F332345

General Info

Members Datasets Scaffolds Average Seq Length
220 141 217 257

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10178679|Ga0207670_101786791
Length 288
Sequence VWRRNFLVWRKLAIPSVLGNLADPMLYMLGLGYGLGTLLPQVDGTPYITFLAAGTVCYSTMNSATFEALYSAFSRMHVQKTWDAILNTPMGLDDVVLAEVIWAASKSVLSGAAIVIIIWALGLSHSPLTLWIFPLTLLIGLTFGSLGLVMTAFAPSYDFFMYYFTLVITPMVLLCGVFFPIAQLPPLFQYVAGVLPLTHASGLVRPLMNDHIPNAWWLHVAVLAGYAAAGFSSKRRFCRFSARKVVISVAQRLQSSNRLLNSWPESRLYWQELAGLFNCSLPLTRLVA

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
104 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
105 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
137 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
138 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
139 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 0.91
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100126955 3300005331 Bacteria 2202
2 Ga0070680_100260867 3300005336 Bacteria 1466
3 Ga0068868_100074177 3300005338 Bacteria 2717
4 Ga0068868_100330369 3300005338 Bacteria 1301
5 Ga0070691_10280235 3300005341 Bacteria 904
6 Ga0070692_10024376 3300005345 Bacteria 2973
7 Ga0070674_100221510 3300005356 Bacteria 1472
8 Ga0070673_100176965 3300005364 Bacteria 1824
9 Ga0070673_100416607 3300005364 Bacteria 1204
10 Ga0070688_100178441 3300005365 Bacteria 1471
11 Ga0070667_100705757 3300005367 Bacteria 934
12 Ga0070700_100126268 3300005441 Bacteria 1720
13 Ga0070694_100281903 3300005444 Bacteria 1267
14 Ga0070694_100520340 3300005444 Bacteria 949
15 Ga0070681_10134930 3300005458 Bacteria 2399
16 Ga0068867_100012234 3300005459 Bacteria 6065
17 Ga0070697_100124354 3300005536 Bacteria 2160
18 Ga0068853_100031621 3300005539 Bacteria 4477
19 Ga0070686_100343331 3300005544 Bacteria 1119
20 Ga0070695_100122851 3300005545 Bacteria 1779
21 Ga0070695_100138589 3300005545 Bacteria 1684
22 Ga0070696_100101319 3300005546 Bacteria 2064
23 Ga0070696_100279202 3300005546 Bacteria 1273
24 Ga0070665_100116712 3300005548 Bacteria 2672
25 Ga0068855_100035868 3300005563 Bacteria 5906
26 Ga0070664_100036137 3300005564 Bacteria 4150
27 Ga0068857_100006660 3300005577 Bacteria 9926
28 Ga0068856_100069875 3300005614 Bacteria 3473
29 Ga0068856_100360131 3300005614 Bacteria 1473
30 Ga0068859_100006929 3300005617 Bacteria 11508
31 Ga0068859_100945579 3300005617 Bacteria 945
32 Ga0068864_100507882 3300005618 Bacteria 1161
33 Ga0068863_100020923 3300005841 Bacteria 6248
34 Ga0068858_100001596 3300005842 Bacteria 23124
35 Ga0068858_100010808 3300005842 Bacteria 8630
36 Ga0068862_100127968 3300005844 Bacteria 2244
37 Ga0070716_100004488 3300006173 Bacteria 6677
38 Ga0097621_100340251 3300006237 Bacteria 1332
39 Ga0068871_100066781 3300006358 Bacteria 2949
40 Ga0075430_100167001 3300006846 Bacteria 1831
41 Ga0068865_100125591 3300006881 Bacteria 1914
42 Ga0068865_100317853 3300006881 Bacteria 1251
43 Ga0068865_100351720 3300006881 Bacteria 1194
44 Ga0097620_100006929 3300006931 Bacteria 11508
45 Ga0097620_100945707 3300006931 Bacteria 945
46 Ga0099794_10037360 3300007265 Bacteria 2299
47 Ga0105240_10203323 3300009093 Bacteria 2320
48 Ga0111539_10055424 3300009094 Bacteria 4712
49 Ga0111539_10428229 3300009094 Bacteria 1541
50 Ga0105245_10154452 3300009098 Bacteria 2173
