F332659

General Info

Members Datasets Scaffolds Average Seq Length
220 178 440 472

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0062706|Ga0496112_0062706_168_1727
Length 519
Sequence MRGMLTSNIRQTFFVTALACAFVGRGKGKRLDRRGYEAGLEEGFRVRAVRRKTMTKSLFVALALSCLAGIAVAQTTPQERLIRSRAVEAAIWGMPVVNYDLMLQEMLTKTPGKVNQVIYWGKPLDWKNQTLTPNPDTLYFMTFLNTKDVGPIVIEIPPADANGSVNANFVNIWQAPLEDAGLLGVDKGAGVKLLMLPPGYKAQVPAGYEPLQPDTWGSYALIRSNLKSHGEADVAKSIAYAKQLKVYPLSQASNPPATVFTDVKDVVFDSTIRYDETFFTNLDRMIQSEPWLDRDRAMIDPLRSIGIEKGKPFAPDAKTKQALNDGIAEAHAWMAAKYDGGLPPFFEGTHWTFPGHPELIKAASDNFSDPNSYPIDWRGVAYHYAFIALKRLGAGQFYLINIKDRDGGDYEGAKTYRLHVPPGVPIEQYWSLTAYDRDTHALIKNVDRASRASNNPDVKQNADRSVDVYVGAKAPAGQESNWIPTDPARKFELMFRLYGPKKEFFDKVWKLPDVEKVPG

