F332464

General Info

Members Datasets Scaffolds Average Seq Length
220 184 180 264

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0423742|Ga0373937_0423742_262_1059
Length 242
Sequence MMKPEMSIFGQTTTGLCGPAAALVIDGVSHSYGPRKALDNVSFEVAAGSFTALLGLNGAGKSTLFSIITRLFGIQDGHIGIFGNDIERNPGEALRRMGVVFQPRTLDLDLSVTQNLLYHAALHGISRRDARSGGQMRRLEIARALMHRPRLLLLDEATVGLDVKARAEILGHVRELVVEQGIGVLWATHLFDEIKPSDDLVILHQGRILAEGKVPFIVAKAEARDLHSAFVRLTETGSGSAP

Samples

Sample ID Description Type Environment
1 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
2 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
5 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
6 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
7 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
8 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
9 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
10 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
11 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
12 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
13 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
14 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
15 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
16 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
17 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
18 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
19 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
20 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
21 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
22 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
23 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
24 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
25 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
26 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
27 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
28 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
29 2909042592 Labrys sp. LIt4 Isolate Nodule
30 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
31 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
32 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
33 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
34 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
35 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
36 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
61 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
62 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 641522639 Methylobacterium sp. 4-46 Isolate Nodule
182 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
183 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
184 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.82
Metatranscriptomes 0
Isolates 18.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 9.09
Rhizoplane 6.36
Rhizosphere 65.45
Stem 0
Stem Tuber 0
Unclassified 15.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10023915 3300005327 Bacteria 4901
2 Ga0070683_100019542 3300005329 Bacteria 6018
3 Ga0070680_100221171 3300005336 Bacteria 1598
4 Ga0070660_100062618 3300005339 Bacteria 2890
5 Ga0070709_10177422 3300005434 Bacteria 1493
6 Ga0070714_100017734 3300005435 Bacteria 5772
