Bacteria 2414
135 Ga0501077_0033441 3300049593 Bacteria 3272
136 Ga0501079_0005367 3300049741 Bacteria 9547
137 Ga0501080_0000005 3300049742 Bacteria 176271
138 Ga0501081_0049931 3300049743 Bacteria 2881
139 Ga0501083_0007168 3300049744 Bacteria 7914
140 Ga0501083_0038092 3300049744 Bacteria 3269
141 Ga0501035_0000314 3300049822 Bacteria 55972
142 Ga0501035_0042914 3300049822 Bacteria 4077
143 Ga0501035_0122681 3300049822 Bacteria 2270
144 Ga0501035_0162279 3300049822 Bacteria 1934
145 Ga0501044_0000019 3300049823 Bacteria 223724
146 Ga0501044_0018038 3300049823 Bacteria 7569
147 Ga0501044_0046730 3300049823 Bacteria 4480
148 Ga0501044_0111801 3300049823 Bacteria 2739
149 Ga0501044_0271652 3300049823 Bacteria 1631
150 Ga0501045_0045996 3300049824 Bacteria 3178
151 Ga0501045_0098835 3300049824 Bacteria 2159
152 Ga0501045_0189346 3300049824 Bacteria 1533
153 nmdc:mga00v17_7772_c1 3300050491 Bacteria 5746
154 nmdc:mga09592_10653_c1 3300050508 Bacteria 7486
155 Ga0500635_0006810 3300053080 Bacteria 3068
156 Ga0500572_006781 3300053111 Bacteria 2631
157 Ga0500618_000055 3300053125 Bacteria 99876
158 Ga0500618_004068 3300053125 Bacteria 4793
159 Ga0500618_004260 3300053125 Bacteria 4634
160 Ga0500616_0010783 3300053153 Bacteria 5448
161 Ga0500622_0011160 3300053156 Bacteria 4905
162 Ga0500636_0000004 3300053177 Bacteria 202392
163 Ga0501084_0024426 3300054114 Bacteria 5041
164 Ga0501082_0010730 3300060353 Bacteria 7885
165 Ga0501082_0026826 3300060353 Bacteria 4964
166 Ga0501082_0106252 3300060353 Bacteria 2428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0002154 Ga0495622_0002154_8582_9565 314
2 3300046648 Ga0495611_0154532 Ga0495611_0154532_42_1025 314
3 3300048926 Ga0496123_0101627 Ga0496123_0101627_359_1441 356
4 3300031456 Ga0307513_10003751 Ga0307513_1000375121 358
5 3300031730 Ga0307516_10073460 Ga0307516_100734602 358
6 3300049589 Ga0501073_0192145 Ga0501073_0192145_140_1378 366
7 3300060353 Ga0501082_0106252 Ga0501082_0106252_768_2021 366
8 3300046542 Ga0495597_0065246 Ga0495597_0065246_70_1320 369
9 3300053080 Ga0500635_0006810 Ga0500635_0006810_171_1421 371
10 3300049582 Ga0501048_0002404 Ga0501048_0002404_7743_8984 375
11 3300049592 Ga0501076_0093971 Ga0501076_0093971_499_1752 377
12 3300005455 Ga0070663_100052702 Ga0070663_1000527021 381
13 3300026067 Ga0207678_10016514 Ga0207678_100165144 381
14 3300048905 Ga0496102_0038107 Ga0496102_0038107_579_1853 381
15 3300049568 Ga0501031_0003659 Ga0501031_0003659_8127_9380 385
16 3300049569 Ga0501032_0025410 Ga0501032_0025410_1133_2386 385
17 3300049571 Ga0501034_0038563 Ga0501034_0038563_3123_4376 385
18 3300049572 Ga0501036_0000541 Ga0501036_0000541_17540_18793 385
19 3300049574 Ga0501038_0043987 Ga0501038_0043987_1777_3030 385
20 3300049575 Ga0501039_0053737 Ga0501039_0053737_71_1324 385
21 3300049580 Ga0501046_0042041 Ga0501046_0042041_128_1381 385
22 3300049581 Ga0501047_0010697 Ga0501047_0010697_30_1283 385
