F332433

General Info

Members Datasets Scaffolds Average Seq Length
220 139 440 295

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10179582|Ga0307414_101795822
Length 335
Sequence VGPQPLILGEMPSLSKLYINAAAQAARRRLLGTGDSSHLPEESHEVRGVAVDVANLTAYQHLLGETASDVLPAGFVHALAFPLAMSVMNRDDFPLPLLGMIHLGNRVEQRMPLLFTEALDITARVENLRGHRSGTQVDVVAEVRKSGSNAVCWLGVSTYLAKGIFLPGIDKPSAHHGKPDFRAPDPTALWQLGVDAGRAYAAVSGDFNPIHLSVLSAKALGMRRSIAHGMYLASRALADVGPARGDSFIWEVGFEAPVFLPARVALDISTEQDGTGGWYRSDFVAWNPRSGRRHFTGSVAALEVTAAGKGGEGSGRDTPGPAETGVSGLVQEERV

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
16 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
21 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
22 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
32 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
33 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
34 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
35 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
36 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
48 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
49 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
50 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
51 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
52 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
53 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
54 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
55 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
56 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
57 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
58 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
59 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
60 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
61 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
64 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
68 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
69 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
70 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
71 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
75 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
103 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
104 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
105 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
106 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
107 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
108 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
109 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
110 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
111 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
112 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
113 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
114 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
115 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
116 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
117 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
118 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
119 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
120 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
121 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
122 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
123 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
124 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
125 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