7 Ga0070713_100047868 3300005436 Bacteria 3517
8 Ga0070710_10004979 3300005437 Bacteria 6290
9 Ga0070711_100004294 3300005439 Bacteria 8390
10 Ga0070711_100107629 3300005439 Bacteria 2041
11 Ga0070711_100123704 3300005439 Bacteria 1917
12 Ga0070684_100010612 3300005535 Bacteria 7305
13 Ga0068853_100002763 3300005539 Bacteria 13249
14 Ga0068855_100123025 3300005563 Bacteria 2968
15 Ga0068858_100329934 3300005842 Bacteria 1459
16 Ga0070717_10005769 3300006028 Bacteria 9067
17 Ga0070715_10000375 3300006163 Bacteria 11180
18 Ga0070715_10186853 3300006163 Bacteria 1043
19 Ga0070716_100001019 3300006173 Bacteria 12248
20 Ga0070712_100054091 3300006175 Bacteria 2805
21 Ga0075369_10024489 3300006186 Bacteria 2501
22 Ga0075433_10340772 3300006852 Bacteria 1325
23 Ga0079104_1000950 3300006946 Bacteria 22986
24 Ga0105240_10009195 3300009093 Bacteria 14013
25 Ga0105237_10074698 3300009545 Bacteria 3382
26 Ga0105237_10142004 3300009545 Bacteria 2395
27 Ga0105238_10073198 3300009551 Bacteria 3422
28 Ga0123340_1047660 3300009763 Unclassified 1685
29 Ga0123341_1021701 3300009765 Bacteria 5382
30 Ga0123342_1021407 3300009766 Bacteria 4547
31 Ga0105239_10001659 3300010375 Bacteria 29335
32 Ga0157370_10027640 3300013104 Bacteria 5593
33 Ga0163162_10046354 3300013306 Bacteria 4356
34 Ga0213874_10017656 3300021377 Bacteria 1917
35 Ga0213876_10000694 3300021384 Bacteria 23745
36 Ga0213876_10004020 3300021384 Bacteria 8272
37 Ga0213875_10005144 3300021388 Bacteria 7076
38 Ga0209758_1028178 3300025297 Bacteria 2383
39 Ga0207692_10015381 3300025898 Bacteria 3365
40 Ga0207685_10037072 3300025905 Bacteria 1793
41 Ga0207699_10005178 3300025906 Bacteria 6237
42 Ga0207705_10178731 3300025909 Bacteria 1600
43 Ga0207707_10000381 3300025912 Bacteria 46274
44 Ga0207695_10048331 3300025913 Bacteria 4494
45 Ga0207671_10078652 3300025914 Bacteria 2470
46 Ga0207671_10243841 3300025914 Bacteria 1412
47 Ga0207693_10002089 3300025915 Bacteria 17466
48 Ga0207663_10001142 3300025916 Bacteria 12236
49 Ga0207663_10011734 3300025916 Bacteria 4715
50 Ga0207663_10032465 3300025916 Bacteria 3100
51 Ga0207657_10000999 3300025919 Bacteria 30070
52 Ga0207652_10001277 3300025921 Bacteria 22426
53 Ga0207700_10006146 3300025928 Bacteria 7233
54 Ga0207664_10018451 3300025929 Bacteria 5137
55 Ga0207690_10144922 3300025932 Bacteria 1755
56 Ga0207665_10002085 3300025939 Bacteria 13500
57 Ga0207661_10034531 3300025944 Bacteria 3934
58 Ga0207667_10007770 3300025949 Bacteria 12820
59 Ga0207703_10134498 3300026035 Bacteria 2139
60 Ga0207639_10014364 3300026041 Bacteria 5568
61 Ga0207702_10267361 3300026078 Bacteria 1612
62 Ga0207676_10371078 3300026095 Bacteria 1329
63 Ga0209281_1000433 3300027111 Bacteria 62005
64 Ga0209974_10043981 3300027876 Bacteria 1489
65 Ga0268266_10257999 3300028379 Bacteria 1615
66 Ga0265328_10024889 3300031239 Bacteria 2258
67 Ga0265331_10000730 3300031250 Bacteria 27712
68 Ga0265327_10004012 3300031251 Bacteria 13402
69 Ga0265316_10018462 3300031344 Bacteria 5992
70 Ga0265316_10317840 3300031344 Bacteria 1131
71 Ga0307409_100088879 3300031995 Bacteria 2524
72 Ga0373923_0031163 3300035111 Bacteria 2148
73 Ga0373936_0044792 3300035113 Bacteria 1781
74 Ga0373953_0037212 3300035117 Bacteria 1920
