F332236

General Info

Members Datasets Scaffolds Average Seq Length
220 146 215 349

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10097272|Ga0157371_100972722
Length 398
Sequence MIGGRRMAANNLALHEMMISKEQSKNRFFIPRFSYPNLQVIFSQLFPVAKKFVPLSMKSRLLLFVCIFSGLLACQSQTTNKIANATMTKAAMQFLQSLTPAQKAKAQFLFDDEERYHWHYVPMDRKGIPLKELTDKQIKGAMDLLHTALSDTGFEKTTAIIKLENVLREIENASPDYRNPGNYYFSIFGNPADSIWGWRLEGHHVSLNFSALKNQLISGSPGFLGANPAVVLSGPQKGLEILKDEGSLGLELLHALTAEQKPKAIINVRAPGDIITGNNRKAMIQSLQGIAFRELNGDQQKIFLQLLSIYLHRYKNELASKMMHDIEEAGLNNLRFAWAGAEEDGVGHPHYYRIQGPTIIIEYDNTQNNANHVHTVVRDLKNDFGGDELLEHYKNSKH

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
4 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
5 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
6 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
124 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
125 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
126 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
127 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
128 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
129 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
130 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
131 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
142 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
143 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
144 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.36
Nodule 0
Rhizoplane 0
Rhizosphere 89.09
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1249102 2162886011 Bacteria 2431
2 JGI24740J21852_10027459 3300001979 Bacteria 1893
3 rootL2_10019977 3300003322 Bacteria 2179
4 rootL2_10089812 3300003322 Bacteria 2889
5 rootH1_10159534 3300003323 Bacteria 1934
6 rootH1_10279876 3300003323 Unclassified 1725
7 JGI25160J50197_1005181 3300003354 Bacteria 5469
8 JGI25160J50197_1017944 3300003354 Unclassified 2222
9 Ga0065714_10090258 3300005288 Bacteria 1950
10 Ga0065704_10105177 3300005289 Bacteria 2119
11 Ga0065712_10007939 3300005290 Unclassified 4212
12 Ga0065712_10075946 3300005290 Bacteria 3759
13 Ga0065712_10082069 3300005290 Bacteria 2934
14 Ga0070690_100151451 3300005330 Bacteria 1583
15 Ga0070670_100219187 3300005331 Bacteria 1655
16 Ga0070670_100238674 3300005331 Bacteria 1582
17 Ga0070677_10022370 3300005333 Bacteria 2327
18 Ga0068869_100307536 3300005334 Unclassified 1282
19 Ga0070666_10042082 3300005335 Bacteria 3055
20 Ga0070689_100015575 3300005340 Bacteria 5548
21 Ga0070661_100074712 3300005344 Bacteria 2496
22 Ga0070668_100061663 3300005347 Bacteria 2905
23 Ga0070668_100167068 3300005347 Bacteria 1789
24 Ga0070669_100045627 3300005353 Bacteria 3194
25 Ga0070669_100047508 3300005353 Unclassified 3131
26 Ga0070675_100016175 3300005354 Bacteria 5915
27 Ga0070675_100059451 3300005354 Bacteria 3153
28 Ga0070675_100325270 3300005354 Bacteria 1359
29 Ga0070671_100212446 3300005355 Unclassified 1641
30 Ga0070673_100028950 3300005364 Bacteria 4126
31 Ga0070659_100002659 3300005366 Bacteria 12715
32 Ga0070667_100266842 3300005367 Bacteria 1534
33 Ga0070678_100116538 3300005456 Bacteria 2099
34 Ga0070662_100104461 3300005457 Bacteria 2150
35 Ga0070681_10252511 3300005458 Bacteria 1676
36 Ga0070685_10011316 3300005466 Unclassified 4672
37 Ga0070685_10152761 3300005466 Bacteria 1464
38 Ga0070698_100056737 3300005471 Bacteria 3967