126 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
127 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
128 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
129 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
130 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
131 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
132 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
133 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
134 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
135 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
136 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
137 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
138 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
139 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.27
Metatranscriptomes 0.45
Isolates 17.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 5
Rhizosphere 84.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10179582 3300032004 Bacteria 1701
2 LJQas_1000901 3300000549 Bacteria 4621
3 JGI25152J39213_1000177 3300002773 Bacteria 42950
4 rootH2_10012136 3300003320 Bacteria 2504
5 Ga0065714_10083249 3300005288 Bacteria 2256
6 Ga0070677_10023378 3300005333 Bacteria 2288
7 Ga0070675_100021633 3300005354 Bacteria 5139
8 Ga0070674_100233683 3300005356 Bacteria 1436
9 Ga0070673_100164376 3300005364 Bacteria 1890
10 Ga0070667_100058897 3300005367 Bacteria 3248
11 Ga0070672_100020295 3300005543 Bacteria 4844
12 Ga0075432_10002029 3300006058 Bacteria 6734
13 Ga0105244_10001111 3300009036 Bacteria 22372
14 Ga0105244_10005496 3300009036 Bacteria 8414
15 Ga0105243_10079461 3300009148 Bacteria 2673
16 Ga0105243_10104555 3300009148 Bacteria 2357
17 Ga0105246_10003357 3300011119 Bacteria 9685
18 Ga0105246_10021465 3300011119 Bacteria 4156
19 Ga0105246_10022910 3300011119 Bacteria 4036
20 Ga0157373_10007733 3300013100 Bacteria 7991
21 Ga0157370_10043357 3300013104 Bacteria 4330
22 Ga0157369_10064048 3300013105 Bacteria 3960
23 Ga0157375_10171088 3300013308 Bacteria 2320
24 Ga0207425_1012048 3300025245 Bacteria 2041
25 Ga0209129_1000067 3300025258 Bacteria 219974
26 Ga0209025_1001150 3300025294 Bacteria 37667
27 Ga0207697_10142393 3300025315 Bacteria 1040
28 Ga0207655_1003577 3300025728 Bacteria 11496
29 Ga0207655_1004412 3300025728 Bacteria 9986
30 Ga0207645_10015780 3300025907 Bacteria 5008
31 Ga0207709_10074944 3300025935 Bacteria 2161
32 Ga0207691_10000545 3300025940 Bacteria 37727
33 Ga0207651_10256669 3300025960 Bacteria 1433
34 Ga0207658_10321336 3300025986 Bacteria 1340
35 Ga0207683_10009131 3300026121 Bacteria 8450
36 Ga0307408_100004357 3300031548 Bacteria 9615
37 Ga0307408_100031083 3300031548 Bacteria 3714
38 Ga0307408_100034071 3300031548 Bacteria 3563
39 Ga0307408_100036543 3300031548 Bacteria 3454
40 Ga0307408_100073686 3300031548 Bacteria 2531
41 Ga0307408_100092918 3300031548 Bacteria 2281
42 Ga0307408_100113517 3300031548 Bacteria 2085
43 Ga0307405_10003466 3300031731 Bacteria 7246
44 Ga0307405_10013486 3300031731 Bacteria 4362
45 Ga0307405_10023090 3300031731 Bacteria 3529
46 Ga0307405_10070830 3300031731 Bacteria 2241
47 Ga0307405_10182114 3300031731 Bacteria 1509
48 Ga0307413_10036954 3300031824 Bacteria 2817
49 Ga0307413_10090353 3300031824 Bacteria 1992
50 Ga0307410_10002045 3300031852 Bacteria 9525
51 Ga0307410_10041553 3300031852 Bacteria 3033
52 Ga0307410_10145926 3300031852 Bacteria 1756
53 Ga0307410_10172343 3300031852 Bacteria 1632
54 Ga0307406_10008559 3300031901 Bacteria 5713