75 Ga0373956_0010939 3300035119 Bacteria 3733
76 Ga0373957_0151340 3300035120 Bacteria 952
77 Ga0373955_0041211 3300035172 Bacteria 2474
78 Ga0373955_0076600 3300035172 Bacteria 1881
79 Ga0373924_0023293 3300035410 Bacteria 2427
80 Ga0373935_0047667 3300035692 Bacteria 2710
81 Ga0373927_0097651 3300035695 Bacteria 1910
82 Ga0373927_0243084 3300035695 Bacteria 1183
83 Ga0373933_0031580 3300035724 Bacteria 3072
84 Ga0373933_0076871 3300035724 Bacteria 2040
85 Ga0373937_0003156 3300036401 Bacteria 13799
86 Ga0373937_0020918 3300036401 Bacteria 5869
87 Ga0373937_0423742 3300036401 Bacteria 1263
88 Ga0373925_0012249 3300037068 Bacteria 6206
89 Ga0436364_0308618 3300037853 Bacteria 1763
90 Ga0436364_0478480 3300037853 Bacteria 14880
91 Ga0436365_0046693 3300039437 Bacteria 37239
92 Ga0436365_0499375 3300039437 Bacteria 98723
93 Ga0436360_0249220 3300039438 Bacteria 3715
94 Ga0436361_0440388 3300039447 Bacteria 2217
95 Ga0436363_0082072 3300039450 Bacteria 7150
96 Ga0436363_0720333 3300039450 Bacteria 51178
97 Ga0436363_1516470 3300039450 Bacteria 1933
98 Ga0436362_0079095 3300039453 Bacteria 2705
99 Ga0436362_1108670 3300039453 Bacteria 7124
100 Ga0439465_0006011 3300041413 Bacteria 3858
101 Ga0439432_042012 3300042006 Bacteria 1446
102 Ga0439449_0007163 3300042007 Bacteria 4242
103 Ga0466967_0521448 3300045976 Bacteria 1168
104 Ga0495592_0061728 3300046454 Bacteria 2754
105 Ga0495592_0166142 3300046454 Bacteria 1514
106 Ga0495629_0015079 3300046459 Bacteria 5555
107 Ga0495629_0059029 3300046459 Bacteria 2682
108 Ga0495638_0019165 3300046460 Bacteria 4529
109 Ga0495651_0005770 3300046462 Bacteria 9446
110 Ga0495651_0055159 3300046462 Bacteria 3054
111 Ga0495653_0067551 3300046463 Bacteria 2684
112 Ga0495664_0195115 3300046477 Bacteria 1227
113 Ga0495607_0114110 3300046501 Bacteria 1428
114 Ga0495606_0000939 3300046507 Bacteria 42966
115 Ga0495606_0010187 3300046507 Bacteria 7838
116 Ga0495608_0014306 3300046511 Bacteria 5505
117 Ga0495618_0023520 3300046514 Bacteria 3811
118 Ga0495628_0032399 3300046516 Bacteria 4219
119 Ga0495628_0167176 3300046516 Bacteria 1669
120 Ga0495632_0051349 3300046519 Bacteria 2030
121 Ga0495648_0083696 3300046524 Bacteria 1807
122 Ga0495652_0315509 3300046529 Bacteria 1131
123 Ga0495654_0002058 3300046530 Bacteria 13202
124 Ga0495640_0015104 3300046533 Bacteria 5817
125 Ga0495640_0016226 3300046533 Bacteria 5576
126 Ga0495587_0129314 3300046536 Bacteria 1444
127 Ga0495645_0357550 3300046543 Bacteria 939
128 Ga0495667_0028767 3300046559 Bacteria 3742
129 Ga0495667_0084307 3300046559 Bacteria 2063
130 Ga0495667_0124344 3300046559 Bacteria 1665
131 Ga0495634_0026755 3300046642 Bacteria 4022
132 Ga0495625_0153489 3300046660 Bacteria 1547
133 Ga0495635_0135852 3300046663 Bacteria 1676
134 Ga0495635_0176050 3300046663 Bacteria 1454
135 Ga0495657_0034209 3300046675 Bacteria 3531
136 Ga0495599_0320012 3300046678 Bacteria 934
137 Ga0495646_0053485 3300046680 Bacteria 2434
138 Ga0495658_0143013 3300046683 Bacteria 1464
139 Ga0495613_0381782 3300046689 Bacteria 963
140 Ga0495604_0066606 3300047317 Bacteria 2738
141 Ga0495674_0038228 3300047319 Bacteria 4309
142 Ga0495674_0111955 3300047319 Bacteria 2313
143 Ga0495674_0601159 3300047319 Bacteria 871