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
83 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
124 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
125 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
126 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
127 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
128 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
129 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
130 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
133 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
134 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
135 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
136 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
137 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
138 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
139 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
140 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
141 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
142 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
143 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
144 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
145 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
146 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
147 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
148 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
149 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
150 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
151 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
152 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
153 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
154 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
155 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
156 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
157 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
158 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
159 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
160 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
161 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
162 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
163 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
164 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
165 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
166 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
167 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
168 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
169 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
170 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
171 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
172 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
173 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
174 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
175 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
176 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
177 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
178 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.09
Metatranscriptomes 0
Isolates 20.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.91
Nodule 15.45
Rhizoplane 7.73
Rhizosphere 56.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0062706 3300048915 Bacteria 3667
2 SwRhRL2b_contig_2964244 2162886007 Bacteria 3704
3 Ga0055526_1019795 3300003771 Bacteria 2434
4 Ga0065704_10002141 3300005289 Bacteria 5780
5 Ga0065707_10087001 3300005295 Bacteria 5198
6 Ga0070670_100049634 3300005331 Bacteria 3608
7 Ga0068869_100003976 3300005334 Bacteria 9135
8 Ga0070666_10144420 3300005335 Bacteria 1658
9 Ga0070682_100002773 3300005337 Bacteria 9698
10 Ga0070682_100022921 3300005337 Bacteria 3704
11 Ga0068868_100011598 3300005338 Bacteria 6419
12 Ga0070668_100002553 3300005347 Bacteria 13391
13 Ga0070668_100005808 3300005347 Bacteria 9156
14 Ga0070668_100057466 3300005347 Bacteria 3007
15 Ga0070669_100146646 3300005353 Bacteria 1824
16 Ga0070674_100045781 3300005356 Bacteria 2990
17 Ga0070709_10007718 3300005434 Bacteria 5906
18 Ga0070663_100069853 3300005455 Bacteria 2553
19 Ga0070678_100023419 3300005456 Bacteria 4115
20 Ga0070678_100025577 3300005456 Bacteria 3974
21 Ga0070662_100020920 3300005457 Bacteria 4462
22 Ga0070662_100086306 3300005457 Bacteria 2347
23 Ga0068867_100050711 3300005459 Bacteria 3060
24 Ga0070706_100074718 3300005467 Bacteria 3137
25 Ga0070698_100239189 3300005471 Bacteria 1749
26 Ga0068853_100046771 3300005539 Bacteria 3711