55 Ga0307406_10034518 3300031901 Bacteria 3103
56 Ga0307407_10019089 3300031903 Bacteria 3484
57 Ga0307407_10024846 3300031903 Bacteria 3149
58 Ga0307407_10034857 3300031903 Bacteria 2760
59 Ga0307407_10075535 3300031903 Bacteria 2020
60 Ga0307407_10078549 3300031903 Bacteria 1988
61 Ga0307412_10000630 3300031911 Bacteria 20565
62 Ga0307412_10015955 3300031911 Bacteria 4463
63 Ga0307412_10042806 3300031911 Bacteria 2945
64 Ga0307412_10064736 3300031911 Bacteria 2471
65 Ga0307412_10086452 3300031911 Bacteria 2182
66 Ga0307412_10115674 3300031911 Bacteria 1923
67 Ga0307412_10115973 3300031911 Bacteria 1920
68 Ga0307412_10177020 3300031911 Bacteria 1600
69 Ga0307412_10202630 3300031911 Bacteria 1508
70 Ga0307409_100001667 3300031995 Bacteria 11161
71 Ga0307409_100059316 3300031995 Bacteria 2977
72 Ga0307409_100062555 3300031995 Bacteria 2914
73 Ga0307409_100091169 3300031995 Bacteria 2497
74 Ga0307409_100113049 3300031995 Bacteria 2281
75 Ga0307409_100226011 3300031995 Bacteria 1693
76 Ga0307416_100016664 3300032002 Bacteria 5116
77 Ga0307416_100058500 3300032002 Bacteria 3125
78 Ga0307416_100064186 3300032002 Bacteria 3011
79 Ga0307416_100072956 3300032002 Bacteria 2859
80 Ga0307416_100170023 3300032002 Bacteria 2027
81 Ga0307416_100683892 3300032002 Bacteria 1114
82 Ga0307416_100703910 3300032002 Bacteria 1099
83 Ga0307414_10027543 3300032004 Bacteria 3675
84 Ga0307414_10042901 3300032004 Bacteria 3077
85 Ga0307414_10107472 3300032004 Bacteria 2114
86 Ga0307411_10162031 3300032005 Bacteria 1677
87 Ga0307415_100051178 3300032126 Bacteria 2802
88 Ga0307415_100079214 3300032126 Bacteria 2339
89 Ga0307415_100263926 3300032126 Bacteria 1407
90 Ga0395899_0011418 3300037312 Bacteria 6800
91 Ga0395899_0031513 3300037312 Bacteria 3984
92 Ga0395900_0030804 3300037418 Bacteria 5509
93 Ga0395900_0126518 3300037418 Bacteria 2621
94 Ga0395900_0178778 3300037418 Bacteria 2157
95 Ga0395898_0036053 3300037466 Bacteria 4914
96 Ga0395898_0059863 3300037466 Bacteria 3703
97 Ga0395901_0017207 3300038443 Bacteria 7376
98 Ga0395901_0094848 3300038443 Bacteria 3126
99 Ga0439436_0000409 3300041404 Bacteria 10782
100 Ga0439438_012444 3300041405 Bacteria 2609
101 Ga0439465_0023240 3300041413 Bacteria 1950
102 Ga0451793_0882776 3300041452 Bacteria 2420
103 Ga0451837_0378029 3300041494 Bacteria 1092
104 Ga0451841_0079367 3300041498 Bacteria 870
105 Ga0439433_0001186 3300041999 Bacteria 5353
106 Ga0439433_0039209 3300041999 Bacteria 1100
107 Ga0439442_000013 3300042002 Bacteria 48856
108 Ga0439442_000075 3300042002 Bacteria 23367
109 Ga0439442_000758 3300042002 Bacteria 6760
110 Ga0439442_017443 3300042002 Bacteria 1481
111 Ga0439449_0003380 3300042007 Bacteria 6218
112 Ga0439449_0005951 3300042007 Bacteria 4658
113 Ga0439449_0007435 3300042007 Bacteria 4166
114 Ga0439449_0014780 3300042007 Bacteria 2933
115 Ga0439449_0046857 3300042007 Bacteria 1601
116 Ga0439457_014350 3300042014 Bacteria 1774
117 Ga0439457_015018 3300042014 Bacteria 1730
118 Ga0439457_027474 3300042014 Bacteria 1260
119 Ga0439462_0012075 3300042015 Bacteria 2204
120 Ga0439462_0014218 3300042015 Bacteria 2043
121 Ga0439462_0043168 3300042015 Bacteria 1205
122 Ga0450919_004722 3300042121 Bacteria 1656
123 Ga0450920_000831 3300042122 Bacteria 5002
124 Ga0450920_001499 3300042122 Bacteria 3872
125 Ga0450907_000059 3300042146 Bacteria 43871
126 Ga0439434_0000507 3300042435 Bacteria 11105
127 Ga0450918_000241 3300042531 Bacteria 12493
128 Ga0495629_0055333 3300046459 Bacteria 2774
129 Ga0495653_0007132 3300046463 Bacteria 9159