144 Ga0495680_0037921 3300047322 Bacteria 3857
145 Ga0495680_0114044 3300047322 Bacteria 2000
146 Ga0495675_0030160 3300047444 Bacteria 3460
147 Ga0495684_0257064 3300047471 Bacteria 1268
148 Ga0496104_0073452 3300048907 Bacteria 3254
149 Ga0496105_0070524 3300048908 Bacteria 2889
150 Ga0496106_0046601 3300048909 Bacteria 3260
151 Ga0496108_0029717 3300048911 Bacteria 4528
152 Ga0496109_0235109 3300048912 Bacteria 1724
153 Ga0496110_0111005 3300048913 Bacteria 2464
154 Ga0496111_0000543 3300048914 Bacteria 19512
155 Ga0496112_0005812 3300048915 Bacteria 10735
156 Ga0496112_0013393 3300048915 Bacteria 7570
157 Ga0496113_0067064 3300048916 Bacteria 2720
158 Ga0496113_0248505 3300048916 Bacteria 1420
159 Ga0496115_0013140 3300048918 Bacteria 6254
160 Ga0496121_0001395 3300048924 Bacteria 40879
161 Ga0496122_0022664 3300048925 Bacteria 5574
162 Ga0496122_0056396 3300048925 Bacteria 2929
163 Ga0496123_0007720 3300048926 Bacteria 10044
164 Ga0496124_0048730 3300048927 Bacteria 3618
165 Ga0496125_0000203 3300048928 Bacteria 125569
166 Ga0501034_0005856 3300049571 Bacteria 13374
167 Ga0501034_0172360 3300049571 Bacteria 2130
168 Ga0501036_0040434 3300049572 Bacteria 3944
169 Ga0501038_0096176 3300049574 Bacteria 2473
170 Ga0501039_0418652 3300049575 Bacteria 1052
171 Ga0501046_0346172 3300049580 Bacteria 1080
172 Ga0501083_0053995 3300049744 Bacteria 2697
173 Ga0501044_0043650 3300049823 Bacteria 4657
174 nmdc:mga00v17_86833_c1 3300050491 Bacteria 1960
175 nmdc:mga0a205_344542_c1 3300050515 Bacteria 1358
176 nmdc:mga0sz30_27593_c1 3300050516 Bacteria 2332
177 Ga0495612_0092107 3300053078 Bacteria 1284
178 Ga0500573_0002043 3300053140 Bacteria 9909
179 Ga0500573_0014211 3300053140 Bacteria 4501
180 Ga0500616_0005116 3300053153 Bacteria 9035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028379 Ga0268266_10257999 Ga0268266_102579991 239
2 iso_pu_bacteria 2829745981 2829747788 241
3 iso_pu_bacteria 2861691609 2861691885 241
4 iso_pu_bacteria 3003665799 3003668125 241
5 3300036401 Ga0373937_0423742 Ga0373937_0423742_262_1059 242
6 3300045976 Ga0466967_0521448 Ga0466967_0521448_287_1015 242
7 iso_pu_bacteria 2909042592 2909045577 244
8 iso_pu_bacteria 643348564 643602945 244
9 iso_pu_bacteria 2595698237 2596373733 245
10 iso_pu_bacteria 2889306138 2889307599 245
11 iso_pu_bacteria 2902405164 2902407135 245
12 iso_pu_bacteria 2928125067 2928127313 245
13 3300006186 Ga0075369_10024489 Ga0075369_100244893 246
14 3300031239 Ga0265328_10024889 Ga0265328_100248892 246
15 3300031250 Ga0265331_10000730 Ga0265331_1000073019 246
16 3300031251 Ga0265327_10004012 Ga0265327_1000401212 246
17 3300031344 Ga0265316_10018462 Ga0265316_100184626 246
18 3300031344 Ga0265316_10317840 Ga0265316_103178401 246
19 3300046530 Ga0495654_0002058 Ga0495654_0002058_6926_7960 246
20 3300050516 nmdc:mga0sz30_27593_c1 nmdc:mga0sz30_27593_c1_239_985 246
21 3300050491 nmdc:mga00v17_86833_c1 nmdc:mga00v17_86833_c1_290_1039 247
22 iso_pu_bacteria 2545555834 2545674814 247
23 iso_pu_bacteria 2738541281 2738746560 247
24 iso_pu_bacteria 2738543032 2739355790 247
25 iso_pu_bacteria 2842698319 2842700314 247
26 iso_pu_bacteria 641522639 641645145 247
27 3300009763 Ga0123340_1047660 Ga0123340_10476602 250