51 Ga0105245_10271343 3300009098 Bacteria 1655
52 Ga0105247_10005196 3300009101 Bacteria 8231
53 Ga0105243_10091971 3300009148 Bacteria 2500
54 Ga0105241_10003948 3300009174 Bacteria 10975
55 Ga0105241_10114136 3300009174 Bacteria 2166
56 Ga0105241_10129077 3300009174 Bacteria 2044
57 Ga0105242_10031301 3300009176 Bacteria 4248
58 Ga0105248_10000992 3300009177 Bacteria 31434
59 Ga0105237_10016087 3300009545 Bacteria 7781
60 Ga0105237_10032247 3300009545 Bacteria 5305
61 Ga0105238_10404550 3300009551 Bacteria 1358
62 Ga0105249_10247429 3300009553 Bacteria 1766
63 Ga0105239_10082040 3300010375 Bacteria 3550
64 Ga0105239_10297125 3300010375 Bacteria 1819
65 Ga0105239_10520561 3300010375 Bacteria 1353
66 Ga0105246_10064289 3300011119 Bacteria 2563
67 Ga0157369_10442467 3300013105 Bacteria 1346
68 Ga0157374_10078401 3300013296 Bacteria 3128
69 Ga0157374_10238988 3300013296 Bacteria 1786
70 Ga0157374_10355950 3300013296 Bacteria 1455
71 Ga0157374_10439454 3300013296 Bacteria 1305
72 Ga0157378_10064164 3300013297 Bacteria 3284
73 Ga0157378_10351099 3300013297 Bacteria 1441
74 Ga0163162_10191134 3300013306 Bacteria 2175
75 Ga0163162_10499207 3300013306 Bacteria 1347
76 Ga0163162_10567131 3300013306 Bacteria 1263
77 Ga0157372_10039610 3300013307 Bacteria 5201
78 Ga0157375_10045551 3300013308 Bacteria 4270
79 Ga0157375_10101514 3300013308 Bacteria 2960
80 Ga0157375_10481241 3300013308 Bacteria 1406
81 Ga0163163_10024034 3300014325 Bacteria 5797
82 Ga0157379_10067099 3300014968 Bacteria 3208
83 Ga0157376_10012058 3300014969 Bacteria 6398
84 Ga0207642_10156933 3300025899 Bacteria 1217
85 Ga0207654_10008208 3300025911 Bacteria 5267
86 Ga0207695_10104171 3300025913 Bacteria 2827
87 Ga0207671_10025541 3300025914 Bacteria 4437
88 Ga0207652_10552302 3300025921 Bacteria 1035
89 Ga0207687_10096924 3300025927 Bacteria 2162
90 Ga0207670_10178679 3300025936 Bacteria 1597
91 Ga0207704_10116988 3300025938 Bacteria 1815
92 Ga0207704_10295602 3300025938 Bacteria 1238
93 Ga0207665_10002227 3300025939 Bacteria 13083
94 Ga0207711_10018678 3300025941 Bacteria 5764
95 Ga0207689_10022518 3300025942 Bacteria 5297
96 Ga0207679_10203630 3300025945 Bacteria 1655
97 Ga0207667_10028143 3300025949 Bacteria 6105
98 Ga0207667_10344434 3300025949 Bacteria 1520
99 Ga0207677_10117633 3300026023 Bacteria 1993
100 Ga0207703_10006739 3300026035 Bacteria 9161
101 Ga0207703_10007101 3300026035 Bacteria 8909
102 Ga0207708_10090480 3300026075 Bacteria 2359
103 Ga0207708_10338430 3300026075 Bacteria 1232
104 Ga0207702_10366178 3300026078 Bacteria 1383
105 Ga0207648_10009225 3300026089 Bacteria 9476
106 Ga0207674_10015715 3300026116 Bacteria 8305
107 Ga0207675_100099171 3300026118 Bacteria 2744
108 Ga0207683_10204217 3300026121 Bacteria 1797
109 Ga0209981_1000274 3300027378 Bacteria 6602
110 Ga0210000_1001631 3300027462 Bacteria 3167
111 Ga0209588_1017153 3300027671 Bacteria 2242
112 Ga0207428_10395564 3300027907 Bacteria 1012
113 Ga0268266_10272231 3300028379 Bacteria 1572
114 Ga0268264_10524310 3300028381 Unclassified 1159
115 Ga0265323_10006829 3300028653 Bacteria 4775
116 Ga0265336_10004828 3300028666 Bacteria 5050
117 Ga0265336_10067976 3300028666 Bacteria 1066
118 Ga0265338_10076020 3300028800 Bacteria 2847
