F332778

General Info

Members Datasets Scaffolds Average Seq Length
220 178 440 195

Family's Representative Sequence

Representative Sequence 3300053107|Ga0500560_015750|Ga0500560_015750_187_774
Length 181
Sequence MRSITATMSVTLDGVVQGLGRPDEDTRGGFTHGGWGGQYKPTDMLFGHRTWNDFISAWGTRTDGNPFTTHMNAATKYVVSRTLKDADAWQNSILLSGEAVETVADLKASPGNDLSIIGSASLIRSLHAAGLVDHYQLLIHPLTLGGGTRLFEGPAPLTEFELTEPAVTTTKGVIIARYSRR

Samples

Sample ID Description Type Environment
1 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
57 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
58 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
59 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
60 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
61 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
63 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
64 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
65 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
66 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
84 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
85 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
86 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
87 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
88 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
89 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
174 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
178 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 5.45
Rhizosphere 86.36
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500560_015750 3300053107 Bacteria 2048
2 Ga0070683_100405030 3300005329 Bacteria 1301
3 Ga0070668_100006763 3300005347 Bacteria 8498
4 Ga0070667_100087268 3300005367 Bacteria 2678
5 Ga0070713_100004846 3300005436 Bacteria 9117
6 Ga0070711_100194030 3300005439 Bacteria 1563
7 Ga0070711_100387189 3300005439 Bacteria 1132
8 Ga0070708_100204318 3300005445 Bacteria 1850
9 Ga0070663_100000117 3300005455 Bacteria 37277
10 Ga0070678_100632152 3300005456 Bacteria 959
11 Ga0070681_10136954 3300005458 Bacteria 2379
12 Ga0070706_100347566 3300005467 Bacteria 1382
13 Ga0070698_100038711 3300005471 Bacteria 4912
14 Ga0070699_100129269 3300005518 Bacteria 2226
15 Ga0070679_100168569 3300005530 Bacteria 2162
16 Ga0070684_100014527 3300005535 Bacteria 6382
17 Ga0070684_100113896 3300005535 Bacteria 2427
18 Ga0070697_100155216 3300005536 Bacteria 1932
19 Ga0068853_100019323 3300005539 Bacteria 5648
20 Ga0070665_100438770 3300005548 Bacteria 1315
21 Ga0070664_100734455 3300005564 Bacteria 921
22 Ga0068856_100013658 3300005614 Bacteria 7854
23 Ga0068852_100069253 3300005616 Bacteria 3092
24 Ga0068863_100057755 3300005841 Bacteria 3672
25 Ga0068862_100574822 3300005844 Bacteria 1079
26 Ga0081540_1002543 3300005983 Bacteria 14794
27 Ga0075363_100173050 3300006048 Bacteria 1226
28 Ga0070716_100049171 3300006173 Bacteria 2388
29 Ga0070712_100180650 3300006175 Bacteria 1644
30 Ga0075428_100532053 3300006844 Bacteria 1257
31 Ga0105244_10146061 3300009036 Bacteria 1135