28 3300009765 Ga0123341_1021701 Ga0123341_10217012 250
29 3300009766 Ga0123342_1021407 Ga0123342_10214074 250
30 3300046543 Ga0495645_0357550 Ga0495645_0357550_71_889 251
31 3300021377 Ga0213874_10017656 Ga0213874_100176562 252
32 3300021384 Ga0213876_10000694 Ga0213876_1000069416 252
33 3300021384 Ga0213876_10004020 Ga0213876_100040209 252
34 3300021388 Ga0213875_10005144 Ga0213875_100051449 252
35 3300037853 Ga0436364_0308618 Ga0436364_0308618_909_1667 252
36 3300037853 Ga0436364_0478480 Ga0436364_0478480_2994_3755 252
37 3300039437 Ga0436365_0499375 Ga0436365_0499375_58541_59302 252
38 3300039450 Ga0436363_0720333 Ga0436363_0720333_39400_40161 252
39 3300039450 Ga0436363_1516470 Ga0436363_1516470_587_1348 252
40 3300039453 Ga0436362_1108670 Ga0436362_1108670_3225_3986 252
41 iso_pu_bacteria 2818991461 2819682859 252
42 3300006852 Ga0075433_10340772 Ga0075433_103407722 254
43 3300050515 nmdc:mga0a205_344542_c1 nmdc:mga0a205_344542_c1_288_1052 254
44 iso_pu_bacteria 2513237351 2514588466 254
45 iso_pu_bacteria 2724679232 2725952180 254
46 iso_pu_bacteria 8024479707 8024482561 254
47 3300039447 Ga0436361_0440388 Ga0436361_0440388_1008_1778 255
48 3300053153 Ga0500616_0005116 Ga0500616_0005116_6804_7583 256
49 iso_pu_bacteria 2599185236 2599719678 256
50 iso_pu_bacteria 2996310559 2996314356 256
51 3300005439 Ga0070711_100107629 Ga0070711_1001076292 257
52 3300025916 Ga0207663_10032465 Ga0207663_100324652 257
53 3300035117 Ga0373953_0037212 Ga0373953_0037212_765_1583 257
54 3300035120 Ga0373957_0151340 Ga0373957_0151340_35_853 257
55 3300035172 Ga0373955_0076600 Ga0373955_0076600_607_1425 257
56 3300035410 Ga0373924_0023293 Ga0373924_0023293_1364_2182 257
57 3300035724 Ga0373933_0031580 Ga0373933_0031580_1920_2738 257
58 3300046454 Ga0495592_0166142 Ga0495592_0166142_604_1422 257
59 3300046459 Ga0495629_0015079 Ga0495629_0015079_2053_2871 257
60 3300046462 Ga0495651_0055159 Ga0495651_0055159_785_1603 257
61 3300046463 Ga0495653_0067551 Ga0495653_0067551_137_955 257
62 3300046511 Ga0495608_0014306 Ga0495608_0014306_1766_2584 257
63 3300046514 Ga0495618_0023520 Ga0495618_0023520_2235_3053 257
64 3300046516 Ga0495628_0032399 Ga0495628_0032399_1830_2648 257
65 3300046533 Ga0495640_0016226 Ga0495640_0016226_3145_3963 257
66 3300046559 Ga0495667_0028767 Ga0495667_0028767_600_1418 257
67 3300046642 Ga0495634_0026755 Ga0495634_0026755_925_1743 257
68 3300046663 Ga0495635_0176050 Ga0495635_0176050_164_982 257
69 3300046678 Ga0495599_0320012 Ga0495599_0320012_89_907 257
70 3300046680 Ga0495646_0053485 Ga0495646_0053485_41_859 257
71 3300046683 Ga0495658_0143013 Ga0495658_0143013_332_1150 257
72 3300046689 Ga0495613_0381782 Ga0495613_0381782_22_840 257
73 3300047317 Ga0495604_0066606 Ga0495604_0066606_1464_2282 257
74 3300047319 Ga0495674_0038228 Ga0495674_0038228_758_1576 257
75 3300047322 Ga0495680_0114044 Ga0495680_0114044_286_1104 257
76 3300047444 Ga0495675_0030160 Ga0495675_0030160_287_1105 257
77 3300047471 Ga0495684_0257064 Ga0495684_0257064_165_983 257
78 3300053140 Ga0500573_0002043 Ga0500573_0002043_7400_8176 257
79 iso_pu_bacteria 2841840854 2841845348 257
80 iso_pu_bacteria 2913295892 2913295974 257
81 3300039453 Ga0436362_0079095 Ga0436362_0079095_1803_2588 258
