F332723

General Info

Members Datasets Scaffolds Average Seq Length
220 139 440 286

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0063331|Ga0501070_0063331_770_1714
Length 314
Sequence VRIVSLLPSTTEILFAVGAGPDVVGVTFECDFPPEARTRTVVSTSAMPEGLRPQEIDAHVAAAMSRGEDLYHLDEGALAGLDADLVVTQDLCAVCAVDVSVVDDALAHLGCTAEVLTIDPHTLEEVFASIETLGTATGRGAAARALVTAQRARLAAVXXXXAARPRPRVLLLEWTDPPYAPGHWIPEMVALAGGEPVLGRAGDKSRRVTWDDVHAARPEVVVVAPCGYDLAGATALKDELVDSGVLPDGVPVHAVDANASWARPGTRLVDGVEELAALLHPSASEGSRWFLRCEEPATSHEGLAGARTSTTDRP

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
133 2643221615 Nocardioides sp. Root224 Isolate Unclassified
134 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
135 2739367898 Nocardioides sp. CF479 Isolate Unclassified
136 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
137 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
138 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
139 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0.45
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.55
Nodule 0.45
Rhizoplane 6.36
Rhizosphere 81.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0063331 3300049586 Bacteria 3063
2 Ga0070658_10039019 3300005327 Bacteria 3831
3 Ga0070658_10405674 3300005327 Bacteria 1171
4 Ga0070683_100005530 3300005329 Bacteria 10559
5 Ga0070683_100120623 3300005329 Bacteria 2477
6 Ga0070682_100345796 3300005337 Bacteria 1107
7 Ga0070682_100428034 3300005337 Bacteria 1008
8 Ga0068868_100198891 3300005338 Bacteria 1670
9 Ga0070659_100030409 3300005366 Bacteria 4180
10 Ga0070679_100032390 3300005530 Bacteria 5170
11 Ga0070684_100015715 3300005535 Bacteria 6174
12 Ga0068855_100247212 3300005563 Bacteria 1991
13 Ga0070664_100043191 3300005564 Bacteria 3803
14 Ga0068857_100010597 3300005577 Bacteria 8014
15 Ga0068856_100019566 3300005614 Bacteria 6573
16 Ga0068852_100128358 3300005616 Bacteria 2332
17 Ga0068864_100074710 3300005618 Bacteria 2957
18 Ga0068861_100215113 3300005719 Bacteria 1621
19 Ga0068870_10207241 3300005840 Bacteria 1192
20 Ga0068863_100508581 3300005841 Bacteria 1187
21 Ga0068858_100011398 3300005842 Bacteria 8393
22 Ga0068860_100592830 3300005843 Bacteria 1113
23 Ga0075365_10001248 3300006038 Bacteria 11273
24 Ga0075365_10016958 3300006038 Bacteria 4446
25 Ga0075365_10049133 3300006038 Bacteria 2779
26 Ga0075365_10071284 3300006038 Bacteria 2339
27 Ga0075368_10060459 3300006042 Bacteria 1517
28 Ga0075363_100016740 3300006048 Bacteria 3626
29 Ga0075364_10005097 3300006051 Bacteria 7616
30 Ga0075364_10021707 3300006051 Bacteria 4048
31 Ga0075362_10005613 3300006177 Bacteria 4605
32 Ga0075370_10005446 3300006353 Bacteria 6332
33 Ga0075370_10075923 3300006353 Bacteria 1927
34 Ga0111539_10265028 3300009094 Bacteria 2000
35 Ga0105243_10089865 3300009148 Bacteria 2526
36 Ga0105248_10084475 3300009177 Bacteria 3571
37 Ga0105248_10621121 3300009177 Bacteria 1219
38 Ga0105249_10110956 3300009553 Bacteria 2593
39 Ga0105239_10006702 3300010375 Bacteria 13304
40 Ga0105239_10017157 3300010375 Bacteria 8003