130 Ga0495582_0213443 3300046473 Bacteria 1103
131 Ga0495662_0008154 3300046476 Bacteria 5161
132 Ga0495664_0037380 3300046477 Bacteria 2865
133 Ga0495594_0016613 3300046499 Bacteria 3880
134 Ga0495610_0145773 3300046512 Bacteria 1015
135 Ga0495642_0025622 3300046528 Bacteria 2338
136 Ga0495642_0037468 3300046528 Bacteria 1962
137 Ga0495665_0000608 3300046531 Bacteria 18224
138 Ga0495586_0000834 3300046535 Bacteria 17681
139 Ga0495586_0078587 3300046535 Bacteria 1810
140 Ga0495587_0001954 3300046536 Bacteria 13740
141 Ga0495645_0007843 3300046543 Bacteria 7429
142 Ga0495645_0198694 3300046543 Bacteria 1362
143 Ga0495667_0001259 3300046559 Bacteria 16597
144 Ga0495588_0002360 3300046674 Bacteria 8080
145 Ga0495588_0014952 3300046674 Bacteria 3725
146 Ga0495657_0018171 3300046675 Bacteria 5094
147 Ga0495600_0009137 3300046809 Bacteria 6113
148 Ga0495581_0005090 3300047315 Bacteria 7613
149 Ga0495581_0068994 3300047315 Bacteria 2044
150 Ga0495581_0071416 3300047315 Bacteria 2008
151 Ga0495680_0013717 3300047322 Bacteria 7053
152 Ga0495675_0004544 3300047444 Bacteria 8411
153 Ga0495677_0080451 3300047445 Bacteria 1221
154 Ga0495684_0175161 3300047471 Bacteria 1593
155 Ga0495593_0057271 3300047673 Bacteria 2047
156 Ga0496100_0162595 3300048903 Bacteria 1601
157 Ga0496102_0344792 3300048905 Bacteria 1402
158 Ga0496103_0256484 3300048906 Bacteria 1125
159 Ga0496107_0289321 3300048910 Bacteria 1219
160 Ga0496107_0388504 3300048910 Bacteria 1038
161 Ga0496108_0029041 3300048911 Bacteria 4576
162 Ga0496112_0062898 3300048915 Bacteria 3662
163 Ga0496112_0221831 3300048915 Bacteria 1846
164 Ga0496113_0045241 3300048916 Bacteria 3264
165 Ga0496113_0181784 3300048916 Bacteria 1667
166 Ga0501325_002740 3300049541 Bacteria 1231
167 Ga0501032_0000496 3300049569 Bacteria 31802
168 Ga0501032_0008995 3300049569 Bacteria 7262
169 Ga0501034_0000016 3300049571 Bacteria 289751
170 Ga0501037_0002588 3300049573 Bacteria 13072
171 Ga0501037_0011860 3300049573 Bacteria 6417
172 Ga0501038_0014138 3300049574 Bacteria 7271
173 Ga0501038_0068871 3300049574 Bacteria 3007
174 Ga0501038_0140911 3300049574 Bacteria 1972
175 Ga0501039_0011128 3300049575 Bacteria 6857
176 Ga0501039_0015152 3300049575 Bacteria 5899
177 Ga0501043_0020819 3300049579 Bacteria 5144
178 Ga0501043_0210875 3300049579 Bacteria 1505
179 Ga0501046_0011046 3300049580 Bacteria 7737
180 Ga0501070_0042927 3300049586 Bacteria 3765
181 Ga0501266_014264 3300049763 Bacteria 1040
182 Ga0501082_0051510 3300060353 Bacteria 3548
183 2537900179 2537561592 Bacteria 4348607
184 2555229824 2554235227 Bacteria 3637389
185 2644524882 2643221694 Bacteria 4392972
186 2644668968 2643221722 Bacteria 4247614
187 2655032525 2654587600 Bacteria 3911798
188 2691513882 2690315906 Bacteria 4517044
189 2775656890 2775506735 Bacteria 4556596
190 2808831147 2808606357 Bacteria 4466944
191 2808852411 2808606360 Bacteria 4404006
192 2808879297 2808606366 Bacteria 4415912
193 2808891202 2808606370 Bacteria 4942454
194 2808896457 2808606371 Bacteria 4251511
195 2812321155 2811994871 Bacteria 4497550
196 2857742099 2857740372 Bacteria 4782044
197 2887447270 2887443736 Bacteria 4426037
198 2904498210 2904497146 Bacteria 4731781
199 2904777569 2904776348 Bacteria 4658726
200 2910810415 2910809715 Bacteria 4982797
201 2919034942 2919034639 Bacteria 4763403
202 2919059765 2919059106 Bacteria 4991624
203 2919394743 2919391150 Bacteria 4884741
204 2919540402 2919538618 Bacteria 4677069
205 2932428256 2932426870 Bacteria 4547726
206 2933421095 2933418574 Bacteria 4476724