27 Ga0070665_100006948 3300005548 Bacteria 11505
28 Ga0070665_100020452 3300005548 Bacteria 6647
29 Ga0070665_100034490 3300005548 Bacteria 5089
30 Ga0070665_100053543 3300005548 Bacteria 4047
31 Ga0070665_100066596 3300005548 Bacteria 3613
32 Ga0068856_100153265 3300005614 Bacteria 2314
33 Ga0068866_10023995 3300005718 Bacteria 2844
34 Ga0068866_10052531 3300005718 Bacteria 2080
35 Ga0068861_100036355 3300005719 Bacteria 3654
36 Ga0068858_100077292 3300005842 Bacteria 3092
37 Ga0081455_10032831 3300005937 Bacteria 4672
38 Ga0081540_1022213 3300005983 Bacteria 3749
39 Ga0081540_1046870 3300005983 Bacteria 2178
40 Ga0081540_1050255 3300005983 Bacteria 2073
41 Ga0075365_10002566 3300006038 Bacteria 8967
42 Ga0075365_10053760 3300006038 Bacteria 2668
43 Ga0075363_100000323 3300006048 Bacteria 14268
44 Ga0075364_10018097 3300006051 Bacteria 4408
45 Ga0075364_10022746 3300006051 Bacteria 3963
46 Ga0075367_10007063 3300006178 Bacteria 5723
47 Ga0075366_10077771 3300006195 Bacteria 1980
48 Ga0097621_100019254 3300006237 Bacteria 5236
49 Ga0075370_10009352 3300006353 Bacteria 5086
50 Ga0075431_100174021 3300006847 Bacteria 2211
51 Ga0075434_100044718 3300006871 Bacteria 4392
52 Ga0075434_100120302 3300006871 Bacteria 2641
53 Ga0075429_100096067 3300006880 Bacteria 2585
54 Ga0068865_100016598 3300006881 Bacteria 4716
55 Ga0075435_100103964 3300007076 Bacteria 2356
56 Ga0105240_10041792 3300009093 Bacteria 5847
57 Ga0111539_10156803 3300009094 Bacteria 2664
58 Ga0111539_10360569 3300009094 Bacteria 1692
59 Ga0105245_10055732 3300009098 Bacteria 3551
60 Ga0105243_10015814 3300009148 Bacteria 5707
61 Ga0105243_10053024 3300009148 Bacteria 3215
62 Ga0105241_10076300 3300009174 Bacteria 2613
63 Ga0105248_10001570 3300009177 Bacteria 25432
64 Ga0105248_10141430 3300009177 Bacteria 2715
65 Ga0105238_10020651 3300009551 Bacteria 6709
66 Ga0105238_10193986 3300009551 Bacteria 2007
67 Ga0105249_10017611 3300009553 Bacteria 6344
68 Ga0105239_10015233 3300010375 Bacteria 8519
69 Ga0157374_10013153 3300013296 Bacteria 7218
70 Ga0157378_10015028 3300013297 Bacteria 6778
71 Ga0163163_10023625 3300014325 Bacteria 5836
72 Ga0163163_10030831 3300014325 Bacteria 5171
73 Ga0157380_10048447 3300014326 Bacteria 3347
74 Ga0157379_10062326 3300014968 Bacteria 3335
75 Ga0209564_1005739 3300025295 Bacteria 6935
76 Ga0209050_1005335 3300025298 Bacteria 8142
77 Ga0207426_1010769 3300025302 Bacteria 3530
78 Ga0207642_10021584 3300025899 Bacteria 2538
79 Ga0207684_10112224 3300025910 Bacteria 2334
80 Ga0207654_10006630 3300025911 Bacteria 5825
81 Ga0207671_10018333 3300025914 Bacteria 5372
82 Ga0207694_10034579 3300025924 Bacteria 3876
83 Ga0207694_10063012 3300025924 Bacteria 2888
84 Ga0207650_10053521 3300025925 Bacteria 2992
85 Ga0207706_10044207 3300025933 Bacteria 3948
86 Ga0207706_10093480 3300025933 Bacteria 2644
87 Ga0207706_10161770 3300025933 Bacteria 1968
88 Ga0207709_10007487 3300025935 Bacteria 6076
89 Ga0207669_10004698 3300025937 Bacteria 6043
90 Ga0207704_10056654 3300025938 Bacteria 2402
91 Ga0207711_10021318 3300025941 Bacteria 5414
92 Ga0207689_10006533 3300025942 Bacteria 10288
93 Ga0207712_10040670 3300025961 Bacteria 3192
94 Ga0207668_10071229 3300025972 Bacteria 2482
95 Ga0207658_10173950 3300025986 Bacteria 1777
96 Ga0207703_10070517 3300026035 Bacteria 2884
97 Ga0207678_10005293 3300026067 Bacteria 11554
98 Ga0207678_10007048 3300026067 Bacteria 9982
99 Ga0207702_10085394 3300026078 Bacteria 2750
100 Ga0207648_10016432 3300026089 Bacteria 6761
101 Ga0207676_10025485 3300026095 Bacteria 4388
102 Ga0207675_100126781 3300026118 Bacteria 2418
103 Ga0207675_100299935 3300026118 Bacteria 1565
104 Ga0207683_10031060 3300026121 Bacteria 4634
105 Ga0207683_10037592 3300026121 Bacteria 4216
106 Ga0268266_10001258 3300028379 Bacteria 30968
107 Ga0268266_10007250 3300028379 Bacteria 10025
108 Ga0268266_10049180 3300028379 Bacteria 3615
109 Ga0495650_0001937 3300046471 Bacteria 18300
110 Ga0495585_0048080 3300046492 Bacteria 2373
111 Ga0495656_0031365 3300046615 Bacteria 2155
112 Ga0495625_0006996 3300046660 Bacteria 9940
113 Ga0495625_0095794 3300046660 Bacteria 2045
114 Ga0495669_0002768 3300046684 Bacteria 7193
115 Ga0495670_0032467 3300046691 Bacteria 2597
116 Ga0495670_0050227 3300046691 Bacteria 2088
117 Ga0495686_0048212 3300047472 Bacteria 2687
118 Ga0496102_0126124 3300048905 Bacteria 2393
119 Ga0496103_0055745 3300048906 Bacteria 2452
120 Ga0496104_0197572 3300048907 Bacteria 1923
121 Ga0496104_0208435 3300048907 Bacteria 1866
122 Ga0496105_0052346 3300048908 Bacteria 3372
123 Ga0496107_0050787 3300048910 Bacteria 2990