23 3300049581 Ga0501047_0051474 Ga0501047_0051474_1105_2352 385
24 3300049582 Ga0501048_0003449 Ga0501048_0003449_9574_10827 385
25 3300049583 Ga0501067_0000670 Ga0501067_0000670_2389_3642 385
26 3300049586 Ga0501070_0038890 Ga0501070_0038890_984_2237 385
27 3300049589 Ga0501073_0062721 Ga0501073_0062721_167_1420 385
28 3300049590 Ga0501074_0012788 Ga0501074_0012788_3113_4366 385
29 3300049741 Ga0501079_0005367 Ga0501079_0005367_1456_2709 385
30 3300049744 Ga0501083_0007168 Ga0501083_0007168_6597_7850 385
31 3300049822 Ga0501035_0122681 Ga0501035_0122681_702_1949 385
32 3300049823 Ga0501044_0046730 Ga0501044_0046730_1439_2692 385
33 3300049824 Ga0501045_0098835 Ga0501045_0098835_441_1694 385
34 3300054114 Ga0501084_0024426 Ga0501084_0024426_887_2140 385
35 3300060353 Ga0501082_0026826 Ga0501082_0026826_1278_2531 385
36 3300003215 JGI25153J46596_10000635 JGI25153J46596_1000063512 387
37 3300005842 Ga0068858_100035824 Ga0068858_1000358243 387
38 3300025297 Ga0209758_1000008 Ga0209758_1000008736 387
39 3300026035 Ga0207703_10034632 Ga0207703_100346326 387
40 3300042145 Ga0450906_011660 Ga0450906_011660_10_1185 387
41 3300048924 Ga0496121_0002450 Ga0496121_0002450_7473_8744 387
42 3300049571 Ga0501034_0224975 Ga0501034_0224975_529_1791 388
43 3300049579 Ga0501043_0236672 Ga0501043_0236672_41_1303 388
44 3300049581 Ga0501047_0002040 Ga0501047_0002040_9623_10885 388
45 3300005337 Ga0070682_100050991 Ga0070682_1000509912 389
46 3300006948 Ga0099826_10027970 Ga0099826_100279705 392
47 3300046460 Ga0495638_0029921 Ga0495638_0029921_1870_3123 393
48 3300046460 Ga0495638_0063123 Ga0495638_0063123_752_2005 393
49 3300049569 Ga0501032_0001523 Ga0501032_0001523_5268_6566 393
50 3300049571 Ga0501034_0000033 Ga0501034_0000033_4627_5925 393
51 3300049572 Ga0501036_0024696 Ga0501036_0024696_945_2243 393
52 3300049573 Ga0501037_0002782 Ga0501037_0002782_6860_8158 393
53 3300049574 Ga0501038_0015843 Ga0501038_0015843_5126_6424 393
54 3300049575 Ga0501039_0007943 Ga0501039_0007943_4561_5859 393
55 3300049576 Ga0501040_0112947 Ga0501040_0112947_431_1729 393
56 3300049581 Ga0501047_0000339 Ga0501047_0000339_40807_42105 393
57 3300049583 Ga0501067_0006893 Ga0501067_0006893_4575_5873 393
58 3300049586 Ga0501070_0009335 Ga0501070_0009335_2432_3730 393
59 3300049589 Ga0501073_0019342 Ga0501073_0019342_1378_2676 393
60 3300049742 Ga0501080_0000005 Ga0501080_0000005_87273_88571 393
61 3300049822 Ga0501035_0000314 Ga0501035_0000314_50035_51333 393
62 3300049823 Ga0501044_0000019 Ga0501044_0000019_4622_5920 393
63 3300049824 Ga0501045_0045996 Ga0501045_0045996_35_1333 393
64 3300060353 Ga0501082_0010730 Ga0501082_0010730_4209_5507 393
65 3300053153 Ga0500616_0010783 Ga0500616_0010783_44_1297 395
66 3300006847 Ga0075431_100011143 Ga0075431_1000111436 398
67 3300006880 Ga0075429_100038223 Ga0075429_1000382232 398
68 3300050508 nmdc:mga09592_10653_c1 nmdc:mga09592_10653_c1_4512_5732 398