82 3300049580 Ga0501046_0346172 Ga0501046_0346172_59_835 258
83 iso_pu_bacteria 2837678835 2837682854 258
84 iso_pu_bacteria 2838736955 2838741491 258
85 iso_pu_bacteria 2842140634 2842145051 258
86 iso_pu_bacteria 2857531043 2857537012 258
87 iso_pu_bacteria 8045864390 8045866835 258
88 3300025297 Ga0209758_1028178 Ga0209758_10281783 260
89 3300027876 Ga0209974_10043981 Ga0209974_100439813 260
90 3300039438 Ga0436360_0249220 Ga0436360_0249220_1064_1858 260
91 3300046533 Ga0495640_0015104 Ga0495640_0015104_966_1748 260
92 3300046559 Ga0495667_0084307 Ga0495667_0084307_656_1438 260
93 3300046663 Ga0495635_0135852 Ga0495635_0135852_521_1303 260
94 3300048924 Ga0496121_0001395 Ga0496121_0001395_32556_33419 260
95 3300006946 Ga0079104_1000950 Ga0079104_100095015 261
96 3300027111 Ga0209281_1000433 Ga0209281_100043315 261
97 3300035111 Ga0373923_0031163 Ga0373923_0031163_1187_1987 261
98 3300035113 Ga0373936_0044792 Ga0373936_0044792_610_1410 261
99 3300035172 Ga0373955_0041211 Ga0373955_0041211_359_1159 261
100 3300035692 Ga0373935_0047667 Ga0373935_0047667_1743_2543 261
101 3300035695 Ga0373927_0097651 Ga0373927_0097651_867_1667 261
102 3300035695 Ga0373927_0243084 Ga0373927_0243084_351_1151 261
103 3300035724 Ga0373933_0076871 Ga0373933_0076871_1031_1831 261
104 3300036401 Ga0373937_0003156 Ga0373937_0003156_6877_7677 261
105 3300036401 Ga0373937_0020918 Ga0373937_0020918_4499_5299 261
106 3300037068 Ga0373925_0012249 Ga0373925_0012249_4289_5089 261
107 3300046454 Ga0495592_0061728 Ga0495592_0061728_1514_2314 261
108 3300046459 Ga0495629_0059029 Ga0495629_0059029_1223_2023 261
109 3300046460 Ga0495638_0019165 Ga0495638_0019165_3139_3927 261
110 3300046462 Ga0495651_0005770 Ga0495651_0005770_4713_5513 261
111 3300046477 Ga0495664_0195115 Ga0495664_0195115_257_1057 261
112 3300046516 Ga0495628_0167176 Ga0495628_0167176_429_1229 261
113 3300046519 Ga0495632_0051349 Ga0495632_0051349_577_1407 261
114 3300046524 Ga0495648_0083696 Ga0495648_0083696_740_1567 261
115 3300046529 Ga0495652_0315509 Ga0495652_0315509_73_873 261
116 3300046536 Ga0495587_0129314 Ga0495587_0129314_466_1266 261
117 3300046559 Ga0495667_0124344 Ga0495667_0124344_48_848 261
118 3300046675 Ga0495657_0034209 Ga0495657_0034209_1069_1869 261
119 3300047319 Ga0495674_0111955 Ga0495674_0111955_920_1720 261
120 3300047319 Ga0495674_0601159 Ga0495674_0601159_10_810 261
121 3300047322 Ga0495680_0037921 Ga0495680_0037921_1896_2696 261
122 3300053140 Ga0500573_0014211 Ga0500573_0014211_71_859 261
123 3300048914 Ga0496111_0000543 Ga0496111_0000543_6884_7711 262
124 3300048925 Ga0496122_0022664 Ga0496122_0022664_3054_3881 262
125 3300048926 Ga0496123_0007720 Ga0496123_0007720_4235_5062 262
126 3300048927 Ga0496124_0048730 Ga0496124_0048730_627_1454 262
127 3300049571 Ga0501034_0005856 Ga0501034_0005856_2756_3556 262
128 iso_pu_bacteria 3003930520 3003935632 262
129 iso_pu_bacteria 2513237146 2513927138 263
130 iso_pu_bacteria 2599185170 2599415423 263
131 iso_pu_bacteria 2838035591 2838038855 263
132 iso_pu_bacteria 2838661181 2838664555 263
133 iso_pu_bacteria 2933016740 2933018648 263
134 iso_pu_bacteria 2765235802 2765468287 264
135 iso_pu_bacteria 2775506902 2776268564 264
136 iso_pu_bacteria 2775506904 2776285355 264