32 Ga0105238_10025951 3300009551 Bacteria 5973
33 Ga0105239_10570160 3300010375 Bacteria 1290
34 Ga0157370_10348148 3300013104 Bacteria 1366
35 Ga0157375_10592660 3300013308 Bacteria 1268
36 Ga0224572_1049544 3300024225 Bacteria 783
37 Ga0207699_10038652 3300025906 Bacteria 2737
38 Ga0207684_10049126 3300025910 Bacteria 3579
39 Ga0207707_10202030 3300025912 Bacteria 1733
40 Ga0207693_10010509 3300025915 Bacteria 7512
41 Ga0207663_10092313 3300025916 Bacteria 2012
42 Ga0207646_10120846 3300025922 Bacteria 2353
43 Ga0207646_10163897 3300025922 Bacteria 2006
44 Ga0207700_10013875 3300025928 Bacteria 5262
45 Ga0207661_10183659 3300025944 Bacteria 1829
46 Ga0207661_10366901 3300025944 Bacteria 1301
47 Ga0207668_10036733 3300025972 Bacteria 3272
48 Ga0207639_10102486 3300026041 Bacteria 2317
49 Ga0207678_10000093 3300026067 Bacteria 74658
50 Ga0207702_10018013 3300026078 Bacteria 5846
51 Ga0207641_10139427 3300026088 Bacteria 2186
52 Ga0207698_10062874 3300026142 Bacteria 2902
53 Ga0268266_10806020 3300028379 Bacteria 907
54 Ga0307515_10113070 3300028794 Bacteria 3151
55 Ga0307511_10001476 3300030521 Bacteria 24879
56 Ga0307509_10001944 3300031507 Bacteria 34100
57 Ga0307509_10076585 3300031507 Bacteria 3471
58 Ga0307407_10564957 3300031903 Bacteria 843
59 Ga0307409_100143728 3300031995 Bacteria 2060
60 Ga0307415_100051307 3300032126 Bacteria 2799
61 Ga0307507_10008537 3300033179 Bacteria 14109
62 Ga0307507_10073025 3300033179 Bacteria 3087
63 Ga0307510_10446784 3300033180 Bacteria 734
64 Ga0373950_0016767 3300034818 Bacteria 1256
65 Ga0373938_0084732 3300034957 Bacteria 776
66 Ga0373934_0009873 3300035086 Bacteria 3583
67 Ga0373923_0020148 3300035111 Bacteria 2588
68 Ga0373936_0127470 3300035113 Bacteria 1091
69 Ga0373939_0067289 3300035114 Bacteria 1157
70 Ga0373945_0005600 3300035116 Bacteria 4028
71 Ga0373956_0011371 3300035119 Bacteria 3666
72 Ga0373957_0200164 3300035120 Bacteria 832
73 Ga0373943_0005630 3300035170 Bacteria 5620
74 Ga0373946_0047368 3300035171 Bacteria 1785
75 Ga0373955_0048120 3300035172 Bacteria 2311
76 Ga0373942_0000310 3300035207 Bacteria 13273
77 Ga0373924_0212390 3300035410 Bacteria 854
78 Ga0373935_0006744 3300035692 Bacteria 6860
79 Ga0373935_0466342 3300035692 Bacteria 914
80 Ga0373927_0108384 3300035695 Bacteria 1809
81 Ga0373933_0274962 3300035724 Bacteria 1087
82 Ga0373947_0056441 3300035725 Bacteria 2373
83 Ga0373937_0114231 3300036401 Bacteria 2513
84 Ga0373925_0059360 3300037068 Bacteria 2869
85 Ga0373925_0067635 3300037068 Bacteria 2695
86 Ga0395900_0069218 3300037418 Bacteria 3627
87 Ga0395898_0009083 3300037466 Bacteria 10469
88 Ga0395905_0021992 3300037471 Bacteria 6033
89 Ga0436364_1348405 3300037853 Bacteria 873
90 Ga0395901_0245099 3300038443 Bacteria 1868
91 Ga0451791_0375851 3300041451 Bacteria 3314
92 Ga0451793_1067722 3300041452 Bacteria 2348
93 Ga0451793_1496297 3300041452 Bacteria 1362
94 Ga0451797_0840696 3300041453 Bacteria 1171
95 Ga0451797_0971569 3300041453 Bacteria 2125
96 Ga0451800_1662981 3300041459 Bacteria 1772