119 Ga0265324_10000004 3300029957 Bacteria 356972
120 Ga0265324_10005489 3300029957 Bacteria 5472
121 Ga0265332_10000092 3300031238 Bacteria 78570
122 Ga0265325_10000084 3300031241 Bacteria 66026
123 Ga0265331_10112665 3300031250 Bacteria 1247
124 Ga0265327_10066994 3300031251 Bacteria 1810
125 Ga0265316_10040794 3300031344 Bacteria 3720
126 Ga0265316_10185261 3300031344 Bacteria 1549
127 Ga0307509_10000032 3300031507 Bacteria 202919
128 Ga0307508_10058709 3300031616 Bacteria 3404
129 Ga0316575_10000182 3300031665 Bacteria 16330
130 Ga0265314_10000706 3300031711 Bacteria 40494
131 Ga0265314_10017532 3300031711 Bacteria 5618
132 Ga0307413_10058308 3300031824 Bacteria 2366
133 Ga0307411_10059229 3300032005 Bacteria 2538
134 Ga0307411_10156512 3300032005 Bacteria 1701
135 Ga0373960_0004399 3300035121 Bacteria 3226
136 Ga0373961_0008046 3300035241 Bacteria 2560
137 Ga0451804_1131734 3300041463 Bacteria 1661
138 Ga0439434_0000212 3300042435 Bacteria 16124
139 Ga0439435_0000206 3300042436 Bacteria 8300
140 Ga0451577_0000085 3300042876 Bacteria 211141
141 Ga0451577_0003213 3300042876 Bacteria 18353
142 Ga0451577_0006917 3300042876 Bacteria 11212
143 Ga0451577_0050286 3300042876 Bacteria 3721
144 Ga0451577_0068565 3300042876 Bacteria 3163
145 Ga0451577_0115224 3300042876 Bacteria 2406
146 Ga0451577_0260034 3300042876 Bacteria 1572
147 Ga0451577_0315417 3300042876 Bacteria 1417
148 Ga0451577_0451802 3300042876 Bacteria 1167
149 Ga0451577_0482455 3300042876 Bacteria 1125
150 Ga0453683_0000047 3300044673 Bacteria 207763
151 Ga0453683_0047650 3300044673 Bacteria 2688
152 Ga0453684_0000273 3300044712 Bacteria 222658
153 Ga0453684_0000276 3300044712 Bacteria 222326
154 Ga0453684_0000302 3300044712 Bacteria 207763
155 Ga0453684_0001463 3300044712 Bacteria 66902
156 Ga0453684_0002114 3300044712 Bacteria 50142
157 Ga0453684_0022295 3300044712 Bacteria 9404
158 Ga0453684_0065106 3300044712 Bacteria 4650
159 Ga0453684_0178952 3300044712 Bacteria 2491
160 Ga0453684_0338412 3300044712 Bacteria 1700
161 Ga0453684_0470326 3300044712 Bacteria 1396
162 Ga0453684_0533225 3300044712 Bacteria 1295
163 Ga0453684_0737454 3300044712 Bacteria 1067
164 Ga0453684_1021393 3300044712 Bacteria 878
165 Ga0453684_1051658 3300044712 Bacteria 863
166 Ga0451576_0000006 3300045051 Bacteria 949698
167 Ga0451576_0000116 3300045051 Bacteria 207763
168 Ga0451576_0000147 3300045051 Bacteria 179223
169 Ga0451576_0004266 3300045051 Bacteria 18738
170 Ga0451576_0004790 3300045051 Bacteria 17343
171 Ga0451576_0004853 3300045051 Bacteria 17226
172 Ga0451576_0005529 3300045051 Bacteria 15785
173 Ga0451576_0006253 3300045051 Bacteria 14658
174 Ga0451576_0012963 3300045051 Bacteria 9342
175 Ga0451576_0016984 3300045051 Bacteria 8015
176 Ga0451576_0050285 3300045051 Bacteria 4371
177 Ga0451576_0066956 3300045051 Bacteria 3738
178 Ga0451576_0075857 3300045051 Bacteria 3499
179 Ga0451576_0076225 3300045051 Bacteria 3490
180 Ga0451576_0100376 3300045051 Bacteria 3010
181 Ga0496103_0340812 3300048906 Bacteria 964
182 Ga0501036_0210452 3300049572 Bacteria 1634
183 Ga0501037_0003806 3300049573 Bacteria 10947
184 Ga0501038_0113812 3300049574 Bacteria 2238
185 Ga0501039_0003932 3300049575 Bacteria 11168
186 Ga0501039_0116601 3300049575 Bacteria 2091