137 iso_pu_bacteria 2839993093 2839997606 264
138 iso_pu_bacteria 2894652903 2894657343 264
139 iso_pu_bacteria 2904578770 2904581916 264
140 iso_pu_bacteria 2919119836 2919123584 264
141 3300031995 Ga0307409_100088879 Ga0307409_1000888793 265
142 3300041413 Ga0439465_0006011 Ga0439465_0006011_555_1361 265
143 3300042006 Ga0439432_042012 Ga0439432_042012_179_985 265
144 3300042007 Ga0439449_0007163 Ga0439449_0007163_1973_2779 265
145 3300046501 Ga0495607_0114110 Ga0495607_0114110_376_1248 265
146 3300046507 Ga0495606_0010187 Ga0495606_0010187_6717_7523 265
147 3300049571 Ga0501034_0172360 Ga0501034_0172360_1143_1949 265
148 3300049572 Ga0501036_0040434 Ga0501036_0040434_2363_3169 265
149 3300049574 Ga0501038_0096176 Ga0501038_0096176_209_1015 265
150 3300049575 Ga0501039_0418652 Ga0501039_0418652_85_891 265
151 3300049744 Ga0501083_0053995 Ga0501083_0053995_1377_2183 265
152 3300049823 Ga0501044_0043650 Ga0501044_0043650_976_1782 265
153 3300046660 Ga0495625_0153489 Ga0495625_0153489_127_933 266
154 3300048925 Ga0496122_0056396 Ga0496122_0056396_926_1744 268
155 3300048928 Ga0496125_0000203 Ga0496125_0000203_14940_15758 268
156 3300005434 Ga0070709_10177422 Ga0070709_101774222 269
157 3300005435 Ga0070714_100017734 Ga0070714_1000177344 269
158 3300005436 Ga0070713_100047868 Ga0070713_1000478682 269
159 3300005437 Ga0070710_10004979 Ga0070710_100049795 269
160 3300005439 Ga0070711_100004294 Ga0070711_1000042944 269
161 3300006028 Ga0070717_10005769 Ga0070717_100057697 269
162 3300006163 Ga0070715_10000375 Ga0070715_100003754 269
163 3300006173 Ga0070716_100001019 Ga0070716_1000010198 269
164 3300006175 Ga0070712_100054091 Ga0070712_1000540914 269
165 3300025898 Ga0207692_10015381 Ga0207692_100153813 269
166 3300025905 Ga0207685_10037072 Ga0207685_100370722 269
167 3300025906 Ga0207699_10005178 Ga0207699_100051785 269
168 3300025915 Ga0207693_10002089 Ga0207693_100020895 269
169 3300025916 Ga0207663_10001142 Ga0207663_100011427 269
170 3300025928 Ga0207700_10006146 Ga0207700_100061465 269
171 3300025929 Ga0207664_10018451 Ga0207664_100184515 269
172 3300025939 Ga0207665_10002085 Ga0207665_1000208510 269
173 3300005439 Ga0070711_100123704 Ga0070711_1001237042 270
174 3300005842 Ga0068858_100329934 Ga0068858_1003299342 270
175 3300009545 Ga0105237_10074698 Ga0105237_100746982 270
176 3300013306 Ga0163162_10046354 Ga0163162_100463543 270
177 3300025914 Ga0207671_10078652 Ga0207671_100786522 270
178 3300025916 Ga0207663_10011734 Ga0207663_100117342 270
179 3300026035 Ga0207703_10134498 Ga0207703_101344982 270
180 3300026078 Ga0207702_10267361 Ga0207702_102673612 270
181 3300026095 Ga0207676_10371078 Ga0207676_103710782 270
182 3300048907 Ga0496104_0073452 Ga0496104_0073452_2113_2925 270
183 3300048908 Ga0496105_0070524 Ga0496105_0070524_1628_2440 270
184 3300048909 Ga0496106_0046601 Ga0496106_0046601_2168_2980 270
185 3300048911 Ga0496108_0029717 Ga0496108_0029717_3391_4203 270
186 3300048912 Ga0496109_0235109 Ga0496109_0235109_371_1183 270
187 3300048913 Ga0496110_0111005 Ga0496110_0111005_314_1126 270
188 3300048915 Ga0496112_0005812 Ga0496112_0005812_8485_9321 270
189 3300048915 Ga0496112_0013393 Ga0496112_0013393_3745_4557 270
190 3300048916 Ga0496113_0067064 Ga0496113_0067064_206_1018 270