97 Ga0451833_0932840 3300041491 Bacteria 1397
98 Ga0451837_0762018 3300041494 Unclassified 1658
99 Ga0451839_1556426 3300041496 Bacteria 1638
100 Ga0451853_2297831 3300041512 Bacteria 1788
101 Ga0466969_0020664 3300044656 Bacteria 3408
102 Ga0466969_0024757 3300044656 Bacteria 3087
103 Ga0466966_0013914 3300044684 Bacteria 5326
104 Ga0466966_0020530 3300044684 Bacteria 4342
105 Ga0466966_0439282 3300044684 Bacteria 784
106 Ga0466961_0005309 3300044693 Bacteria 8104
107 Ga0466961_0135283 3300044693 Bacteria 1544
108 Ga0466961_0160360 3300044693 Bacteria 1402
109 Ga0466963_0009595 3300044694 Bacteria 5833
110 Ga0466964_0272239 3300044706 Bacteria 843
111 Ga0466970_0101686 3300044765 Bacteria 1565
112 Ga0466957_0172583 3300044842 Bacteria 1409
113 Ga0466957_0459518 3300044842 Bacteria 878
114 Ga0466957_0596718 3300044842 Bacteria 773
115 Ga0466959_0006065 3300045049 Bacteria 8340
116 Ga0466959_0081068 3300045049 Bacteria 2338
117 Ga0466958_0192080 3300045836 Bacteria 1298
118 Ga0466958_0374704 3300045836 Bacteria 917
119 Ga0466958_0416566 3300045836 Bacteria 868
120 Ga0466967_0043573 3300045976 Bacteria 3886
121 Ga0466967_0046128 3300045976 Bacteria 3792
122 Ga0466967_0266600 3300045976 Bacteria 1640
123 Ga0495592_0055772 3300046454 Bacteria 2921
124 Ga0495603_0103694 3300046455 Bacteria 1660
125 Ga0495629_0124831 3300046459 Bacteria 1793
126 Ga0495629_0442818 3300046459 Bacteria 880
127 Ga0495641_0008403 3300046461 Bacteria 6305
128 Ga0495651_0069320 3300046462 Bacteria 2686
129 Ga0495651_0106736 3300046462 Bacteria 2075
130 Ga0495653_0014142 3300046463 Bacteria 6506
131 Ga0495653_0014513 3300046463 Bacteria 6427
132 Ga0495580_0139098 3300046472 Bacteria 1683
133 Ga0495639_0124021 3300046475 Bacteria 1233
134 Ga0495662_0021226 3300046476 Bacteria 3139
135 Ga0495664_0070616 3300046477 Bacteria 2085
136 Ga0495608_0010614 3300046511 Bacteria 6427
137 Ga0495618_0017474 3300046514 Bacteria 4399
138 Ga0495618_0020974 3300046514 Bacteria 4024
139 Ga0495628_0009271 3300046516 Bacteria 8410
140 Ga0495630_0015884 3300046517 Bacteria 5502
141 Ga0495666_0016699 3300046526 Bacteria 3654
142 Ga0495652_0040583 3300046529 Bacteria 4022
143 Ga0495652_0054877 3300046529 Bacteria 3391
144 Ga0495665_0031541 3300046531 Bacteria 2836
145 Ga0495640_0017155 3300046533 Bacteria 5401
146 Ga0495586_0163083 3300046535 Bacteria 1257
147 Ga0495587_0076135 3300046536 Bacteria 1948
148 Ga0495645_0022118 3300046543 Bacteria 4599
149 Ga0495645_0038776 3300046543 Bacteria 3475
150 Ga0495667_0018988 3300046559 Bacteria 4641
151 Ga0495667_0067818 3300046559 Bacteria 2330
152 Ga0495634_0011856 3300046642 Bacteria 6334
153 Ga0495635_0020718 3300046663 Bacteria 4580
154 Ga0495635_0068473 3300046663 Bacteria 2434
155 Ga0495588_0081051 3300046674 Bacteria 1694
156 Ga0495657_0020532 3300046675 Bacteria 4747
157 Ga0495657_0028152 3300046675 Bacteria 3956
158 Ga0495599_0004475 3300046678 Bacteria 8281
159 Ga0495646_0069703 3300046680 Bacteria 2073
160 Ga0495658_0153143 3300046683 Bacteria 1417
161 Ga0495613_0144467 3300046689 Bacteria 1698