187 Ga0501041_0004135 3300049577 Bacteria 8394
188 Ga0501042_0006414 3300049578 Bacteria 7630
189 Ga0501043_0150165 3300049579 Bacteria 1823
190 Ga0501068_0007273 3300049584 Bacteria 6131
191 Ga0501068_0110686 3300049584 Bacteria 1707
192 Ga0501070_0007828 3300049586 Bacteria 9057
193 Ga0501070_0122484 3300049586 Bacteria 2149
194 Ga0501070_0342900 3300049586 Bacteria 1213
195 Ga0501071_0201445 3300049587 Bacteria 1495
196 Ga0501072_0211752 3300049588 Bacteria 1544
197 Ga0501073_0000811 3300049589 Bacteria 22210
198 Ga0501074_0035229 3300049590 Bacteria 3626
199 Ga0501075_0002497 3300049591 Bacteria 12252
200 Ga0501076_0002131 3300049592 Bacteria 13585
201 Ga0501209_064881 3300049656 Bacteria 1027
202 Ga0501079_0008832 3300049741 Bacteria 7630
203 Ga0501080_0006805 3300049742 Bacteria 10306
204 Ga0501080_0018160 3300049742 Bacteria 6510
205 Ga0501081_0000696 3300049743 Bacteria 19414
206 Ga0501083_0044001 3300049744 Bacteria 3023
207 Ga0501035_0100607 3300049822 Bacteria 2538
208 Ga0501045_0108737 3300049824 Bacteria 2055
209 Ga0501045_0184205 3300049824 Bacteria 1556
210 nmdc:mga0qj67_101896_c1 3300050509 Bacteria 2315
211 nmdc:mga08y16_35981_c1 3300050511 Bacteria 5199
212 Ga0500607_014498 3300053121 Bacteria 4565
213 Ga0500636_0000250 3300053177 Bacteria 29581
214 Ga0500637_0005994 3300053178 Bacteria 5940
215 Ga0500625_001806 3300053729 Bacteria 7633
216 Ga0501082_0000754 3300060353 Bacteria 28420
217 Ga0501082_0066792 3300060353 Bacteria 3097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100069875 Ga0068856_1000698754 219
2 3300009093 Ga0105240_10203323 Ga0105240_102033232 219
3 3300025913 Ga0207695_10104171 Ga0207695_101041714 220
4 3300025949 Ga0207667_10344434 Ga0207667_103444342 220
5 3300005336 Ga0070680_100260867 Ga0070680_1002608672 226
6 3300013306 Ga0163162_10499207 Ga0163162_104992072 226
7 3300005536 Ga0070697_100124354 Ga0070697_1001243542 228
8 3300006173 Ga0070716_100004488 Ga0070716_1000044884 228
9 3300025939 Ga0207665_10002227 Ga0207665_100022275 228
10 3300049656 Ga0501209_064881 Ga0501209_064881_215_943 228
11 3300005842 Ga0068858_100001596 Ga0068858_10000159620 229
12 3300009551 Ga0105238_10404550 Ga0105238_104045501 229
13 3300026035 Ga0207703_10007101 Ga0207703_100071014 229
14 3300027671 Ga0209588_1017153 Ga0209588_10171532 229
15 3300045051 Ga0451576_0050285 Ga0451576_0050285_1223_2017 232
16 3300049824 Ga0501045_0184205 Ga0501045_0184205_131_916 233
17 3300013297 Ga0157378_10064164 Ga0157378_100641642 237
18 3300025936 Ga0207670_10178679 Ga0207670_101786791 237
19 3300014325 Ga0163163_10024034 Ga0163163_100240344 238
20 3300031238 Ga0265332_10000092 Ga0265332_1000009255 240
21 3300005341 Ga0070691_10280235 Ga0070691_102802351 241
22 3300042876 Ga0451577_0260034 Ga0451577_0260034_48_800 243
23 3300044673 Ga0453683_0047650 Ga0453683_0047650_1357_2139 243
24 3300045051 Ga0451576_0076225 Ga0451576_0076225_1559_2341 243
25 3300045051 Ga0451576_0000147 Ga0451576_0000147_163752_164531 244
26 3300042876 Ga0451577_0115224 Ga0451577_0115224_83_862 247
27 3300044712 Ga0453684_0533225 Ga0453684_0533225_20_799 247
28 3300044712 Ga0453684_1051658 Ga0453684_1051658_11_790 247
29 3300049586 Ga0501070_0122484 Ga0501070_0122484_430_1218 247
30 3300045051 Ga0451576_0075857 Ga0451576_0075857_875_1642 248