124 Ga0496108_0032246 3300048911 Bacteria 4351
125 Ga0496109_0112420 3300048912 Bacteria 2533
126 Ga0496113_0128517 3300048916 Bacteria 1986
127 Ga0496114_0014166 3300048917 Bacteria 6396
128 Ga0496115_0013342 3300048918 Bacteria 6215
129 Ga0496115_0035098 3300048918 Bacteria 3966
130 Ga0496115_0042709 3300048918 Bacteria 3613
131 Ga0496115_0135878 3300048918 Bacteria 2027
132 Ga0496115_0148514 3300048918 Bacteria 1935
133 Ga0496121_0002100 3300048924 Bacteria 31362
134 Ga0496121_0108838 3300048924 Bacteria 2119
135 Ga0496125_0013564 3300048928 Bacteria 8004
136 Ga0496126_0003493 3300048929 Bacteria 19836
137 Ga0496126_0020818 3300048929 Bacteria 6419
138 Ga0496126_0022574 3300048929 Bacteria 6118
139 Ga0496126_0022745 3300048929 Bacteria 6089
140 Ga0496126_0082340 3300048929 Bacteria 2844
141 Ga0496126_0085034 3300048929 Bacteria 2789
142 Ga0501033_0002321 3300049570 Bacteria 16226
143 Ga0501036_0018933 3300049572 Bacteria 5776
144 Ga0501038_0107279 3300049574 Bacteria 2317
145 Ga0501039_0005333 3300049575 Bacteria 9722
146 Ga0501041_0034421 3300049577 Bacteria 3067
147 Ga0501043_0016142 3300049579 Bacteria 5856
148 Ga0501072_0025578 3300049588 Bacteria 4599
149 Ga0501075_0013611 3300049591 Bacteria 5810
150 Ga0501077_0015551 3300049593 Bacteria 4791
151 Ga0501079_0021853 3300049741 Bacteria 4899
152 Ga0501080_0046599 3300049742 Bacteria 4036
153 Ga0501044_0022583 3300049823 Bacteria 6704
154 Ga0501045_0068059 3300049824 Bacteria 2616
155 nmdc:mga03n38_545_c1 3300050490 Bacteria 9552
156 nmdc:mga00v17_11749_c1 3300050491 Bacteria 4816
157 nmdc:mga0k408_47141_c1 3300050493 Bacteria 2490
158 nmdc:mga06z11_43467_c1 3300050494 Bacteria 2261
159 nmdc:mga06z11_7326_c1 3300050494 Bacteria 4534
160 nmdc:mga07m45_31266_c1 3300050496 Bacteria 2950
161 nmdc:mga09592_192039_c1 3300050508 Bacteria 1768
162 nmdc:mga06r32_156153_c1 3300050510 Bacteria 2263
163 nmdc:mga08y16_309669_c1 3300050511 Bacteria 1626
164 nmdc:mga0n895_5680_c1 3300050512 Bacteria 10457
165 nmdc:mga0rr50_16199_c1 3300050513 Bacteria 4943
166 nmdc:mga08x19_181491_c1 3300050514 Bacteria 1437
167 Ga0500643_000707 3300053087 Bacteria 22129
168 Ga0500566_0001717 3300053094 Bacteria 12864
169 Ga0500641_0043125 3300053096 Bacteria 1831
170 Ga0500562_003332 3300053108 Bacteria 4019
171 Ga0500658_0016043 3300053134 Bacteria 2788
172 Ga0500588_0012631 3300053146 Bacteria 2099
173 Ga0501082_0010673 3300060353 Bacteria 7906
174 Ga0530510_0074353 3300061734 Bacteria 2467
175 2509073710 2508501114 Bacteria 7082538
176 2513658666 2513237096 Bacteria 8722461
177 2513920770 2513237145 Bacteria 8979722
178 2524467431 2524023210 Bacteria 9029266
179 2524537838 2524023228 Bacteria 10118060
180 2599719324 2599185236 Bacteria 6875203
181 2776266629 2775506901 Bacteria 9631051
182 2824601727 2824600985 Bacteria 8488197
183 2824611332 2824609381 Bacteria 8672835
184 2824653385 2824653114 Bacteria 8493680
185 2824706850 2824704595 Bacteria 9667483
186 2824756820 2824753945 Bacteria 9787441
187 2824767413 2824763712 Bacteria 9792355
188 2857530414 2857524615 Bacteria 6615449
189 2888422326 2888419890 Bacteria 7857137
190 2904720689 2904711408 Bacteria 9771557
191 2929617733 2929615660 Bacteria 9193770
192 2929627438 2929624759 Bacteria 9339455
193 2932788464 2932784394 Bacteria 9704911
194 2932816293 2932809354 Bacteria 9135765
195 2932831546 2932828146 Bacteria 9745859
196 2933579689 2933577622 Bacteria 9116884
197 2935622405 2935616580 Bacteria 9032984
198 2935645166 2935638405 Bacteria 10015038
199 2935671805 2935665750 Bacteria 9571747
200 2935707007 2935703347 Bacteria 10242284
201 2935807645 2935801545 Bacteria 9301974
202 2935817086 2935810662 Bacteria 9401221
203 2935834633 2935827899 Bacteria 10038562
204 2935840315 2935837841 Bacteria 9454360
205 2935860526 2935855204 Bacteria 9035059
206 2935865435 2935864058 Bacteria 9784707
207 2935878031 2935873716 Bacteria 9632195
208 2935996019 2935992306 Bacteria 9802711
209 2936009510 2936002035 Bacteria 9362176
210 2936043465 2936037263 Bacteria 9446081
211 2941541553 2941538514 Bacteria 9402094
212 8006942662 8006933436 Bacteria 10410654
213 8016513621 8016511872 Bacteria 9921665
214 8017062821 8017057580 Bacteria 10023680
215 8019582258 8019576017 Bacteria 10049540
216 8019589953 8019586578 Bacteria 10212056
217 8019601316 8019597564 Bacteria 10041141
218 8019617237 8019608314 Bacteria 10042931
219 8055746652 8055742211 Bacteria 9226248
220 8057579769 8057575449 Bacteria 7367519
221 Ga0496112_0062706
222 SwRhRL2b_contig_2964244
223 Ga0055526_1019795
224 Ga0065704_10002141
225 Ga0065707_10087001
226 Ga0070670_100049634
227 Ga0068869_100003976