39 Ga0070698_100223393 3300005471 Bacteria 1817
40 Ga0068853_100132928 3300005539 Bacteria 2228
41 Ga0070672_100087240 3300005543 Bacteria 2510
42 Ga0070693_100120734 3300005547 Bacteria 1625
43 Ga0068855_100020810 3300005563 Bacteria 7866
44 Ga0070664_100019126 3300005564 Bacteria 5631
45 Ga0070664_100268134 3300005564 Unclassified 1537
46 Ga0068857_100041367 3300005577 Unclassified 4087
47 Ga0068857_100119461 3300005577 Bacteria 2372
48 Ga0068857_100298135 3300005577 Bacteria 1486
49 Ga0068854_100027962 3300005578 Bacteria 3892
50 Ga0068856_100017904 3300005614 Bacteria 6871
51 Ga0068852_100278588 3300005616 Bacteria 1611
52 Ga0068852_100401935 3300005616 Unclassified 1348
53 Ga0068859_100021777 3300005617 Bacteria 6428
54 Ga0068859_100053234 3300005617 Bacteria 4070
55 Ga0068870_10006650 3300005840 Bacteria 5109
56 Ga0068863_100482022 3300005841 Bacteria 1220
57 Ga0068860_100032647 3300005843 Bacteria 5001
58 Ga0068860_100175570 3300005843 Bacteria 2070
59 Ga0068862_100011611 3300005844 Bacteria 7267
60 Ga0068862_100433847 3300005844 Bacteria 1235
61 Ga0081539_10001239 3300005985 Bacteria 45441
62 Ga0081539_10056335 3300005985 Bacteria 2182
63 Ga0097621_100149593 3300006237 Unclassified 2002
64 Ga0068871_100137372 3300006358 Bacteria 2077
65 Ga0075428_100000817 3300006844 Bacteria 32586
66 Ga0075428_100067683 3300006844 Bacteria 3908
67 Ga0075430_100042694 3300006846 Bacteria 3834
68 Ga0075430_100054330 3300006846 Bacteria 3370
69 Ga0075431_100009835 3300006847 Bacteria 9603
70 Ga0075431_100062774 3300006847 Bacteria 3834
71 Ga0075431_100271259 3300006847 Bacteria 1719
72 Ga0075433_10013220 3300006852 Bacteria 6702
73 Ga0075434_100087995 3300006871 Bacteria 3107
74 Ga0075429_100006495 3300006880 Bacteria 10126
75 Ga0097620_100021778 3300006931 Bacteria 6428
76 Ga0097620_100053233 3300006931 Bacteria 4070
77 Ga0111539_10014537 3300009094 Bacteria 9830
78 Ga0105247_10005373 3300009101 Bacteria 8074
79 Ga0114129_10018289 3300009147 Bacteria 9982
80 Ga0114129_10130386 3300009147 Bacteria 3453
81 Ga0105237_10011311 3300009545 Bacteria 9442
82 Ga0105237_10042757 3300009545 Bacteria 4568
83 Ga0105249_10000440 3300009553 Bacteria 39169
84 Ga0105249_10020664 3300009553 Bacteria 5887
85 Ga0105249_10023933 3300009553 Bacteria 5486
86 Ga0105249_10089561 3300009553 Bacteria 2876
87 Ga0105239_10005067 3300010375 Bacteria 15560
88 Ga0105239_10005938 3300010375 Bacteria 14209
89 Ga0105239_10135634 3300010375 Bacteria 2740
90 Ga0157373_10024593 3300013100 Unclassified 4362
91 Ga0157371_10097272 3300013102 Bacteria 2086
92 Ga0157371_10155646 3300013102 Bacteria 1631
93 Ga0157371_10161059 3300013102 Unclassified 1603
94 Ga0157374_10012336 3300013296 Bacteria 7435
95 Ga0157374_10024469 3300013296 Bacteria 5415
96 Ga0157378_10016504 3300013297 Bacteria 6467
97 Ga0157378_10096165 3300013297 Bacteria 2699
98 Ga0163162_10044393 3300013306 Bacteria 4452
99 Ga0163162_10124012 3300013306 Bacteria 2689
100 Ga0163162_10155996 3300013306 Bacteria 2403
101 Ga0163162_10198625 3300013306 Bacteria 2134
102 Ga0157372_10070115 3300013307 Bacteria 3943
103 Ga0157372_10102790 3300013307 Unclassified 3265
104 Ga0157375_10005940 3300013308 Bacteria 10638
105 Ga0163163_10209416 3300014325 Bacteria 1998
106 Ga0157380_10004719 3300014326 Bacteria 9486
107 Ga0157380_10017234 3300014326 Bacteria 5343