31 3300006846 Ga0075430_100167001 Ga0075430_1001670012 249
32 3300028653 Ga0265323_10006829 Ga0265323_100068292 249
33 3300031344 Ga0265316_10040794 Ga0265316_100407942 249
34 3300031344 Ga0265316_10185261 Ga0265316_101852613 249
35 3300031616 Ga0307508_10058709 Ga0307508_100587093 249
36 3300044712 Ga0453684_0001463 Ga0453684_0001463_51559_52329 249
37 3300044712 Ga0453684_0065106 Ga0453684_0065106_2845_3615 249
38 3300044712 Ga0453684_0338412 Ga0453684_0338412_836_1621 249
39 3300044712 Ga0453684_0737454 Ga0453684_0737454_209_979 249
40 3300045051 Ga0451576_0066956 Ga0451576_0066956_431_1201 249
41 3300050509 nmdc:mga0qj67_101896_c1 nmdc:mga0qj67_101896_c1_830_1621 249
42 3300013306 Ga0163162_10567131 Ga0163162_105671312 250
43 3300031824 Ga0307413_10058308 Ga0307413_100583082 250
44 3300032005 Ga0307411_10059229 Ga0307411_100592293 250
45 3300032005 Ga0307411_10156512 Ga0307411_101565122 250
46 3300045051 Ga0451576_0012963 Ga0451576_0012963_1865_2638 250
47 3300053177 Ga0500636_0000250 Ga0500636_0000250_2944_3717 250
48 iso_pu_bacteria 639633007 639785461 250
49 3300031251 Ga0265327_10066994 Ga0265327_100669942 251
50 3300028666 Ga0265336_10004828 Ga0265336_100048283 252
51 3300028666 Ga0265336_10067976 Ga0265336_100679761 252
52 3300028800 Ga0265338_10076020 Ga0265338_100760203 252
53 3300029957 Ga0265324_10000004 Ga0265324_1000000486 252
54 3300029957 Ga0265324_10005489 Ga0265324_100054898 252
55 3300031241 Ga0265325_10000084 Ga0265325_1000008431 252
56 3300031250 Ga0265331_10112665 Ga0265331_101126651 252
57 3300031711 Ga0265314_10000706 Ga0265314_100007063 252
58 3300031711 Ga0265314_10017532 Ga0265314_100175326 252
59 3300042876 Ga0451577_0068565 Ga0451577_0068565_336_1115 252
60 3300044712 Ga0453684_0000276 Ga0453684_0000276_51897_52676 252
61 3300044712 Ga0453684_1021393 Ga0453684_1021393_50_829 252
62 3300045051 Ga0451576_0004853 Ga0451576_0004853_6175_6954 252
63 3300045051 Ga0451576_0016984 Ga0451576_0016984_6177_6956 252
64 3300045051 Ga0451576_0100376 Ga0451576_0100376_269_1048 252
65 3300035121 Ga0373960_0004399 Ga0373960_0004399_2152_2937 253
66 3300035241 Ga0373961_0008046 Ga0373961_0008046_1605_2390 253
67 3300042876 Ga0451577_0315417 Ga0451577_0315417_259_1041 253
68 iso_pu_bacteria 2891633521 2891633630 253
69 3300005331 Ga0070670_100126955 Ga0070670_1001269552 254
70 3300005338 Ga0068868_100074177 Ga0068868_1000741771 254
71 3300005338 Ga0068868_100330369 Ga0068868_1003303692 254
72 3300005345 Ga0070692_10024376 Ga0070692_100243763 254
73 3300005356 Ga0070674_100221510 Ga0070674_1002215101 254
74 3300005364 Ga0070673_100176965 Ga0070673_1001769653 254
75 3300005364 Ga0070673_100416607 Ga0070673_1004166071 254
76 3300005365 Ga0070688_100178441 Ga0070688_1001784411 254
77 3300005367 Ga0070667_100705757 Ga0070667_1007057571 254
78 3300005441 Ga0070700_100126268 Ga0070700_1001262681 254
79 3300005444 Ga0070694_100281903 Ga0070694_1002819031 254
80 3300005444 Ga0070694_100520340 Ga0070694_1005203401 254
81 3300005458 Ga0070681_10134930 Ga0070681_101349303 254
82 3300005459 Ga0068867_100012234 Ga0068867_1000122344 254
83 3300005539 Ga0068853_100031621 Ga0068853_1000316215 254
84 3300005544 Ga0070686_100343331 Ga0070686_1003433311 254