228 Ga0070666_10144420
229 Ga0070682_100002773
230 Ga0070682_100022921
231 Ga0068868_100011598
232 Ga0070668_100002553
233 Ga0070668_100005808
234 Ga0070668_100057466
235 Ga0070669_100146646
236 Ga0070674_100045781
237 Ga0070709_10007718
238 Ga0070663_100069853
239 Ga0070678_100023419
240 Ga0070678_100025577
241 Ga0070662_100020920
242 Ga0070662_100086306
243 Ga0068867_100050711
244 Ga0070706_100074718
245 Ga0070698_100239189
246 Ga0068853_100046771
247 Ga0070665_100006948
248 Ga0070665_100020452
249 Ga0070665_100034490
250 Ga0070665_100053543
251 Ga0070665_100066596
252 Ga0068856_100153265
253 Ga0068866_10023995
254 Ga0068866_10052531
255 Ga0068861_100036355
256 Ga0068858_100077292
257 Ga0081455_10032831
258 Ga0081540_1022213
259 Ga0081540_1046870
260 Ga0081540_1050255
261 Ga0075365_10002566
262 Ga0075365_10053760
263 Ga0075363_100000323
264 Ga0075364_10018097
265 Ga0075364_10022746
266 Ga0075367_10007063
267 Ga0075366_10077771
268 Ga0097621_100019254
269 Ga0075370_10009352
270 Ga0075431_100174021
271 Ga0075434_100044718
272 Ga0075434_100120302
273 Ga0075429_100096067
274 Ga0068865_100016598
275 Ga0075435_100103964
276 Ga0105240_10041792
277 Ga0111539_10156803
278 Ga0111539_10360569
279 Ga0105245_10055732
280 Ga0105243_10015814
281 Ga0105243_10053024
282 Ga0105241_10076300
283 Ga0105248_10001570
284 Ga0105248_10141430
285 Ga0105238_10020651
286 Ga0105238_10193986
287 Ga0105249_10017611
288 Ga0105239_10015233
289 Ga0157374_10013153
290 Ga0157378_10015028
291 Ga0163163_10023625
292 Ga0163163_10030831
293 Ga0157380_10048447
294 Ga0157379_10062326
295 Ga0209564_1005739
296 Ga0209050_1005335
297 Ga0207426_1010769
298 Ga0207642_10021584
299 Ga0207684_10112224
300 Ga0207654_10006630
301 Ga0207671_10018333
302 Ga0207694_10034579
303 Ga0207694_10063012
304 Ga0207650_10053521
305 Ga0207706_10044207
306 Ga0207706_10093480
307 Ga0207706_10161770
308 Ga0207709_10007487
309 Ga0207669_10004698
310 Ga0207704_10056654
311 Ga0207711_10021318
312 Ga0207689_10006533
313 Ga0207712_10040670
314 Ga0207668_10071229
315 Ga0207658_10173950
316 Ga0207703_10070517
317 Ga0207678_10005293
318 Ga0207678_10007048
319 Ga0207702_10085394
320 Ga0207648_10016432
321 Ga0207676_10025485
322 Ga0207675_100126781
323 Ga0207675_100299935
324 Ga0207683_10031060
325 Ga0207683_10037592
326 Ga0268266_10001258
327 Ga0268266_10007250
328 Ga0268266_10049180
329 Ga0495650_0001937
330 Ga0495585_0048080
331 Ga0495656_0031365
332 Ga0495625_0006996
333 Ga0495625_0095794
334 Ga0495669_0002768
335 Ga0495670_0032467
336 Ga0495670_0050227
337 Ga0495686_0048212
338 Ga0496102_0126124
339 Ga0496103_0055745
340 Ga0496104_0197572
341 Ga0496104_0208435
342 Ga0496105_0052346
343 Ga0496107_0050787
344 Ga0496108_0032246
345 Ga0496109_0112420
346 Ga0496113_0128517
347 Ga0496114_0014166
348 Ga0496115_0013342
349 Ga0496115_0035098
350 Ga0496115_0042709
351 Ga0496115_0135878
352 Ga0496115_0148514
353 Ga0496121_0002100
354 Ga0496121_0108838
355 Ga0496125_0013564
356 Ga0496126_0003493
357 Ga0496126_0020818
358 Ga0496126_0022574
359 Ga0496126_0022745
360 Ga0496126_0082340
361 Ga0496126_0085034
362 Ga0501033_0002321
363 Ga0501036_0018933
364 Ga0501038_0107279
365 Ga0501039_0005333
366 Ga0501041_0034421
367 Ga0501043_0016142
368 Ga0501072_0025578
369 Ga0501075_0013611
370 Ga0501077_0015551
371 Ga0501079_0021853
372 Ga0501080_0046599
373 Ga0501044_0022583
374 Ga0501045_0068059
375 nmdc:mga03n38_545_c1
376 nmdc:mga00v17_11749_c1
377 nmdc:mga0k408_47141_c1
378 nmdc:mga06z11_43467_c1
379 nmdc:mga06z11_7326_c1
380 nmdc:mga07m45_31266_c1
381 nmdc:mga09592_192039_c1
382 nmdc:mga06r32_156153_c1
383 nmdc:mga08y16_309669_c1
384 nmdc:mga0n895_5680_c1
385 nmdc:mga0rr50_16199_c1
386 nmdc:mga08x19_181491_c1
387 Ga0500643_000707
388 Ga0500566_0001717
389 Ga0500641_0043125
390 Ga0500562_003332
391 Ga0500658_0016043
392 Ga0500588_0012631
393 Ga0501082_0010673
394 Ga0530510_0074353
395 2509073710
396 2513658666
397 2513920770
398 2524467431
399 2524537838
400 2599719324
401 2776266629
402 2824601727
403 2824611332
404 2824653385
405 2824706850
406 2824756820
407 2824767413
408 2857530414
409 2888422326
410 2904720689
411 2929617733
412 2929627438
413 2932788464
414 2932816293
415 2932831546
416 2933579689
417 2935622405
418 2935645166
419 2935671805
420 2935707007
421 2935807645
422 2935817086
423 2935834633
424 2935840315
425 2935860526
426 2935865435
427 2935878031
428 2935996019
429 2936009510
430 2936043465
431 2941541553
432 8006942662
433 8016513621
434 8017062821
435 8019582258
436 8019589953
437 8019601316
438 8019617237
439 8055746652
440 8057579769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06742