108 Ga0157380_10081696 3300014326 Unclassified 2644
109 Ga0157380_10132295 3300014326 Bacteria 2130
110 Ga0157380_10160561 3300014326 Unclassified 1953
111 Ga0157377_10002627 3300014745 Bacteria 7974
112 Ga0157377_10024074 3300014745 Unclassified 3233
113 Ga0157376_10021514 3300014969 Bacteria 5010
114 Ga0157376_10083734 3300014969 Bacteria 2744
115 Ga0157376_10173775 3300014969 Bacteria 1964
116 Ga0163161_10204176 3300017792 Unclassified 1524
117 Ga0209436_101838 3300025208 Bacteria 6880
118 Ga0209130_1001119 3300025284 Bacteria 19701
119 Ga0207426_1000002 3300025302 Bacteria 1249660
120 Ga0207426_1000446 3300025302 Bacteria 66148
121 Ga0207642_10066812 3300025899 Bacteria 1695
122 Ga0207710_10002540 3300025900 Bacteria 8441
123 Ga0207680_10084204 3300025903 Bacteria 2006
124 Ga0207643_10016983 3300025908 Bacteria 3972
125 Ga0207705_10117643 3300025909 Bacteria 1969
126 Ga0207707_10148335 3300025912 Bacteria 2051
127 Ga0207671_10032230 3300025914 Bacteria 3901
128 Ga0207671_10141767 3300025914 Bacteria 1852
129 Ga0207657_10051135 3300025919 Unclassified 3592
130 Ga0207650_10015656 3300025925 Bacteria 5287
131 Ga0207650_10307600 3300025925 Unclassified 1296
132 Ga0207659_10022404 3300025926 Bacteria 4206
133 Ga0207659_10032211 3300025926 Bacteria 3595
134 Ga0207690_10032485 3300025932 Bacteria 3349
135 Ga0207706_10001298 3300025933 Bacteria 25177
136 Ga0207706_10069004 3300025933 Bacteria 3109
137 Ga0207670_10009425 3300025936 Bacteria 5573
138 Ga0207670_10104129 3300025936 Bacteria 2032
139 Ga0207691_10082225 3300025940 Bacteria 2893
140 Ga0207691_10365669 3300025940 Bacteria 1233
141 Ga0207679_10024842 3300025945 Bacteria 4113
142 Ga0207679_10091570 3300025945 Unclassified 2353
143 Ga0207679_10114012 3300025945 Bacteria 2139
144 Ga0207667_10008777 3300025949 Bacteria 11970
145 Ga0207667_10190478 3300025949 Bacteria 2104
146 Ga0207712_10004069 3300025961 Bacteria 9228
147 Ga0207712_10012055 3300025961 Bacteria 5519
148 Ga0207712_10045550 3300025961 Bacteria 3038
149 Ga0207712_10304807 3300025961 Bacteria 1309
150 Ga0207640_10085193 3300025981 Bacteria 2172
151 Ga0207677_10245690 3300026023 Bacteria 1450
152 Ga0207639_10117947 3300026041 Bacteria 2175
153 Ga0207708_10235107 3300026075 Unclassified 1472
154 Ga0207702_10035124 3300026078 Bacteria 4192
155 Ga0207676_10042276 3300026095 Bacteria 3505
156 Ga0207674_10008842 3300026116 Bacteria 11586
157 Ga0207674_10021267 3300026116 Bacteria 6992
158 Ga0207674_10056508 3300026116 Bacteria 3985
159 Ga0207674_10086044 3300026116 Bacteria 3138
160 Ga0207674_10253317 3300026116 Bacteria 1707
161 Ga0207675_100017196 3300026118 Bacteria 6753
162 Ga0207675_100030395 3300026118 Bacteria 5031
163 Ga0207675_100198412 3300026118 Bacteria 1927
164 Ga0207675_100220672 3300026118 Bacteria 1826
165 Ga0207698_10256182 3300026142 Bacteria 1605
166 Ga0207428_10059226 3300027907 Bacteria 3037
167 Ga0268265_10038258 3300028380 Unclassified 3528
168 Ga0268264_10013712 3300028381 Bacteria 6672
169 Ga0307511_10000033 3300030521 Bacteria 104421
170 Ga0265327_10000031 3300031251 Bacteria 325718
171 Ga0265327_10009252 3300031251 Bacteria 7144
172 Ga0265327_10014995 3300031251 Bacteria 5038
173 Ga0307513_10158750 3300031456 Bacteria 2157
174 Ga0307413_10099982 3300031824 Unclassified 1914
175 Ga0451851_0378835 3300041507 Unclassified 1904
176 Ga0451853_0783540 3300041512 Bacteria 4751