162 Ga0495624_0022668 3300046690 Bacteria 4146
163 Ga0495600_0052210 3300046809 Bacteria 2669
164 Ga0495581_0038391 3300047315 Bacteria 2771
165 Ga0495604_0245149 3300047317 Bacteria 1223
166 Ga0495674_0269776 3300047319 Bacteria 1396
167 Ga0495676_0095082 3300047321 Bacteria 2218
168 Ga0495680_0019013 3300047322 Bacteria 5814
169 Ga0495680_0036056 3300047322 Bacteria 3975
170 Ga0495675_0088787 3300047444 Bacteria 1941
171 Ga0495684_0016667 3300047471 Bacteria 5660
172 Ga0495684_0020766 3300047471 Bacteria 5060
173 Ga0495593_0007590 3300047673 Bacteria 6334
174 Ga0495593_0101203 3300047673 Bacteria 1478
175 Ga0495602_0334937 3300048088 Bacteria 1096
176 Ga0495614_0228050 3300048089 Bacteria 848
177 Ga0496102_0562281 3300048905 Bacteria 1063
178 Ga0496112_0008762 3300048915 Bacteria 9076
179 Ga0496112_0071746 3300048915 Bacteria 3423
180 Ga0496112_0118225 3300048915 Bacteria 2621
181 Ga0496114_0065699 3300048917 Bacteria 3040
182 Ga0496115_0172130 3300048918 Bacteria 1791
183 Ga0501031_0058818 3300049568 Bacteria 2505
184 Ga0501032_0420866 3300049569 Bacteria 857
185 Ga0501033_0296903 3300049570 Bacteria 1138
186 Ga0501036_0123945 3300049572 Bacteria 2182
187 Ga0501036_0513296 3300049572 Bacteria 997
188 Ga0501037_0366573 3300049573 Bacteria 992
189 Ga0501038_0033205 3300049574 Bacteria 4546
190 Ga0501038_0036590 3300049574 Bacteria 4307
191 Ga0501039_0602013 3300049575 Bacteria 861
192 Ga0501040_0045863 3300049576 Bacteria 2983
193 Ga0501041_0117756 3300049577 Bacteria 1650
194 Ga0501043_0034296 3300049579 Bacteria 3992
195 Ga0501046_0251105 3300049580 Bacteria 1302
196 Ga0501046_0452265 3300049580 Bacteria 923
197 Ga0501047_0051408 3300049581 Bacteria 3982
198 Ga0501047_0103971 3300049581 Bacteria 2720
199 Ga0501048_0404794 3300049582 Bacteria 975
200 Ga0501048_0411442 3300049582 Bacteria 967
201 Ga0501072_0629910 3300049588 Bacteria 845
202 Ga0501074_0001291 3300049590 Bacteria 16615
203 Ga0501075_0045749 3300049591 Bacteria 3286
204 Ga0501079_0309334 3300049741 Bacteria 1236
205 Ga0501080_0719470 3300049742 Bacteria 880
206 Ga0501081_0219486 3300049743 Bacteria 1382
207 Ga0501083_0258784 3300049744 Bacteria 1132
208 Ga0501035_0207644 3300049822 Bacteria 1677
209 Ga0501044_0037101 3300049823 Bacteria 5096
210 Ga0501044_0394703 3300049823 Bacteria 1297
211 Ga0501045_0053445 3300049824 Bacteria 2951
212 Ga0495601_0027430 3300053077 Bacteria 3521
213 Ga0495612_0094311 3300053078 Bacteria 1270
214 Ga0495619_0073224 3300053085 Bacteria 2295
215 Ga0500573_0085915 3300053140 Bacteria 1783
216 Ga0500636_0158378 3300053177 Bacteria 1237
217 Ga0501084_0048328 3300054114 Bacteria 3562
218 Ga0466962_0035494 3300061719 Bacteria 2387
219 2917745006 2917736166 Bacteria 9690793
220 3003008523 3002998708 Bacteria 11715108
221 Ga0500560_015750
222 Ga0070683_100405030
223 Ga0070668_100006763
224 Ga0070667_100087268
225 Ga0070713_100004846
226 Ga0070711_100194030
227 Ga0070711_100387189
228 Ga0070708_100204318
229 Ga0070663_100000117
230 Ga0070678_100632152
231 Ga0070681_10136954