41 Ga0105239_10661895 3300010375 Bacteria 1193
42 Ga0105246_10008957 3300011119 Bacteria 6161
43 Ga0157369_10147109 3300013105 Bacteria 2491
44 Ga0163162_10549747 3300013306 Bacteria 1283
45 Ga0157372_10001978 3300013307 Bacteria 22270
46 Ga0157375_10146145 3300013308 Bacteria 2495
47 Ga0157375_10217523 3300013308 Bacteria 2068
48 Ga0163163_10042642 3300014325 Bacteria 4445
49 Ga0163163_10231400 3300014325 Bacteria 1897
50 Ga0157380_10132626 3300014326 Bacteria 2128
51 Ga0157379_10163550 3300014968 Bacteria 2009
52 Ga0163161_10006768 3300017792 Bacteria 7918
53 Ga0206353_10071942 3300020082 Bacteria 2432
54 Ga0207647_10153979 3300025904 Bacteria 1343
55 Ga0207705_10243811 3300025909 Bacteria 1369
56 Ga0207705_10246486 3300025909 Bacteria 1362
57 Ga0207657_10139766 3300025919 Bacteria 1979
58 Ga0207657_10309286 3300025919 Bacteria 1251
59 Ga0207687_10079160 3300025927 Bacteria 2369
60 Ga0207686_10048428 3300025934 Bacteria 2633
61 Ga0207670_10406267 3300025936 Bacteria 1090
62 Ga0207689_10256503 3300025942 Bacteria 1446
63 Ga0207661_10073738 3300025944 Bacteria 2796
64 Ga0207661_10287804 3300025944 Bacteria 1470
65 Ga0207661_10324352 3300025944 Bacteria 1385
66 Ga0207679_10335258 3300025945 Bacteria 1314
67 Ga0207667_10413196 3300025949 Bacteria 1373
68 Ga0207668_10266289 3300025972 Bacteria 1399
69 Ga0207668_10624517 3300025972 Bacteria 941
70 Ga0207658_10342365 3300025986 Bacteria 1300
71 Ga0207703_10032735 3300026035 Bacteria 4116
72 Ga0207639_10395412 3300026041 Bacteria 1244
73 Ga0207708_10534791 3300026075 Bacteria 986
74 Ga0207702_10321086 3300026078 Bacteria 1474
75 Ga0207641_10725548 3300026088 Bacteria 980
76 Ga0207676_10016404 3300026095 Bacteria 5364
77 Ga0207674_10005576 3300026116 Bacteria 14923
78 Ga0207675_100421496 3300026118 Bacteria 1318
79 Ga0207698_10329549 3300026142 Bacteria 1433
80 Ga0268264_10367736 3300028381 Bacteria 1374
81 Ga0307405_10026330 3300031731 Bacteria 3354
82 Ga0307410_10037971 3300031852 Bacteria 3151
83 Ga0307407_10026700 3300031903 Bacteria 3062
84 Ga0307407_10100209 3300031903 Bacteria 1796
85 Ga0307412_10098988 3300031911 Bacteria 2058
86 Ga0307412_10235908 3300031911 Bacteria 1412
87 Ga0307409_100002563 3300031995 Bacteria 9544
88 Ga0307409_100254161 3300031995 Bacteria 1608
89 Ga0307416_100004854 3300032002 Bacteria 8181
90 Ga0307411_10143519 3300032005 Bacteria 1764
91 Ga0307415_100000548 3300032126 Bacteria 16447
92 Ga0307415_100280065 3300032126 Bacteria 1371
93 Ga0373947_0080700 3300035725 Bacteria 2013
94 Ga0395899_0148909 3300037312 Bacteria 1660
95 Ga0395900_0707875 3300037418 Bacteria 940
96 Ga0395898_0115552 3300037466 Bacteria 2571
97 Ga0395901_0015961 3300038443 Bacteria 7651
98 Ga0395901_0048316 3300038443 Bacteria 4419
99 Ga0395901_0133051 3300038443 Bacteria 2613
100 Ga0466965_0025384 3300044683 Bacteria 2868
101 Ga0466965_0039224 3300044683 Bacteria 2328
102 Ga0466965_0046257 3300044683 Bacteria 2154
103 Ga0466966_0041284 3300044684 Bacteria 2965
104 Ga0466966_0051337 3300044684 Bacteria 2621