177 Ga0466972_0109946 3300044658 Bacteria 1303
178 Ga0466959_0065368 3300045049 Bacteria 2639
179 Ga0495668_0004553 3300046616 Bacteria 9766
180 Ga0495672_0035063 3300047320 Bacteria 3092
181 Ga0501298_002399 3300049521 Unclassified 2830
182 Ga0501032_0017895 3300049569 Bacteria 4972
183 Ga0501033_0196524 3300049570 Bacteria 1442
184 Ga0501037_0005464 3300049573 Bacteria 9259
185 Ga0501046_0204969 3300049580 Bacteria 1466
186 Ga0501047_0333114 3300049581 Bacteria 1356
187 Ga0501047_0355928 3300049581 Unclassified 1300
188 Ga0501198_000192 3300049649 Bacteria 7992
189 Ga0501207_000627 3300049654 Unclassified 4089
190 Ga0501217_000871 3300049661 Bacteria 5359
191 Ga0501233_006117 3300049668 Unclassified 2252
192 Ga0501235_001047 3300049669 Bacteria 5763
193 Ga0501242_001288 3300049674 Unclassified 2480
194 Ga0501243_000386 3300049675 Bacteria 5810
195 Ga0501259_000537 3300049688 Bacteria 6070
196 Ga0501225_0000661 3300049705 Bacteria 10742
197 Ga0501035_0104644 3300049822 Bacteria 2482
198 nmdc:mga0k408_14449_c1 3300050493 Bacteria 4351
199 nmdc:mga05p37_2503_c1 3300050507 Bacteria 14485
200 nmdc:mga09592_18187_c1 3300050508 Bacteria 5763
201 nmdc:mga09592_67540_c1 3300050508 Bacteria 3033
202 nmdc:mga0qj67_121656_c1 3300050509 Bacteria 2112
203 nmdc:mga0qj67_42896_c1 3300050509 Bacteria 3561
204 nmdc:mga06r32_257969_c1 3300050510 Bacteria 1731
205 nmdc:mga06r32_53136_c1 3300050510 Bacteria 3881
206 nmdc:mga08y16_353146_c1 3300050511 Bacteria 1510
207 nmdc:mga0n895_86440_c1 3300050512 Bacteria 3132
208 nmdc:mga0a205_50118_c1 3300050515 Bacteria 4031
209 Ga0500646_0006873 3300053090 Bacteria 2897
210 Ga0500583_0000049 3300053092 Bacteria 77456
211 Ga0500652_077747 3300053131 Bacteria 1380
212 Ga0500589_003380 3300053147 Bacteria 5721
213 Ga0500622_0029457 3300053156 Unclassified 2887
214 Ga0500622_0067789 3300053156 Bacteria 1809
215 Ga0500611_010853 3300053727 Unclassified 1490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10012336 Ga0157374_100123364 308
2 3300013306 Ga0163162_10155996 Ga0163162_101559962 309
3 3300049688 Ga0501259_000537 Ga0501259_000537_396_1340 312
4 3300014745 Ga0157377_10024074 Ga0157377_100240742 313
5 3300005844 Ga0068862_100433847 Ga0068862_1004338472 314
6 3300025900 Ga0207710_10002540 Ga0207710_100025405 314
7 3300026116 Ga0207674_10056508 Ga0207674_100565083 314
8 3300026118 Ga0207675_100220672 Ga0207675_1002206722 314
9 3300047320 Ga0495672_0035063 Ga0495672_0035063_458_1408 314
10 3300014326 Ga0157380_10081696 Ga0157380_100816961 315
11 3300009094 Ga0111539_10014537 Ga0111539_1001453710 319
12 3300009553 Ga0105249_10023933 Ga0105249_100239338 319
13 3300013306 Ga0163162_10198625 Ga0163162_101986252 319
14 3300013308 Ga0157375_10005940 Ga0157375_1000594010 319
15 3300014326 Ga0157380_10004719 Ga0157380_100047199 319
16 3300014745 Ga0157377_10002627 Ga0157377_100026274 319
17 3300025940 Ga0207691_10365669 Ga0207691_103656691 321
18 3300006871 Ga0075434_100087995 Ga0075434_1000879953 324
19 3300050512 nmdc:mga0n895_86440_c1 nmdc:mga0n895_86440_c1_123_1154 324
20 3300050510 nmdc:mga06r32_53136_c1 nmdc:mga06r32_53136_c1_927_1922 328
21 3300005290 Ga0065712_10075946 Ga0065712_100759464 329
22 3300005334 Ga0068869_100307536 Ga0068869_1003075361 329
23 3300005340 Ga0070689_100015575 Ga0070689_1000155758 329
24 3300005347 Ga0070668_100061663 Ga0070668_1000616632 329