232 Ga0070706_100347566
233 Ga0070698_100038711
234 Ga0070699_100129269
235 Ga0070679_100168569
236 Ga0070684_100014527
237 Ga0070684_100113896
238 Ga0070697_100155216
239 Ga0068853_100019323
240 Ga0070665_100438770
241 Ga0070664_100734455
242 Ga0068856_100013658
243 Ga0068852_100069253
244 Ga0068863_100057755
245 Ga0068862_100574822
246 Ga0081540_1002543
247 Ga0075363_100173050
248 Ga0070716_100049171
249 Ga0070712_100180650
250 Ga0075428_100532053
251 Ga0105244_10146061
252 Ga0105238_10025951
253 Ga0105239_10570160
254 Ga0157370_10348148
255 Ga0157375_10592660
256 Ga0224572_1049544
257 Ga0207699_10038652
258 Ga0207684_10049126
259 Ga0207707_10202030
260 Ga0207693_10010509
261 Ga0207663_10092313
262 Ga0207646_10120846
263 Ga0207646_10163897
264 Ga0207700_10013875
265 Ga0207661_10183659
266 Ga0207661_10366901
267 Ga0207668_10036733
268 Ga0207639_10102486
269 Ga0207678_10000093
270 Ga0207702_10018013
271 Ga0207641_10139427
272 Ga0207698_10062874
273 Ga0268266_10806020
274 Ga0307515_10113070
275 Ga0307511_10001476
276 Ga0307509_10001944
277 Ga0307509_10076585
278 Ga0307407_10564957
279 Ga0307409_100143728
280 Ga0307415_100051307
281 Ga0307507_10008537
282 Ga0307507_10073025
283 Ga0307510_10446784
284 Ga0373950_0016767
285 Ga0373938_0084732
286 Ga0373934_0009873
287 Ga0373923_0020148
288 Ga0373936_0127470
289 Ga0373939_0067289
290 Ga0373945_0005600
291 Ga0373956_0011371
292 Ga0373957_0200164
293 Ga0373943_0005630
294 Ga0373946_0047368
295 Ga0373955_0048120
296 Ga0373942_0000310
297 Ga0373924_0212390
298 Ga0373935_0006744
299 Ga0373935_0466342
300 Ga0373927_0108384
301 Ga0373933_0274962
302 Ga0373947_0056441
303 Ga0373937_0114231
304 Ga0373925_0059360
305 Ga0373925_0067635
306 Ga0395900_0069218
307 Ga0395898_0009083
308 Ga0395905_0021992
309 Ga0436364_1348405
310 Ga0395901_0245099
311 Ga0451791_0375851
312 Ga0451793_1067722
313 Ga0451793_1496297
314 Ga0451797_0840696
315 Ga0451797_0971569
316 Ga0451800_1662981
317 Ga0451833_0932840
318 Ga0451837_0762018
319 Ga0451839_1556426
320 Ga0451853_2297831
321 Ga0466969_0020664
322 Ga0466969_0024757
323 Ga0466966_0013914
324 Ga0466966_0020530
325 Ga0466966_0439282
326 Ga0466961_0005309
327 Ga0466961_0135283
328 Ga0466961_0160360
329 Ga0466963_0009595
330 Ga0466964_0272239
331 Ga0466970_0101686
332 Ga0466957_0172583
333 Ga0466957_0459518
334 Ga0466957_0596718
335 Ga0466959_0006065
336 Ga0466959_0081068
337 Ga0466958_0192080
338 Ga0466958_0374704
339 Ga0466958_0416566
340 Ga0466967_0043573
341 Ga0466967_0046128
342 Ga0466967_0266600
343 Ga0495592_0055772
344 Ga0495603_0103694
345 Ga0495629_0124831
346 Ga0495629_0442818
347 Ga0495641_0008403
348 Ga0495651_0069320
349 Ga0495651_0106736
350 Ga0495653_0014142
351 Ga0495653_0014513
352 Ga0495580_0139098
353 Ga0495639_0124021
354 Ga0495662_0021226
355 Ga0495664_0070616
356 Ga0495608_0010614
357 Ga0495618_0017474
358 Ga0495618_0020974
359 Ga0495628_0009271
360 Ga0495630_0015884
361 Ga0495666_0016699
362 Ga0495652_0040583
363 Ga0495652_0054877
364 Ga0495665_0031541
365 Ga0495640_0017155