85 3300005545 Ga0070695_100122851 Ga0070695_1001228511 254
86 3300005545 Ga0070695_100138589 Ga0070695_1001385892 254
87 3300005546 Ga0070696_100101319 Ga0070696_1001013192 254
88 3300005546 Ga0070696_100279202 Ga0070696_1002792022 254
89 3300005548 Ga0070665_100116712 Ga0070665_1001167122 254
90 3300005563 Ga0068855_100035868 Ga0068855_1000358686 254
91 3300005564 Ga0070664_100036137 Ga0070664_1000361372 254
92 3300005577 Ga0068857_100006660 Ga0068857_10000666013 254
93 3300005614 Ga0068856_100360131 Ga0068856_1003601312 254
94 3300005617 Ga0068859_100006929 Ga0068859_1000069293 254
95 3300005617 Ga0068859_100945579 Ga0068859_1009455792 254
96 3300005618 Ga0068864_100507882 Ga0068864_1005078822 254
97 3300005841 Ga0068863_100020923 Ga0068863_1000209235 254
98 3300005842 Ga0068858_100010808 Ga0068858_1000108082 254
99 3300005844 Ga0068862_100127968 Ga0068862_1001279683 254
100 3300006237 Ga0097621_100340251 Ga0097621_1003402512 254
101 3300006358 Ga0068871_100066781 Ga0068871_1000667813 254
102 3300006881 Ga0068865_100125591 Ga0068865_1001255912 254
103 3300006881 Ga0068865_100317853 Ga0068865_1003178531 254
104 3300006881 Ga0068865_100351720 Ga0068865_1003517202 254
105 3300006931 Ga0097620_100006929 Ga0097620_10000692912 254
106 3300006931 Ga0097620_100945707 Ga0097620_1009457072 254
107 3300007265 Ga0099794_10037360 Ga0099794_100373602 254
108 3300009094 Ga0111539_10055424 Ga0111539_100554242 254
109 3300009094 Ga0111539_10428229 Ga0111539_104282291 254
110 3300009098 Ga0105245_10154452 Ga0105245_101544523 254
111 3300009098 Ga0105245_10271343 Ga0105245_102713433 254
112 3300009101 Ga0105247_10005196 Ga0105247_100051968 254
113 3300009148 Ga0105243_10091971 Ga0105243_100919714 254
114 3300009174 Ga0105241_10003948 Ga0105241_100039484 254
115 3300009174 Ga0105241_10114136 Ga0105241_101141362 254
116 3300009174 Ga0105241_10129077 Ga0105241_101290772 254
117 3300009176 Ga0105242_10031301 Ga0105242_100313014 254
118 3300009177 Ga0105248_10000992 Ga0105248_1000099224 254
119 3300009545 Ga0105237_10016087 Ga0105237_100160877 254
120 3300009545 Ga0105237_10032247 Ga0105237_100322476 254
121 3300009553 Ga0105249_10247429 Ga0105249_102474292 254
122 3300010375 Ga0105239_10082040 Ga0105239_100820402 254
123 3300010375 Ga0105239_10297125 Ga0105239_102971252 254
124 3300010375 Ga0105239_10520561 Ga0105239_105205611 254
125 3300011119 Ga0105246_10064289 Ga0105246_100642893 254
126 3300013105 Ga0157369_10442467 Ga0157369_104424672 254
127 3300013296 Ga0157374_10078401 Ga0157374_100784013 254
128 3300013296 Ga0157374_10238988 Ga0157374_102389883 254
129 3300013296 Ga0157374_10355950 Ga0157374_103559503 254
130 3300013296 Ga0157374_10439454 Ga0157374_104394541 254
131 3300013297 Ga0157378_10351099 Ga0157378_103510993 254
132 3300013306 Ga0163162_10191134 Ga0163162_101911342 254
133 3300013307 Ga0157372_10039610 Ga0157372_100396102 254
134 3300013308 Ga0157375_10045551 Ga0157375_100455515 254
135 3300013308 Ga0157375_10101514 Ga0157375_101015145 254
136 3300013308 Ga0157375_10481241 Ga0157375_104812411 254
137 3300014968 Ga0157379_10067099 Ga0157379_100670992 254
138 3300014969 Ga0157376_10012058 Ga0157376_100120585 254
139 3300025899 Ga0207642_10156933 Ga0207642_101569332 254