25 3300005353 Ga0070669_100047508 Ga0070669_1000475081 329
26 3300005364 Ga0070673_100028950 Ga0070673_1000289503 329
27 3300005543 Ga0070672_100087240 Ga0070672_1000872404 329
28 3300005577 Ga0068857_100298135 Ga0068857_1002981352 329
29 3300005840 Ga0068870_10006650 Ga0068870_100066505 329
30 3300005844 Ga0068862_100011611 Ga0068862_1000116115 329
31 3300025908 Ga0207643_10016983 Ga0207643_100169836 329
32 3300025933 Ga0207706_10069004 Ga0207706_100690043 329
33 3300025936 Ga0207670_10104129 Ga0207670_101041291 329
34 3300025940 Ga0207691_10082225 Ga0207691_100822252 329
35 3300025961 Ga0207712_10304807 Ga0207712_103048072 329
36 3300026116 Ga0207674_10008842 Ga0207674_100088421 329
37 3300026118 Ga0207675_100017196 Ga0207675_1000171969 329
38 3300027907 Ga0207428_10059226 Ga0207428_100592264 329
39 3300028380 Ga0268265_10038258 Ga0268265_100382584 329
40 3300005331 Ga0070670_100238674 Ga0070670_1002386741 331
41 3300025925 Ga0207650_10307600 Ga0207650_103076001 331
42 3300031456 Ga0307513_10158750 Ga0307513_101587502 331
43 iso_pu_bacteria 2818991460 2819679701 331
44 3300003322 rootL2_10019977 rootL2_100199773 332
45 3300003323 rootH1_10159534 rootH1_101595342 333
46 3300005564 Ga0070664_100268134 Ga0070664_1002681342 333
47 3300005577 Ga0068857_100041367 Ga0068857_1000413672 333
48 3300009545 Ga0105237_10011311 Ga0105237_100113119 333
49 3300025914 Ga0207671_10032230 Ga0207671_100322302 333
50 3300025949 Ga0207667_10008777 Ga0207667_100087779 333
51 3300026116 Ga0207674_10021267 Ga0207674_100212676 333
52 iso_pu_bacteria 2929177148 2929180502 333
53 iso_pu_bacteria 2945977869 2945982886 333
54 iso_pu_bacteria 2946013367 2946017722 333
55 3300003354 JGI25160J50197_1005181 JGI25160J50197_10051811 334
56 3300005335 Ga0070666_10042082 Ga0070666_100420822 334
57 3300025208 Ga0209436_101838 Ga0209436_1018383 334
58 3300025284 Ga0209130_1001119 Ga0209130_100111915 334
59 3300025302 Ga0207426_1000446 Ga0207426_100044636 334
60 3300025903 Ga0207680_10084204 Ga0207680_100842042 334
61 3300026142 Ga0207698_10256182 Ga0207698_102561822 334
62 3300030521 Ga0307511_10000033 Ga0307511_1000003319 334
63 3300046616 Ga0495668_0004553 Ga0495668_0004553_4463_5476 334
64 3300050511 nmdc:mga08y16_353146_c1 nmdc:mga08y16_353146_c1_206_1276 334
65 3300003354 JGI25160J50197_1017944 JGI25160J50197_10179442 335
66 3300006847 Ga0075431_100009835 Ga0075431_1000098352 335
67 3300013102 Ga0157371_10161059 Ga0157371_101610592 335
68 3300025302 Ga0207426_1000002 Ga0207426_1000002509 335
69 3300044658 Ga0466972_0109946 Ga0466972_0109946_88_1104 335
70 3300045049 Ga0466959_0065368 Ga0466959_0065368_482_1498 335
71 3300049569 Ga0501032_0017895 Ga0501032_0017895_2539_3555 335
72 3300049570 Ga0501033_0196524 Ga0501033_0196524_363_1379 335
73 3300049573 Ga0501037_0005464 Ga0501037_0005464_6943_7959 335
74 3300049581 Ga0501047_0355928 Ga0501047_0355928_252_1268 335
75 3300049822 Ga0501035_0104644 Ga0501035_0104644_280_1296 335
76 3300005577 Ga0068857_100119461 Ga0068857_1001194612 336
77 3300013297 Ga0157378_10096165 Ga0157378_100961652 336
78 3300013306 Ga0163162_10044393 Ga0163162_100443932 336
79 3300013306 Ga0163162_10124012 Ga0163162_101240122 336
80 3300013307 Ga0157372_10102790 Ga0157372_101027904 336
81 3300025945 Ga0207679_10024842 Ga0207679_100248422 336
82 3300031251 Ga0265327_10000031 Ga0265327_1000003195 336