207 2939601293 2939598168 Bacteria 4687164
208 2939648661 2939647034 Bacteria 4681660
209 2939675287 2939674588 Bacteria 4844420
210 2945918910 2945916053 Bacteria 4555517
211 2945920722 2945920336 Bacteria 4501603
212 2945943093 2945941187 Bacteria 4682474
213 2945959168 2945956166 Bacteria 5110334
214 2946038985 2946037020 Bacteria 4900426
215 2946062767 2946059875 Bacteria 4386623
216 2954000391 2953998280 Bacteria 4812144
217 2974306896 2974302888 Bacteria 4369871
218 8004024982 8004021418 Bacteria 4313954
219 8004027318 8004025490 Bacteria 4327753
220 8054107849 8054107350 Bacteria 5022511
221 Ga0307414_10179582
222 LJQas_1000901
223 JGI25152J39213_1000177
224 rootH2_10012136
225 Ga0065714_10083249
226 Ga0070677_10023378
227 Ga0070675_100021633
228 Ga0070674_100233683
229 Ga0070673_100164376
230 Ga0070667_100058897
231 Ga0070672_100020295
232 Ga0075432_10002029
233 Ga0105244_10001111
234 Ga0105244_10005496
235 Ga0105243_10079461
236 Ga0105243_10104555
237 Ga0105246_10003357
238 Ga0105246_10021465
239 Ga0105246_10022910
240 Ga0157373_10007733
241 Ga0157370_10043357
242 Ga0157369_10064048
243 Ga0157375_10171088
244 Ga0207425_1012048
245 Ga0209129_1000067
246 Ga0209025_1001150
247 Ga0207697_10142393
248 Ga0207655_1003577
249 Ga0207655_1004412
250 Ga0207645_10015780
251 Ga0207709_10074944
252 Ga0207691_10000545
253 Ga0207651_10256669
254 Ga0207658_10321336
255 Ga0207683_10009131
256 Ga0307408_100004357
257 Ga0307408_100031083
258 Ga0307408_100034071
259 Ga0307408_100036543
260 Ga0307408_100073686
261 Ga0307408_100092918
262 Ga0307408_100113517
263 Ga0307405_10003466
264 Ga0307405_10013486
265 Ga0307405_10023090
266 Ga0307405_10070830
267 Ga0307405_10182114
268 Ga0307413_10036954
269 Ga0307413_10090353
270 Ga0307410_10002045
271 Ga0307410_10041553
272 Ga0307410_10145926
273 Ga0307410_10172343
274 Ga0307406_10008559
275 Ga0307406_10034518
276 Ga0307407_10019089
277 Ga0307407_10024846
278 Ga0307407_10034857
279 Ga0307407_10075535
280 Ga0307407_10078549
281 Ga0307412_10000630
282 Ga0307412_10015955
283 Ga0307412_10042806
284 Ga0307412_10064736
285 Ga0307412_10086452
286 Ga0307412_10115674
287 Ga0307412_10115973
288 Ga0307412_10177020
289 Ga0307412_10202630
290 Ga0307409_100001667
291 Ga0307409_100059316
292 Ga0307409_100062555
293 Ga0307409_100091169
294 Ga0307409_100113049
295 Ga0307409_100226011
296 Ga0307416_100016664
297 Ga0307416_100058500
298 Ga0307416_100064186
299 Ga0307416_100072956
300 Ga0307416_100170023
301 Ga0307416_100683892
302 Ga0307416_100703910
303 Ga0307414_10027543
304 Ga0307414_10042901
305 Ga0307414_10107472
306 Ga0307411_10162031
307 Ga0307415_100051178
308 Ga0307415_100079214
309 Ga0307415_100263926
310 Ga0395899_0011418
311 Ga0395899_0031513
312 Ga0395900_0030804
313 Ga0395900_0126518
314 Ga0395900_0178778
315 Ga0395898_0036053
316 Ga0395898_0059863
317 Ga0395901_0017207
318 Ga0395901_0094848
319 Ga0439436_0000409
320 Ga0439438_012444
321 Ga0439465_0023240
322 Ga0451793_0882776
323 Ga0451837_0378029
324 Ga0451841_0079367
325 Ga0439433_0001186
326 Ga0439433_0039209
327 Ga0439442_000013
328 Ga0439442_000075
329 Ga0439442_000758
330 Ga0439442_017443
331 Ga0439449_0003380
332 Ga0439449_0005951
333 Ga0439449_0007435
334 Ga0439449_0014780
335 Ga0439449_0046857
336 Ga0439457_014350
337 Ga0439457_015018
338 Ga0439457_027474
339 Ga0439462_0012075
340 Ga0439462_0014218
341 Ga0439462_0043168
342 Ga0450919_004722
343 Ga0450920_000831
344 Ga0450920_001499
345 Ga0450907_000059
346 Ga0439434_0000507
347 Ga0450918_000241