105 Ga0466963_0078285 3300044694 Bacteria 2235
106 Ga0466963_0215562 3300044694 Bacteria 1344
107 Ga0466963_0245318 3300044694 Bacteria 1256
108 Ga0466971_0017968 3300044719 Bacteria 3132
109 Ga0466968_0087252 3300044735 Bacteria 1378
110 Ga0466970_0015566 3300044765 Bacteria 3916
111 Ga0466957_0026499 3300044842 Bacteria 3439
112 Ga0466957_0040655 3300044842 Bacteria 2809
113 Ga0466957_0099271 3300044842 Bacteria 1833
114 Ga0466957_0194191 3300044842 Bacteria 1331
115 Ga0466957_0241148 3300044842 Bacteria 1199
116 Ga0466960_0001438 3300044901 Bacteria 8687
117 Ga0466960_0022410 3300044901 Bacteria 2824
118 Ga0466967_0000988 3300045976 Bacteria 15473
119 Ga0466967_0012246 3300045976 Bacteria 6549
120 Ga0466967_0119079 3300045976 Bacteria 2436
121 Ga0466967_0236390 3300045976 Bacteria 1741
122 Ga0466967_0469273 3300045976 Bacteria 1232
123 Ga0466967_0486487 3300045976 Bacteria 1209
124 Ga0466967_0562141 3300045976 Bacteria 1123
125 Ga0495603_0193311 3300046455 Bacteria 1176
126 Ga0495664_0052182 3300046477 Bacteria 2429
127 Ga0496102_0170924 3300048905 Bacteria 2046
128 Ga0496102_0204337 3300048905 Bacteria 1862
129 Ga0496104_0087590 3300048907 Bacteria 2974
130 Ga0496106_0423389 3300048909 Bacteria 1070
131 Ga0496108_0016404 3300048911 Bacteria 6041
132 Ga0496109_0019495 3300048912 Bacteria 5985
133 Ga0496109_0652083 3300048912 Bacteria 990
134 Ga0496110_0162365 3300048913 Bacteria 2025
135 Ga0496110_0169446 3300048913 Bacteria 1981
136 Ga0496110_0228653 3300048913 Bacteria 1691
137 Ga0496111_0358712 3300048914 Bacteria 1079
138 Ga0496113_0112328 3300048916 Bacteria 2122
139 Ga0496113_0139119 3300048916 Bacteria 1909
140 Ga0496115_0346089 3300048918 Bacteria 1213
141 Ga0501031_0064181 3300049568 Bacteria 2392
142 Ga0501032_0167347 3300049569 Bacteria 1442
143 Ga0501034_0133787 3300049571 Bacteria 2462
144 Ga0501034_0161803 3300049571 Bacteria 2209
145 Ga0501036_0027797 3300049572 Bacteria 4781
146 Ga0501036_0378190 3300049572 Bacteria 1182
147 Ga0501037_0092668 3300049573 Bacteria 2185
148 Ga0501038_0012225 3300049574 Bacteria 7839
149 Ga0501039_0001897 3300049575 Bacteria 15459
150 Ga0501040_0015044 3300049576 Bacteria 5113
151 Ga0501041_0028849 3300049577 Bacteria 3348
152 Ga0501042_0006099 3300049578 Bacteria 7810
153 Ga0501042_0011102 3300049578 Bacteria 6067
154 Ga0501042_0238289 3300049578 Bacteria 1313
155 Ga0501043_0054398 3300049579 Bacteria 3143
156 Ga0501046_0015747 3300049580 Bacteria 6346
157 Ga0501046_0098819 3300049580 Bacteria 2241
158 Ga0501067_0004128 3300049583 Bacteria 8012
159 Ga0501067_0009722 3300049583 Bacteria 5322
160 Ga0501068_0021382 3300049584 Bacteria 3777
161 Ga0501068_0085910 3300049584 Bacteria 1936
162 Ga0501069_0014277 3300049585 Bacteria 4244
163 Ga0501069_0041531 3300049585 Bacteria 2542
164 Ga0501069_0064107 3300049585 Bacteria 2054
165 Ga0501070_0015381 3300049586 Bacteria 6437
166 Ga0501070_0053978 3300049586 Bacteria 3332
167 Ga0501071_0006964 3300049587 Bacteria 7380
168 Ga0501071_0029826 3300049587 Bacteria 3853
169 Ga0501071_0043671 3300049587 Bacteria 3215