83 3300031251 Ga0265327_10009252 Ga0265327_100092523 336
84 3300031251 Ga0265327_10014995 Ga0265327_100149952 336
85 3300049580 Ga0501046_0204969 Ga0501046_0204969_87_1106 336
86 3300049581 Ga0501047_0333114 Ga0501047_0333114_68_1087 336
87 3300001979 JGI24740J21852_10027459 JGI24740J21852_100274591 337
88 3300003323 rootH1_10279876 rootH1_102798762 337
89 3300005331 Ga0070670_100219187 Ga0070670_1002191872 337
90 3300005354 Ga0070675_100059451 Ga0070675_1000594514 337
91 3300005985 Ga0081539_10001239 Ga0081539_1000123910 337
92 3300006852 Ga0075433_10013220 Ga0075433_100132207 337
93 3300009147 Ga0114129_10018289 Ga0114129_100182896 337
94 3300009545 Ga0105237_10042757 Ga0105237_100427573 337
95 3300010375 Ga0105239_10005938 Ga0105239_100059382 337
96 3300013307 Ga0157372_10070115 Ga0157372_100701153 337
97 3300025914 Ga0207671_10141767 Ga0207671_101417672 337
98 3300025926 Ga0207659_10022404 Ga0207659_100224042 337
99 3300050493 nmdc:mga0k408_14449_c1 nmdc:mga0k408_14449_c1_2683_3705 337
100 3300050507 nmdc:mga05p37_2503_c1 nmdc:mga05p37_2503_c1_8950_9972 337
101 3300050515 nmdc:mga0a205_50118_c1 nmdc:mga0a205_50118_c1_2516_3565 337
102 iso_pu_bacteria 2883068021 2883069108 337
103 3300005330 Ga0070690_100151451 Ga0070690_1001514511 338
104 3300005344 Ga0070661_100074712 Ga0070661_1000747122 338
105 3300005354 Ga0070675_100325270 Ga0070675_1003252701 338
106 3300005366 Ga0070659_100002659 Ga0070659_1000026596 338
107 3300005456 Ga0070678_100116538 Ga0070678_1001165383 338
108 3300005457 Ga0070662_100104461 Ga0070662_1001044612 338
109 3300005458 Ga0070681_10252511 Ga0070681_102525111 338
110 3300005539 Ga0068853_100132928 Ga0068853_1001329281 338
111 3300005547 Ga0070693_100120734 Ga0070693_1001207342 338
112 3300005563 Ga0068855_100020810 Ga0068855_1000208108 338
113 3300005564 Ga0070664_100019126 Ga0070664_1000191266 338
114 3300005578 Ga0068854_100027962 Ga0068854_1000279622 338
115 3300005614 Ga0068856_100017904 Ga0068856_1000179041 338
116 3300005616 Ga0068852_100278588 Ga0068852_1002785881 338
117 3300005841 Ga0068863_100482022 Ga0068863_1004820221 338
118 3300006358 Ga0068871_100137372 Ga0068871_1001373724 338
119 3300006847 Ga0075431_100271259 Ga0075431_1002712591 338
120 3300013100 Ga0157373_10024593 Ga0157373_100245936 338
121 3300013102 Ga0157371_10155646 Ga0157371_101556462 338
122 3300013296 Ga0157374_10024469 Ga0157374_100244697 338
123 3300013297 Ga0157378_10016504 Ga0157378_100165048 338
124 3300014969 Ga0157376_10083734 Ga0157376_100837341 338
125 3300025909 Ga0207705_10117643 Ga0207705_101176432 338
126 3300025912 Ga0207707_10148335 Ga0207707_101483352 338
127 3300025919 Ga0207657_10051135 Ga0207657_100511355 338
128 3300025932 Ga0207690_10032485 Ga0207690_100324851 338
129 3300025933 Ga0207706_10001298 Ga0207706_1000129817 338
130 3300025945 Ga0207679_10114012 Ga0207679_101140123 338
131 3300025949 Ga0207667_10190478 Ga0207667_101904782 338
132 3300025981 Ga0207640_10085193 Ga0207640_100851931 338
133 3300026023 Ga0207677_10245690 Ga0207677_102456901 338
134 3300026041 Ga0207639_10117947 Ga0207639_101179472 338
135 3300026078 Ga0207702_10035124 Ga0207702_100351245 338
136 3300026116 Ga0207674_10086044 Ga0207674_100860443 338
137 3300050510 nmdc:mga06r32_257969_c1 nmdc:mga06r32_257969_c1_323_1453 338
138 3300053090 Ga0500646_0006873 Ga0500646_0006873_1510_2538 338