140 3300025911 Ga0207654_10008208 Ga0207654_100082084 254
141 3300025914 Ga0207671_10025541 Ga0207671_100255412 254
142 3300025921 Ga0207652_10552302 Ga0207652_105523022 254
143 3300025927 Ga0207687_10096924 Ga0207687_100969243 254
144 3300025938 Ga0207704_10116988 Ga0207704_101169882 254
145 3300025938 Ga0207704_10295602 Ga0207704_102956022 254
146 3300025941 Ga0207711_10018678 Ga0207711_100186782 254
147 3300025942 Ga0207689_10022518 Ga0207689_100225186 254
148 3300025945 Ga0207679_10203630 Ga0207679_102036302 254
149 3300025949 Ga0207667_10028143 Ga0207667_100281439 254
150 3300026023 Ga0207677_10117633 Ga0207677_101176334 254
151 3300026035 Ga0207703_10006739 Ga0207703_100067392 254
152 3300026075 Ga0207708_10090480 Ga0207708_100904801 254
153 3300026075 Ga0207708_10338430 Ga0207708_103384302 254
154 3300026078 Ga0207702_10366178 Ga0207702_103661782 254
155 3300026089 Ga0207648_10009225 Ga0207648_100092255 254
156 3300026116 Ga0207674_10015715 Ga0207674_100157152 254
157 3300026118 Ga0207675_100099171 Ga0207675_1000991712 254
158 3300026121 Ga0207683_10204217 Ga0207683_102042172 254
159 3300027378 Ga0209981_1000274 Ga0209981_10002745 254
160 3300027462 Ga0210000_1001631 Ga0210000_10016313 254
161 3300027907 Ga0207428_10395564 Ga0207428_103955642 254
162 3300028379 Ga0268266_10272231 Ga0268266_102722312 254
163 3300028381 Ga0268264_10524310 Ga0268264_105243101 254
164 3300031507 Ga0307509_10000032 Ga0307509_10000032141 254
165 3300031665 Ga0316575_10000182 Ga0316575_1000018212 254
166 3300041463 Ga0451804_1131734 Ga0451804_1131734_830_1615 254
167 3300042435 Ga0439434_0000212 Ga0439434_0000212_10974_11759 254
168 3300042436 Ga0439435_0000206 Ga0439435_0000206_961_1746 254
169 3300042876 Ga0451577_0000085 Ga0451577_0000085_126498_127283 254
170 3300042876 Ga0451577_0003213 Ga0451577_0003213_11031_11816 254
171 3300042876 Ga0451577_0006917 Ga0451577_0006917_874_1659 254
172 3300042876 Ga0451577_0050286 Ga0451577_0050286_926_1711 254
173 3300042876 Ga0451577_0451802 Ga0451577_0451802_150_935 254
174 3300042876 Ga0451577_0482455 Ga0451577_0482455_216_1001 254
175 3300044673 Ga0453683_0000047 Ga0453683_0000047_123120_123905 254
176 3300044712 Ga0453684_0000273 Ga0453684_0000273_97395_98180 254
177 3300044712 Ga0453684_0000302 Ga0453684_0000302_83859_84644 254
178 3300044712 Ga0453684_0002114 Ga0453684_0002114_18609_19394 254
179 3300044712 Ga0453684_0022295 Ga0453684_0022295_6259_7044 254
180 3300044712 Ga0453684_0178952 Ga0453684_0178952_652_1437 254
181 3300044712 Ga0453684_0470326 Ga0453684_0470326_13_798 254
182 3300045051 Ga0451576_0000006 Ga0451576_0000006_293483_294268 254
183 3300045051 Ga0451576_0000116 Ga0451576_0000116_123120_123905 254
184 3300045051 Ga0451576_0004266 Ga0451576_0004266_13400_14185 254
185 3300045051 Ga0451576_0004790 Ga0451576_0004790_11636_12430 254
186 3300045051 Ga0451576_0005529 Ga0451576_0005529_2746_3531 254
187 3300045051 Ga0451576_0006253 Ga0451576_0006253_2336_3121 254
188 3300048906 Ga0496103_0340812 Ga0496103_0340812_37_825 254
189 3300049572 Ga0501036_0210452 Ga0501036_0210452_206_991 254
190 3300049573 Ga0501037_0003806 Ga0501037_0003806_4540_5325 254
191 3300049574 Ga0501038_0113812 Ga0501038_0113812_362_1147 254
192 3300049575 Ga0501039_0003932 Ga0501039_0003932_6595_7380 254