170 Ga0501071_0144195 3300049587 Bacteria 1775
171 Ga0501072_0043993 3300049588 Bacteria 3511
172 Ga0501072_0087933 3300049588 Bacteria 2465
173 Ga0501072_0416375 3300049588 Bacteria 1065
174 Ga0501073_0093181 3300049589 Bacteria 2093
175 Ga0501073_0197713 3300049589 Bacteria 1390
176 Ga0501074_0007917 3300049590 Bacteria 7697
177 Ga0501074_0022714 3300049590 Bacteria 4560
178 Ga0501074_0156250 3300049590 Bacteria 1629
179 Ga0501075_0013042 3300049591 Bacteria 5923
180 Ga0501075_0229015 3300049591 Bacteria 1417
181 Ga0501076_0004063 3300049592 Bacteria 10347
182 Ga0501077_0008161 3300049593 Bacteria 6472
183 Ga0501077_0049542 3300049593 Bacteria 2669
184 Ga0501079_0019077 3300049741 Bacteria 5239
185 Ga0501079_0033641 3300049741 Bacteria 3943
186 Ga0501080_0017101 3300049742 Bacteria 6698
187 Ga0501080_0049499 3300049742 Bacteria 3911
188 Ga0501080_0183348 3300049742 Bacteria 1925
189 Ga0501080_0187099 3300049742 Bacteria 1904
190 Ga0501081_0063523 3300049743 Bacteria 2562
191 Ga0501083_0265602 3300049744 Bacteria 1116
192 Ga0501045_0015843 3300049824 Bacteria 5347
193 Ga0501045_0040660 3300049824 Bacteria 3382
194 Ga0501045_0074063 3300049824 Bacteria 2508
195 Ga0501045_0167218 3300049824 Bacteria 1638
196 nmdc:mga03683_2777_c1 3300050489 Bacteria 5505
197 nmdc:mga03n38_277460_c1 3300050490 Bacteria 893
198 nmdc:mga00v17_11412_c1 3300050491 Bacteria 4883
199 nmdc:mga0yw44_262719_c1 3300050492 Bacteria 1151
200 nmdc:mga0yw44_49957_c1 3300050492 Bacteria 2527
201 nmdc:mga0yw44_59051_c2 3300050492 Bacteria 1358
202 nmdc:mga0yw44_98107_c1 3300050492 Bacteria 1862
203 nmdc:mga04h51_4975_c1 3300050495 Bacteria 3352
204 nmdc:mga07m45_39707_c1 3300050496 Bacteria 2631
205 Ga0500556_0000337 3300053104 Bacteria 34999
206 Ga0501084_0141448 3300054114 Bacteria 2026
207 Ga0501082_0020483 3300060353 Bacteria 5703
208 Ga0501082_0042208 3300060353 Bacteria 3932
209 Ga0501082_0270708 3300060353 Bacteria 1478
210 Ga0501082_0548968 3300060353 Bacteria 1011
211 Ga0530510_0015771 3300061734 Bacteria 5342
212 Ga0530510_0042687 3300061734 Bacteria 3276
213 Ga0530510_0130824 3300061734 Bacteria 1846
214 2644091278 2643221615 Bacteria 5487866
215 2644321081 2643221657 Bacteria 5490246
216 2740166520 2739367898 Bacteria 4367674
217 2857485618 2857481737 Bacteria 4761446
218 2868092521 2868088558 Bacteria 7609351
219 2919447928 2919446982 Bacteria 3994487
220 8054610517 8054609563 Bacteria 5170090
221 Ga0501070_0063331
222 Ga0070658_10039019
223 Ga0070658_10405674
224 Ga0070683_100005530
225 Ga0070683_100120623
226 Ga0070682_100345796
227 Ga0070682_100428034
228 Ga0068868_100198891
229 Ga0070659_100030409
230 Ga0070679_100032390
231 Ga0070684_100015715
232 Ga0068855_100247212
233 Ga0070664_100043191
234 Ga0068857_100010597
235 Ga0068856_100019566
236 Ga0068852_100128358
237 Ga0068864_100074710
238 Ga0068861_100215113
239 Ga0068870_10207241
240 Ga0068863_100508581
241 Ga0068858_100011398
242 Ga0068860_100592830
243 Ga0075365_10001248
244 Ga0075365_10016958
245 Ga0075365_10049133