139 3300053147 Ga0500589_003380 Ga0500589_003380_3814_4842 338
140 3300053156 Ga0500622_0029457 Ga0500622_0029457_1573_2601 338
141 3300053156 Ga0500622_0067789 Ga0500622_0067789_247_1275 338
142 3300053727 Ga0500611_010853 Ga0500611_010853_152_1180 338
143 3300003322 rootL2_10089812 rootL2_100898123 339
144 3300005355 Ga0070671_100212446 Ga0070671_1002124461 339
145 3300010375 Ga0105239_10005067 Ga0105239_100050672 339
146 3300014969 Ga0157376_10021514 Ga0157376_100215142 339
147 3300053092 Ga0500583_0000049 Ga0500583_0000049_25965_26996 339
148 3300005985 Ga0081539_10056335 Ga0081539_100563352 340
149 3300013102 Ga0157371_10097272 Ga0157371_100972722 340
150 3300005616 Ga0068852_100401935 Ga0068852_1004019352 341
151 3300006237 Ga0097621_100149593 Ga0097621_1001495931 341
152 3300025945 Ga0207679_10091570 Ga0207679_100915702 341
153 3300026118 Ga0207675_100030395 Ga0207675_1000303953 341
154 3300049521 Ga0501298_002399 Ga0501298_002399_1278_2309 341
155 3300049649 Ga0501198_000192 Ga0501198_000192_6336_7367 341
156 3300049654 Ga0501207_000627 Ga0501207_000627_2066_3097 341
157 3300049661 Ga0501217_000871 Ga0501217_000871_3691_4722 341
158 3300049668 Ga0501233_006117 Ga0501233_006117_1095_2126 341
159 3300049669 Ga0501235_001047 Ga0501235_001047_3796_4827 341
160 3300049674 Ga0501242_001288 Ga0501242_001288_644_1675 341
161 3300049675 Ga0501243_000386 Ga0501243_000386_2997_4028 341
162 3300049705 Ga0501225_0000661 Ga0501225_0000661_2044_3075 341
163 3300005289 Ga0065704_10105177 Ga0065704_101051772 342
164 3300005290 Ga0065712_10007939 Ga0065712_100079392 342
165 3300005367 Ga0070667_100266842 Ga0070667_1002668422 342
166 3300005466 Ga0070685_10011316 Ga0070685_100113162 342
167 3300005471 Ga0070698_100056737 Ga0070698_1000567372 342
168 3300005471 Ga0070698_100223393 Ga0070698_1002233932 342
169 3300005617 Ga0068859_100053234 Ga0068859_1000532344 342
170 3300005843 Ga0068860_100175570 Ga0068860_1001755702 342
171 3300006844 Ga0075428_100000817 Ga0075428_1000008174 342
172 3300006844 Ga0075428_100067683 Ga0075428_1000676833 342
173 3300006846 Ga0075430_100042694 Ga0075430_1000426942 342
174 3300006846 Ga0075430_100054330 Ga0075430_1000543305 342
175 3300006847 Ga0075431_100062774 Ga0075431_1000627743 342
176 3300006880 Ga0075429_100006495 Ga0075429_1000064956 342
177 3300006931 Ga0097620_100053233 Ga0097620_1000532334 342
178 3300009147 Ga0114129_10130386 Ga0114129_101303863 342
179 3300009553 Ga0105249_10000440 Ga0105249_1000044011 342
180 3300014325 Ga0163163_10209416 Ga0163163_102094161 342
181 3300014326 Ga0157380_10132295 Ga0157380_101322952 342
182 3300014326 Ga0157380_10160561 Ga0157380_101605612 342
183 3300014969 Ga0157376_10173775 Ga0157376_101737752 342
184 3300017792 Ga0163161_10204176 Ga0163161_102041761 342
185 3300025925 Ga0207650_10015656 Ga0207650_100156563 342
186 3300025936 Ga0207670_10009425 Ga0207670_100094255 342
187 3300025961 Ga0207712_10012055 Ga0207712_100120551 342
188 3300026075 Ga0207708_10235107 Ga0207708_102351072 342
189 3300026116 Ga0207674_10253317 Ga0207674_102533171 342
190 3300026118 Ga0207675_100198412 Ga0207675_1001984123 342
191 3300028381 Ga0268264_10013712 Ga0268264_100137126 342
192 3300031824 Ga0307413_10099982 Ga0307413_100999822 342
193 3300041507 Ga0451851_0378835 Ga0451851_0378835_31_1083 342