366 Ga0495586_0163083
367 Ga0495587_0076135
368 Ga0495645_0022118
369 Ga0495645_0038776
370 Ga0495667_0018988
371 Ga0495667_0067818
372 Ga0495634_0011856
373 Ga0495635_0020718
374 Ga0495635_0068473
375 Ga0495588_0081051
376 Ga0495657_0020532
377 Ga0495657_0028152
378 Ga0495599_0004475
379 Ga0495646_0069703
380 Ga0495658_0153143
381 Ga0495613_0144467
382 Ga0495624_0022668
383 Ga0495600_0052210
384 Ga0495581_0038391
385 Ga0495604_0245149
386 Ga0495674_0269776
387 Ga0495676_0095082
388 Ga0495680_0019013
389 Ga0495680_0036056
390 Ga0495675_0088787
391 Ga0495684_0016667
392 Ga0495684_0020766
393 Ga0495593_0007590
394 Ga0495593_0101203
395 Ga0495602_0334937
396 Ga0495614_0228050
397 Ga0496102_0562281
398 Ga0496112_0008762
399 Ga0496112_0071746
400 Ga0496112_0118225
401 Ga0496114_0065699
402 Ga0496115_0172130
403 Ga0501031_0058818
404 Ga0501032_0420866
405 Ga0501033_0296903
406 Ga0501036_0123945
407 Ga0501036_0513296
408 Ga0501037_0366573
409 Ga0501038_0033205
410 Ga0501038_0036590
411 Ga0501039_0602013
412 Ga0501040_0045863
413 Ga0501041_0117756
414 Ga0501043_0034296
415 Ga0501046_0251105
416 Ga0501046_0452265
417 Ga0501047_0051408
418 Ga0501047_0103971
419 Ga0501048_0404794
420 Ga0501048_0411442
421 Ga0501072_0629910
422 Ga0501074_0001291
423 Ga0501075_0045749
424 Ga0501079_0309334
425 Ga0501080_0719470
426 Ga0501081_0219486
427 Ga0501083_0258784
428 Ga0501035_0207644
429 Ga0501044_0037101
430 Ga0501044_0394703
431 Ga0501045_0053445
432 Ga0495601_0027430
433 Ga0495612_0094311
434 Ga0495619_0073224
435 Ga0500573_0085915
436 Ga0500636_0158378
437 Ga0501084_0048328
438 Ga0466962_0035494
439 2917745006
440 3003008523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

175

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8105 2 194
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7886 1 194
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7845 1 194
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7816 1 194
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7776 1 194
ID Description Score Start End Superfamily
af_Q93323_89_290_2.70.170.10 Mainly Beta;Distorted Sandwich;Acetylcholine Binding Protein; Chain: A,;Neurotransmitter-gated ion-channel ligand-binding domain 0.8731 172 193 2.70.170.10
af_Q54FJ0_879_1544_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.847 172 193 2.70.130.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8003 2 191 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7958 2 191 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.792 1 194 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A1Y5U461-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9481 52 193 GO:0008703
GO:0009231
AF-A0A3N5K9Y5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9464 56 194 GO:0008703
GO:0009231
AF-A0A231GVN7-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.942 1 194 GO:0008703
GO:0009231
AF-A0A2T2ZFK4-F1-model_v4 Deaminase 0.9417 1 194 GO:0008703
GO:0009231
AF-A0A2T2ZFK4-F1-model_v4 Deaminase 0.937 1 194 GO:0008703
GO:0009231

Map