246 Ga0075365_10071284
247 Ga0075368_10060459
248 Ga0075363_100016740
249 Ga0075364_10005097
250 Ga0075364_10021707
251 Ga0075362_10005613
252 Ga0075370_10005446
253 Ga0075370_10075923
254 Ga0111539_10265028
255 Ga0105243_10089865
256 Ga0105248_10084475
257 Ga0105248_10621121
258 Ga0105249_10110956
259 Ga0105239_10006702
260 Ga0105239_10017157
261 Ga0105239_10661895
262 Ga0105246_10008957
263 Ga0157369_10147109
264 Ga0163162_10549747
265 Ga0157372_10001978
266 Ga0157375_10146145
267 Ga0157375_10217523
268 Ga0163163_10042642
269 Ga0163163_10231400
270 Ga0157380_10132626
271 Ga0157379_10163550
272 Ga0163161_10006768
273 Ga0206353_10071942
274 Ga0207647_10153979
275 Ga0207705_10243811
276 Ga0207705_10246486
277 Ga0207657_10139766
278 Ga0207657_10309286
279 Ga0207687_10079160
280 Ga0207686_10048428
281 Ga0207670_10406267
282 Ga0207689_10256503
283 Ga0207661_10073738
284 Ga0207661_10287804
285 Ga0207661_10324352
286 Ga0207679_10335258
287 Ga0207667_10413196
288 Ga0207668_10266289
289 Ga0207668_10624517
290 Ga0207658_10342365
291 Ga0207703_10032735
292 Ga0207639_10395412
293 Ga0207708_10534791
294 Ga0207702_10321086
295 Ga0207641_10725548
296 Ga0207676_10016404
297 Ga0207674_10005576
298 Ga0207675_100421496
299 Ga0207698_10329549
300 Ga0268264_10367736
301 Ga0307405_10026330
302 Ga0307410_10037971
303 Ga0307407_10026700
304 Ga0307407_10100209
305 Ga0307412_10098988
306 Ga0307412_10235908
307 Ga0307409_100002563
308 Ga0307409_100254161
309 Ga0307416_100004854
310 Ga0307411_10143519
311 Ga0307415_100000548
312 Ga0307415_100280065
313 Ga0373947_0080700
314 Ga0395899_0148909
315 Ga0395900_0707875
316 Ga0395898_0115552
317 Ga0395901_0015961
318 Ga0395901_0048316
319 Ga0395901_0133051
320 Ga0466965_0025384
321 Ga0466965_0039224
322 Ga0466965_0046257
323 Ga0466966_0041284
324 Ga0466966_0051337
325 Ga0466963_0078285
326 Ga0466963_0215562
327 Ga0466963_0245318
328 Ga0466971_0017968
329 Ga0466968_0087252
330 Ga0466970_0015566
331 Ga0466957_0026499
332 Ga0466957_0040655
333 Ga0466957_0099271
334 Ga0466957_0194191
335 Ga0466957_0241148
336 Ga0466960_0001438
337 Ga0466960_0022410
338 Ga0466967_0000988
339 Ga0466967_0012246
340 Ga0466967_0119079
341 Ga0466967_0236390
342 Ga0466967_0469273
343 Ga0466967_0486487
344 Ga0466967_0562141
345 Ga0495603_0193311
346 Ga0495664_0052182
347 Ga0496102_0170924
348 Ga0496102_0204337
349 Ga0496104_0087590
350 Ga0496106_0423389
351 Ga0496108_0016404
352 Ga0496109_0019495
353 Ga0496109_0652083
354 Ga0496110_0162365
355 Ga0496110_0169446
356 Ga0496110_0228653
357 Ga0496111_0358712
358 Ga0496113_0112328
359 Ga0496113_0139119
360 Ga0496115_0346089
361 Ga0501031_0064181
362 Ga0501032_0167347
363 Ga0501034_0133787
364 Ga0501034_0161803
365 Ga0501036_0027797
366 Ga0501036_0378190
367 Ga0501037_0092668
368 Ga0501038_0012225
369 Ga0501039_0001897
370 Ga0501040_0015044
371 Ga0501041_0028849
372 Ga0501042_0006099
373 Ga0501042_0011102
374 Ga0501042_0238289
375 Ga0501043_0054398
376 Ga0501046_0015747
377 Ga0501046_0098819
378 Ga0501067_0004128
379 Ga0501067_0009722