DUF1214

Protein of unknown function (DUF1214)

395

502

0.94

PF06863

DUF1254

Protein of unknown function (DUF1254)

114

248

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vb9-assembly2.cif.gz_D crystal structure of vpa0735 from vibrio parahaemolyticus in monoclinic form, northeast structural genomics target vpr109 0.866 24 475
3vb9-assembly2.cif.gz_D crystal structure of vpa0735 from vibrio parahaemolyticus in monoclinic form, northeast structural genomics target vpr109 0.8286 24 475
3u07-assembly3.cif.gz_C crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.6729 40 476
3u07-assembly2.cif.gz_B crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.6701 40 476
3u07-assembly3.cif.gz_C crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.6701 40 476
ID Description Score Start End Superfamily
3vb9A04 Mainly Beta;Sandwich;Jelly Rolls;Domain of unknown function DUF1214, C-terminal domain 0.8694 300 475 2.60.120.600
3vb9A04 Mainly Beta;Sandwich;Jelly Rolls;Domain of unknown function DUF1214, C-terminal domain 0.8645 300 475 2.60.120.600
2p3yA02 Mainly Alpha;Orthogonal Bundle;VPA0735-like fold;VPA0735-like domain 0.8253 233 300 1.10.3360.10
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.8143 356 476 2.60.120.1600
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.8016 356 476 2.60.120.1600
ID Description Score Start End GO Terms
AF-A0A850DCS9-F1-model_v4 DUF1214 domain-containing protein 0.9878 358 475
AF-A0A395L8J5-F1-model_v4 DUF1254 domain-containing protein 0.9859 40 298
AF-X0XYQ7-F1-model_v4 DUF1214 domain-containing protein 0.9755 354 476
AF-A0A2W4CUF8-F1-model_v4 DUF1254 domain-containing protein 0.9726 61 476
AF-A0A850DCS9-F1-model_v4 DUF1214 domain-containing protein 0.9715 358 475

Map