193 3300049575 Ga0501039_0116601 Ga0501039_0116601_759_1544 254
194 3300049577 Ga0501041_0004135 Ga0501041_0004135_1868_2653 254
195 3300049578 Ga0501042_0006414 Ga0501042_0006414_1701_2486 254
196 3300049579 Ga0501043_0150165 Ga0501043_0150165_167_952 254
197 3300049584 Ga0501068_0007273 Ga0501068_0007273_1802_2587 254
198 3300049584 Ga0501068_0110686 Ga0501068_0110686_356_1141 254
199 3300049586 Ga0501070_0007828 Ga0501070_0007828_797_1582 254
200 3300049586 Ga0501070_0342900 Ga0501070_0342900_380_1168 254
201 3300049587 Ga0501071_0201445 Ga0501071_0201445_94_879 254
202 3300049588 Ga0501072_0211752 Ga0501072_0211752_747_1532 254
203 3300049589 Ga0501073_0000811 Ga0501073_0000811_13061_13846 254
204 3300049590 Ga0501074_0035229 Ga0501074_0035229_2466_3251 254
205 3300049591 Ga0501075_0002497 Ga0501075_0002497_5463_6248 254
206 3300049592 Ga0501076_0002131 Ga0501076_0002131_4898_5683 254
207 3300049741 Ga0501079_0008832 Ga0501079_0008832_6376_7161 254
208 3300049742 Ga0501080_0006805 Ga0501080_0006805_2362_3147 254
209 3300049742 Ga0501080_0018160 Ga0501080_0018160_4040_4825 254
210 3300049743 Ga0501081_0000696 Ga0501081_0000696_6546_7331 254
211 3300049744 Ga0501083_0044001 Ga0501083_0044001_39_824 254
212 3300049822 Ga0501035_0100607 Ga0501035_0100607_158_943 254
213 3300049824 Ga0501045_0108737 Ga0501045_0108737_456_1241 254
214 3300050511 nmdc:mga08y16_35981_c1 nmdc:mga08y16_35981_c1_3352_4137 254
215 3300053121 Ga0500607_014498 Ga0500607_014498_331_1116 254
216 3300053178 Ga0500637_0005994 Ga0500637_0005994_673_1458 254
217 3300053729 Ga0500625_001806 Ga0500625_001806_801_1586 254
218 3300060353 Ga0501082_0000754 Ga0501082_0000754_6441_7226 254
219 3300060353 Ga0501082_0066792 Ga0501082_0066792_398_1183 254
220 iso_pu_bacteria 2547132512 2548847594 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

1

209

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r88-assembly1.cif.gz_B the structure of human abcg5-i529w/abcg8-wt 0.7391 14 249
8i3b-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in nanodisc 0.7243 27 250
7r8a-assembly1.cif.gz_A the structure of human abcg5/abcg8 purified from mammalian cells 0.7079 15 251
7r8d-assembly1.cif.gz_B the structure of human abcg1 e242q with cholesterol 0.705 14 251
8wbx-assembly1.cif.gz_B cryo-em structure of the abcg25 bound to aba 0.7019 15 250
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8233 51 245 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7385 35 247 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7017 3 247 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6762 3 247 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.647 51 245 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A2M7C2L9-F1-model_v4 Transport permease protein 0.9851 50 254 GO:0043190
GO:0140359
AF-A0A2M7C2L9-F1-model_v4 Transport permease protein 0.9804 50 254 GO:0043190
GO:0140359
AF-A0A2L1CLI0-F1-model_v4 deleted 0.9738 66 254
AF-A0A534VGJ6-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9697 37 254 GO:0043190
GO:0140359
AF-A0A534ZIS0-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.969 72 254 GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
83.24 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map