69 3300049570 Ga0501033_0033983 Ga0501033_0033983_1339_2583 399
70 3300049581 Ga0501047_0009380 Ga0501047_0009380_2158_3402 399
71 3300049822 Ga0501035_0042914 Ga0501035_0042914_2058_3302 399
72 3300049823 Ga0501044_0018038 Ga0501044_0018038_3258_4502 399
73 3300031247 Ga0265340_10006721 Ga0265340_100067219 401
74 3300031249 Ga0265339_10030272 Ga0265339_100302723 401
75 3300031711 Ga0265314_10018480 Ga0265314_100184803 401
76 3300049579 Ga0501043_0239086 Ga0501043_0239086_44_1288 402
77 iso_pu_bacteria 2828305725 2828306968 402
78 iso_pu_bacteria 8045864390 8045867696 402
79 3300003856 Ga0058692_1001700 Ga0058692_10017004 403
80 3300027312 Ga0209371_1001344 Ga0209371_10013448 403
81 3300028794 Ga0307515_10008302 Ga0307515_100083027 403
82 3300053156 Ga0500622_0011160 Ga0500622_0011160_42_1295 403
83 3300005340 Ga0070689_100232482 Ga0070689_1002324821 404
84 iso_pu_bacteria 2558860983 2561465941 404
85 iso_pu_bacteria 2995392953 2995394936 404
86 iso_pu_bacteria 8005658619 8005660106 404
87 3300028794 Ga0307515_10003153 Ga0307515_100031534 405
88 3300046519 Ga0495632_0004017 Ga0495632_0004017_541_1797 405
89 3300048924 Ga0496121_0000662 Ga0496121_0000662_49316_50590 406
90 iso_pu_bacteria 2837678835 2837682723 406
91 iso_pu_bacteria 2891048133 2891051986 406
92 iso_pu_bacteria 8054460903 8054461749 406
93 3300049571 Ga0501034_0226589 Ga0501034_0226589_278_1537 407
94 iso_pu_bacteria 8054558443 8054563629 407
95 iso_pu_bacteria 8056875544 8056879991 407
96 3300005334 Ga0068869_100132649 Ga0068869_1001326491 408
97 3300005406 Ga0070703_10000089 Ga0070703_100000897 408
98 3300005445 Ga0070708_100038262 Ga0070708_1000382624 408
99 3300006881 Ga0068865_100059052 Ga0068865_1000590523 408
100 3300009092 Ga0105250_10000554 Ga0105250_100005544 408
101 3300009148 Ga0105243_10014511 Ga0105243_1001451110 408
102 3300025908 Ga0207643_10000162 Ga0207643_1000016243 408
103 3300025935 Ga0207709_10027104 Ga0207709_100271045 408
104 3300025938 Ga0207704_10037472 Ga0207704_100374722 408
105 3300026075 Ga0207708_10004546 Ga0207708_100045462 408
106 3300028380 Ga0268265_10000414 Ga0268265_1000041426 408
107 3300049581 Ga0501047_0314474 Ga0501047_0314474_126_1364 408
108 3300049744 Ga0501083_0038092 Ga0501083_0038092_490_1746 408
109 iso_pu_bacteria 2582581306 2585266341 408
110 iso_pu_bacteria 2582581865 2585387315 408
111 iso_pu_bacteria 2643221688 2644493508 408
112 iso_pu_bacteria 2671180139 2671694892 408
113 iso_pu_bacteria 2854896431 2854898741 408
114 iso_pu_bacteria 2996887358 2996889509 408
115 iso_pu_bacteria 3005452660 3005453300 408
116 iso_pu_bacteria 8005321885 8005324036 408
117 iso_pu_bacteria 8055431914 8055434039 408
118 3300005937 Ga0081455_10016652 Ga0081455_1001665212 409
119 3300006051 Ga0075364_10010169 Ga0075364_100101695 409
120 3300006946 Ga0079104_1000010 Ga0079104_100001094 409
121 3300027111 Ga0209281_1000053 Ga0209281_100005323 409