194 3300041512 Ga0451853_0783540 Ga0451853_0783540_3564_4616 342
195 3300050508 nmdc:mga09592_18187_c1 nmdc:mga09592_18187_c1_4455_5525 342
196 3300050508 nmdc:mga09592_67540_c1 nmdc:mga09592_67540_c1_678_1748 342
197 3300050509 nmdc:mga0qj67_121656_c1 nmdc:mga0qj67_121656_c1_119_1189 342
198 3300050509 nmdc:mga0qj67_42896_c1 nmdc:mga0qj67_42896_c1_388_1458 342
199 3300053131 Ga0500652_077747 Ga0500652_077747_45_1100 342
200 3300005353 Ga0070669_100045627 Ga0070669_1000456272 343
201 3300005617 Ga0068859_100021777 Ga0068859_1000217774 343
202 3300005843 Ga0068860_100032647 Ga0068860_1000326472 343
203 3300006931 Ga0097620_100021778 Ga0097620_1000217784 343
204 3300009101 Ga0105247_10005373 Ga0105247_100053736 343
205 3300009553 Ga0105249_10020664 Ga0105249_100206643 343
206 3300009553 Ga0105249_10089561 Ga0105249_100895612 343
207 3300010375 Ga0105239_10135634 Ga0105239_101356343 343
208 3300025961 Ga0207712_10004069 Ga0207712_100040696 343
209 3300025961 Ga0207712_10045550 Ga0207712_100455502 343
210 3300026095 Ga0207676_10042276 Ga0207676_100422762 343
211 3300005347 Ga0070668_100167068 Ga0070668_1001670682 344
212 3300025899 Ga0207642_10066812 Ga0207642_100668121 344
213 2162886011 MRS1b_contig_1249102 MRS1b_0358.00002570 350
214 3300005288 Ga0065714_10090258 Ga0065714_100902582 350
215 3300005290 Ga0065712_10082069 Ga0065712_100820693 350
216 3300005333 Ga0070677_10022370 Ga0070677_100223702 350
217 3300005354 Ga0070675_100016175 Ga0070675_1000161755 350
218 3300005466 Ga0070685_10152761 Ga0070685_101527611 350
219 3300014326 Ga0157380_10017234 Ga0157380_100172343 350
220 3300025926 Ga0207659_10032211 Ga0207659_100322113 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12006

DUF3500

Protein of unknown function (DUF3500)

80

386

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rql-assembly1.cif.gz_M rna polymerase i closed conformation 2 (cc2) 0.6288 278 314
4csd-assembly2.cif.gz_B structure of monomeric ralstonia solanacearum lectin 0.6266 278 308
5o7u-assembly1.cif.gz_A crystal structure of the 7-fluorotryptophan rsl lectin in complex with lewis x tetrasaccharide 0.6124 278 311
7e7t-assembly1.cif.gz_A crystal structure of rsl mutant in complex with sugar ligand 0.6105 276 308
5tuk-assembly2.cif.gz_B crystal structure of tetracycline destructase tet(51) 0.5994 280 321
ID Description Score Start End Superfamily
af_I1MTB0_252_412_2.40.320.10 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.6759 292 323 2.40.320.10
af_O59852_425_576_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6624 292 323 2.60.120.560
af_B8A474_421_760_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6479 297 324 2.130.10.10
af_F4J6T7_705_857_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.6434 277 308 2.60.40.1180
af_Q9ZUH0_58_281_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6197 278 311 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A537KG58-F1-model_v4 DUF3500 domain-containing protein 0.9713 30 339
AF-A0A3D4FUS0-F1-model_v4 DUF3500 domain-containing protein 0.9684 30 338
AF-A0A6L7WLI8-F1-model_v4 DUF3500 domain-containing protein 0.9661 25 244
AF-A0A6N6Q4L5-F1-model_v4 DUF3500 domain-containing protein 0.9649 30 341
AF-A0A142XX59-F1-model_v4 DUF3500 domain-containing protein 0.9639 30 328

Feature Viewer

pLDDT pTM Quality
87.26 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map