191 3300048916 Ga0496113_0248505 Ga0496113_0248505_337_1173 270
192 3300048918 Ga0496115_0013140 Ga0496115_0013140_985_1797 270
193 3300006163 Ga0070715_10186853 Ga0070715_101868532 271
194 3300025909 Ga0207705_10178731 Ga0207705_101787312 271
195 3300005327 Ga0070658_10023915 Ga0070658_100239155 272
196 3300005329 Ga0070683_100019542 Ga0070683_1000195424 272
197 3300005336 Ga0070680_100221171 Ga0070680_1002211712 272
198 3300005339 Ga0070660_100062618 Ga0070660_1000626182 272
199 3300005535 Ga0070684_100010612 Ga0070684_1000106127 272
200 3300005539 Ga0068853_100002763 Ga0068853_1000027632 272
201 3300005563 Ga0068855_100123025 Ga0068855_1001230253 272
202 3300009093 Ga0105240_10009195 Ga0105240_100091954 272
203 3300009545 Ga0105237_10142004 Ga0105237_101420042 272
204 3300009551 Ga0105238_10073198 Ga0105238_100731983 272
205 3300010375 Ga0105239_10001659 Ga0105239_1000165910 272
206 3300013104 Ga0157370_10027640 Ga0157370_100276402 272
207 3300025912 Ga0207707_10000381 Ga0207707_1000038124 272
208 3300025913 Ga0207695_10048331 Ga0207695_100483313 272
209 3300025914 Ga0207671_10243841 Ga0207671_102438411 272
210 3300025919 Ga0207657_10000999 Ga0207657_1000099917 272
211 3300025921 Ga0207652_10001277 Ga0207652_100012774 272
212 3300025932 Ga0207690_10144922 Ga0207690_101449222 272
213 3300025944 Ga0207661_10034531 Ga0207661_100345316 272
214 3300025949 Ga0207667_10007770 Ga0207667_100077709 272
215 3300026041 Ga0207639_10014364 Ga0207639_100143646 272
216 3300035119 Ga0373956_0010939 Ga0373956_0010939_878_1696 272
217 3300039437 Ga0436365_0046693 Ga0436365_0046693_23970_24818 272
218 3300039450 Ga0436363_0082072 Ga0436363_0082072_5206_6054 272
219 3300046507 Ga0495606_0000939 Ga0495606_0000939_25655_26473 272
220 3300053078 Ga0495612_0092107 Ga0495612_0092107_374_1192 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

38

159

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.956 24 247
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9448 24 247
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9351 25 240
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9344 26 260
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9341 26 235
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9447 25 248 3.40.50.300
af_Q8T5Z7_540_794_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9444 25 247 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.941 25 247 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9387 25 251 3.40.50.300
af_Q2FW34_4_263_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9386 25 249 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A388Q5Q5-F1-model_v4 Uncharacterized ABC transporter ATP-binding protein YbhF 0.9726 25 246 GO:0005524
GO:0016887
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9721 25 207 GO:0005524
GO:0016887
AF-A0A7C4J2F6-F1-model_v4 ABC transporter ATP-binding protein 0.9698 27 249 GO:0005524
GO:0016887
AF-A0A7V3Y0W2-F1-model_v4 ABC transporter ATP-binding protein 0.9663 25 247 GO:0005524
GO:0016887
AF-A0A2V6WXH7-F1-model_v4 AAA+ ATPase domain-containing protein 0.9657 24 188 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.01 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map