122 3300050491 nmdc:mga00v17_7772_c1 nmdc:mga00v17_7772_c1_2218_3468 409
123 iso_pu_bacteria 2534681796 2535515577 409
124 iso_pu_bacteria 2585427633 2585994952 409
125 iso_pu_bacteria 2585427634 2585999496 409
126 iso_pu_bacteria 2643221599 2644007782 409
127 iso_pu_bacteria 2643221634 2644191046 409
128 iso_pu_bacteria 2899803654 2899806135 409
129 iso_pu_bacteria 8005542996 8005544206 409
130 iso_pu_bacteria 8024486573 8024489885 409
131 3300041413 Ga0439465_0007332 Ga0439465_0007332_1156_2460 410
132 3300049823 Ga0501044_0271652 Ga0501044_0271652_227_1483 410
133 3300053111 Ga0500572_006781 Ga0500572_006781_1359_2606 410
134 3300053177 Ga0500636_0000004 Ga0500636_0000004_137028_138275 410
135 iso_pu_bacteria 2599185156 2599333913 410
136 iso_pu_bacteria 2643221558 2643810122 410
137 iso_pu_bacteria 2821123053 2821124111 410
138 iso_pu_bacteria 2838736955 2838738865 410
139 iso_pu_bacteria 2841840854 2841842764 410
140 iso_pu_bacteria 2842140634 2842142544 410
141 iso_pu_bacteria 2842922631 2842923688 410
142 iso_pu_bacteria 2857531043 2857531692 410
143 iso_pu_bacteria 2919171160 2919171596 410
144 3300046519 Ga0495632_0035006 Ga0495632_0035006_18_1265 411
145 3300047472 Ga0495686_0001574 Ga0495686_0001574_11347_12594 411
146 3300049459 Ga0495678_030144 Ga0495678_030144_993_2240 411
147 3300049572 Ga0501036_0098417 Ga0501036_0098417_608_1855 411
148 3300049573 Ga0501037_0093988 Ga0501037_0093988_877_2124 411
149 3300049589 Ga0501073_0100525 Ga0501073_0100525_49_1296 411
150 3300049591 Ga0501075_0168449 Ga0501075_0168449_112_1401 411
151 3300049822 Ga0501035_0162279 Ga0501035_0162279_61_1308 411
152 3300049823 Ga0501044_0111801 Ga0501044_0111801_443_1690 411
153 3300003790 Ga0055528_1022477 Ga0055528_10224772 412
154 3300025273 Ga0209673_1002166 Ga0209673_10021667 412
155 3300025295 Ga0209564_1002198 Ga0209564_10021987 412
156 3300025299 Ga0209256_1002568 Ga0209256_100256818 412
157 3300025925 Ga0207650_10005035 Ga0207650_100050354 412
158 3300028794 Ga0307515_10000115 Ga0307515_1000011588 412
159 3300031456 Ga0307513_10001114 Ga0307513_1000111421 412
160 3300031911 Ga0307412_10176420 Ga0307412_101764202 412
161 3300046507 Ga0495606_0010199 Ga0495606_0010199_5709_6986 412
162 3300046558 Ga0495633_0039186 Ga0495633_0039186_506_1756 412
163 3300047472 Ga0495686_0056401 Ga0495686_0056401_518_1795 412
164 3300048924 Ga0496121_0014166 Ga0496121_0014166_3319_4596 412
165 3300048925 Ga0496122_0004312 Ga0496122_0004312_9588_10859 412
166 3300049576 Ga0501040_0030773 Ga0501040_0030773_1757_3064 412
167 3300049578 Ga0501042_0020836 Ga0501042_0020836_2756_4063 412
168 3300049590 Ga0501074_0050471 Ga0501074_0050471_520_1827 412
169 3300049593 Ga0501077_0033441 Ga0501077_0033441_1198_2505 412
170 3300049743 Ga0501081_0049931 Ga0501081_0049931_446_1753 412
171 3300049824 Ga0501045_0189346 Ga0501045_0189346_29_1336 412
172 iso_pu_bacteria 2537561587 2537874521 412