348 Ga0495629_0055333
349 Ga0495653_0007132
350 Ga0495582_0213443
351 Ga0495662_0008154
352 Ga0495664_0037380
353 Ga0495594_0016613
354 Ga0495610_0145773
355 Ga0495642_0025622
356 Ga0495642_0037468
357 Ga0495665_0000608
358 Ga0495586_0000834
359 Ga0495586_0078587
360 Ga0495587_0001954
361 Ga0495645_0007843
362 Ga0495645_0198694
363 Ga0495667_0001259
364 Ga0495588_0002360
365 Ga0495588_0014952
366 Ga0495657_0018171
367 Ga0495600_0009137
368 Ga0495581_0005090
369 Ga0495581_0068994
370 Ga0495581_0071416
371 Ga0495680_0013717
372 Ga0495675_0004544
373 Ga0495677_0080451
374 Ga0495684_0175161
375 Ga0495593_0057271
376 Ga0496100_0162595
377 Ga0496102_0344792
378 Ga0496103_0256484
379 Ga0496107_0289321
380 Ga0496107_0388504
381 Ga0496108_0029041
382 Ga0496112_0062898
383 Ga0496112_0221831
384 Ga0496113_0045241
385 Ga0496113_0181784
386 Ga0501325_002740
387 Ga0501032_0000496
388 Ga0501032_0008995
389 Ga0501034_0000016
390 Ga0501037_0002588
391 Ga0501037_0011860
392 Ga0501038_0014138
393 Ga0501038_0068871
394 Ga0501038_0140911
395 Ga0501039_0011128
396 Ga0501039_0015152
397 Ga0501043_0020819
398 Ga0501043_0210875
399 Ga0501046_0011046
400 Ga0501070_0042927
401 Ga0501266_014264
402 Ga0501082_0051510
403 2537900179
404 2555229824
405 2644524882
406 2644668968
407 2655032525
408 2691513882
409 2775656890
410 2808831147
411 2808852411
412 2808879297
413 2808891202
414 2808896457
415 2812321155
416 2857742099
417 2887447270
418 2904498210
419 2904777569
420 2910810415
421 2919034942
422 2919059765
423 2919394743
424 2919540402
425 2932428256
426 2933421095
427 2939601293
428 2939648661
429 2939675287
430 2945918910
431 2945920722
432 2945943093
433 2945959168
434 2946038985
435 2946062767
436 2954000391
437 2974306896
438 8004024982
439 8004027318
440 8054107849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

170

280

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wew-assembly1.cif.gz_A crystal structure of htdx (rv0241c) of mycobacterium tuberculosis at 2.4 a resolution 0.9354 44 301
3wew-assembly1.cif.gz_A crystal structure of htdx (rv0241c) of mycobacterium tuberculosis at 2.4 a resolution 0.9277 44 301
4oob-assembly1.cif.gz_A crystal structure of htdx(rv0241c) from mycobacterium tuberculosis 0.8652 46 301
4oob-assembly1.cif.gz_A crystal structure of htdx(rv0241c) from mycobacterium tuberculosis 0.8554 46 301
4rlw-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with butein 0.8478 46 162
ID Description Score Start End Superfamily
af_Q9W439_57_173_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9043 98 159 3.10.129.10
af_Q2G0K1_2_118_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8823 46 159 3.10.129.10
af_Q5A0N4_66_202_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8686 99 158 3.10.129.10
4oobA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8652 46 301 3.10.129.10
af_Q2G0K1_32_119_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8597 68 160 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1H1Z675-F1-model_v4 MaoC like domain-containing protein 0.9938 2 301 GO:0004312
GO:0005835
GO:0006633
AF-A0A1H1Z675-F1-model_v4 MaoC like domain-containing protein 0.9873 2 301 GO:0004312
GO:0005835
GO:0006633
AF-A0A2V5LHU5-F1-model_v4 MaoC-like domain-containing protein 0.9792 12 301 GO:0004312
GO:0005835
GO:0006633
AF-A0A7Y0MGQ7-F1-model_v4 MaoC-like domain-containing protein 0.9577 1 301 GO:0004312
GO:0005835
GO:0006633
AF-A0A7Y0MGQ7-F1-model_v4 MaoC-like domain-containing protein 0.9546 1 301 GO:0004312
GO:0005835
GO:0006633

Map