380 Ga0501068_0021382
381 Ga0501068_0085910
382 Ga0501069_0014277
383 Ga0501069_0041531
384 Ga0501069_0064107
385 Ga0501070_0015381
386 Ga0501070_0053978
387 Ga0501071_0006964
388 Ga0501071_0029826
389 Ga0501071_0043671
390 Ga0501071_0144195
391 Ga0501072_0043993
392 Ga0501072_0087933
393 Ga0501072_0416375
394 Ga0501073_0093181
395 Ga0501073_0197713
396 Ga0501074_0007917
397 Ga0501074_0022714
398 Ga0501074_0156250
399 Ga0501075_0013042
400 Ga0501075_0229015
401 Ga0501076_0004063
402 Ga0501077_0008161
403 Ga0501077_0049542
404 Ga0501079_0019077
405 Ga0501079_0033641
406 Ga0501080_0017101
407 Ga0501080_0049499
408 Ga0501080_0183348
409 Ga0501080_0187099
410 Ga0501081_0063523
411 Ga0501083_0265602
412 Ga0501045_0015843
413 Ga0501045_0040660
414 Ga0501045_0074063
415 Ga0501045_0167218
416 nmdc:mga03683_2777_c1
417 nmdc:mga03n38_277460_c1
418 nmdc:mga00v17_11412_c1
419 nmdc:mga0yw44_262719_c1
420 nmdc:mga0yw44_49957_c1
421 nmdc:mga0yw44_59051_c2
422 nmdc:mga0yw44_98107_c1
423 nmdc:mga04h51_4975_c1
424 nmdc:mga07m45_39707_c1
425 Ga0500556_0000337
426 Ga0501084_0141448
427 Ga0501082_0020483
428 Ga0501082_0042208
429 Ga0501082_0270708
430 Ga0501082_0548968
431 Ga0530510_0015771
432 Ga0530510_0042687
433 Ga0530510_0130824
434 2644091278
435 2644321081
436 2740166520
437 2857485618
438 2868092521
439 2919447928
440 8054610517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01497

Peripla_BP_2

Periplasmic binding protein

3

246

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m29-assembly2.cif.gz_B structure of cobinamide-bound btuf, the periplasmic vitamin b12 binding protein in e.coli 0.8316 2 283
5m34-assembly2.cif.gz_B structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli 0.824 2 280
5m3b-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66l, the periplasmic vitamin b12 binding protein in e.coli 0.8188 2 283
5m29-assembly2.cif.gz_B structure of cobinamide-bound btuf, the periplasmic vitamin b12 binding protein in e.coli 0.8181 2 283
5m2q-assembly2.cif.gz_B structure of cobinamide-bound btuf mutant w66f, the periplasmic vitamin b12 binding protein in e.coli 0.8096 2 280
ID Description Score Start End Superfamily
af_P37028_141_266_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8538 153 283 3.40.50.1980
5m2qB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.85 153 280 3.40.50.1980
af_P37028_141_266_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8413 153 283 3.40.50.1980
4n01B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8232 122 276 3.40.50.1980
5m2qB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8205 153 280 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A848UGB8-F1-model_v4 Cobalamin-binding protein 0.9738 166 279
AF-A0A2V5XJK6-F1-model_v4 Cobalamin-binding protein 0.9421 103 221
AF-A0A832WB11-F1-model_v4 ABC transporter substrate-binding protein 0.9412 120 244
AF-A0A2V7PY43-F1-model_v4 Cobalamin-binding protein 0.9316 122 279
AF-A0A832WB11-F1-model_v4 ABC transporter substrate-binding protein 0.9268 120 244

Map