173 iso_pu_bacteria 2582581283 2585165425 412
174 iso_pu_bacteria 2599185210 2599603461 412
175 iso_pu_bacteria 2643221637 2644206331 412
176 iso_pu_bacteria 2643221718 2644649979 412
177 iso_pu_bacteria 2738541317 2738948487 412
178 iso_pu_bacteria 2841859092 2841860085 412
179 iso_pu_bacteria 2842515876 2842516870 412
180 iso_pu_bacteria 2899792073 2899792151 412
181 iso_pu_bacteria 2913308742 2913313446 412
182 iso_pu_bacteria 2933011516 2933012488 412
183 iso_pu_bacteria 2989771324 2989771914 412
184 3300003775 Ga0055524_1023392 Ga0055524_10233921 413
185 3300003790 Ga0055528_1000607 Ga0055528_100060723 413
186 3300003791 Ga0055530_10017722 Ga0055530_100177222 413
187 3300003794 Ga0055531_10001997 Ga0055531_1000199715 413
188 3300025273 Ga0209673_1000122 Ga0209673_1000122107 413
189 3300025292 Ga0209676_1011848 Ga0209676_10118483 413
190 3300025297 Ga0209758_1000121 Ga0209758_1000121106 413
191 3300025298 Ga0209050_1003042 Ga0209050_10030421 413
192 3300025299 Ga0209256_1001197 Ga0209256_10011972 413
193 3300025303 Ga0209051_1002622 Ga0209051_100262215 413
194 3300025304 Ga0209257_1006615 Ga0209257_100661511 413
195 3300046507 Ga0495606_0014290 Ga0495606_0014290_3230_4483 413
196 3300046530 Ga0495654_0000130 Ga0495654_0000130_15209_16480 413
197 3300047472 Ga0495686_0000613 Ga0495686_0000613_38051_39331 413
198 3300048903 Ga0496100_0166805 Ga0496100_0166805_175_1428 413
199 3300048924 Ga0496121_0016253 Ga0496121_0016253_4912_6165 413
200 3300048924 Ga0496121_0016558 Ga0496121_0016558_3684_4967 413
201 3300048924 Ga0496121_0150594 Ga0496121_0150594_212_1465 413
202 3300048924 Ga0496121_0213423 Ga0496121_0213423_95_1348 413
203 3300048925 Ga0496122_0032170 Ga0496122_0032170_1902_3188 413
204 3300048925 Ga0496122_0130912 Ga0496122_0130912_104_1357 413
205 3300048926 Ga0496123_0032820 Ga0496123_0032820_1528_2814 413
206 3300048927 Ga0496124_0018963 Ga0496124_0018963_3367_4650 413
207 3300048927 Ga0496124_0133785 Ga0496124_0133785_332_1585 413
208 3300053125 Ga0500618_000055 Ga0500618_000055_11916_13187 413
209 3300053125 Ga0500618_004068 Ga0500618_004068_3439_4716 413
210 3300053125 Ga0500618_004260 Ga0500618_004260_1846_3123 413
211 iso_pu_bacteria 2513237159 2513999427 413
212 iso_pu_bacteria 2775507049 2776912589 413
213 iso_pu_bacteria 2791355253 2793282866 413
214 iso_pu_bacteria 2818991461 2819684301 413
215 iso_pu_bacteria 2842521101 2842525220 413
216 iso_pu_bacteria 3003930520 3003932479 415
217 3300002773 JGI25152J39213_1000201 JGI25152J39213_10002012 423
218 3300003187 JGI25151J46595_10000798 JGI25151J46595_1000079835 423
219 3300025258 Ga0209129_1000125 Ga0209129_100012513 423
220 3300025294 Ga0209025_1000933 Ga0209025_100093326 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05065

Phage_capsid

Phage capsid family

125

395

0.98

Feature Viewer

pLDDT pTM Quality
54.24 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map