F332222

General Info

Members Datasets Scaffolds Average Seq Length
220 137 206 283

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10000998|Ga0105239_1000099820
Length 296
Sequence MRVHTVNTGLFKLDGGAMFGVVPKSIWNKVNPSDDNNLCTWAMRCLLIEEGNKLILVDNGIGNKQDAKFFGHYHLHGPDTLDGSLAALGFHRDDITDVFLTHLHFDHCGGSIVREDDRLVPAFKNATYWSNKRHWKWATEPNDREKASFLNENILPIQESGQLRFIEPEPAGQAISGDIQRSHLETVPNVIIPGLSIRLVNGHTDAMMLPQLTYKGKTLIFMADLLPSIGHIPLPYVMAYDMFPLTTLQEKRAFFDEAIAGDYVLFFEHDPVTECCTLERTEKGVRSSRTFRLDEL

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2739367663 Pedobacter sp. YR510 Isolate Unclassified
3 2818991437 Pedobacter terrae 518 Isolate Unclassified
4 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
9 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
10 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
11 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
12 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
13 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
14 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
134 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
135 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
136 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
137 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.64
Metatranscriptomes 0
Isolates 6.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 0
Rhizoplane 0.45
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 7.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10009652 3300001990 Bacteria 3201
2 JGI24744J21845_10000148 3300002077 Bacteria 10160
3 JGI25154J39366_1000021 3300002738 Bacteria 221559
4 JGI25157J39369_1002591 3300002741 Bacteria 4308
5 JGI25153J46596_10000222 3300003215 Bacteria 49028
6 rootH2_10051822 3300003320 Bacteria 17209
7 rootL2_10101605 3300003322 Bacteria 1327
8 Ga0055530_10000622 3300003791 Bacteria 30682
9 Ga0065714_10064694 3300005288 Bacteria 23013
10 Ga0065714_10066114 3300005288 Bacteria 7587
11 Ga0070676_10000187 3300005328 Bacteria 25771
12 Ga0070683_100036008 3300005329 Bacteria 4527
13 Ga0070666_10029294 3300005335 Bacteria 3618
14 Ga0068868_100087978 3300005338 Bacteria 2499
15 Ga0070660_100194500 3300005339 Bacteria 1643
16 Ga0070669_100071414 3300005353 Bacteria 2568
17 Ga0070671_100005898 3300005355 Bacteria 9762
18 Ga0070673_100009864 3300005364 Bacteria 6433
19 Ga0070673_100381930 3300005364 Bacteria 1256
20 Ga0070678_100001486 3300005456 Bacteria 12520
21 Ga0070662_100000011 3300005457 Bacteria 133652
22 Ga0070662_100357641 3300005457 Bacteria 1197
23 Ga0070662_100545215 3300005457 Bacteria 971
24 Ga0070681_10160699 3300005458 Bacteria 2170
25 Ga0068867_100000770 3300005459 Bacteria 21597
26 Ga0068867_100249684 3300005459 Unclassified 1442
27 Ga0070684_100025165 3300005535 Bacteria 5000
28 Ga0068853_100020524 3300005539 Bacteria 5495
29 Ga0068853_100038702 3300005539 Bacteria 4063
30 Ga0068853_100077674 3300005539 Bacteria 2901
31 Ga0070665_100000003 3300005548 Bacteria 811857
32 Ga0070665_100000018 3300005548 Bacteria 434118
33 Ga0068855_100001866 3300005563 Bacteria 26188
34 Ga0068855_100077187 3300005563 Bacteria 3864
35 Ga0068855_100163340 3300005563 Bacteria 2526
36 Ga0070664_100041168 3300005564 Bacteria 3897
37 Ga0068854_100074766 3300005578 Bacteria 2486
38 Ga0068856_100001307 3300005614 Bacteria 26219
39 Ga0068856_100470422 3300005614 Bacteria 1278
40 Ga0068856_100566514 3300005614 Bacteria 1157
41 Ga0068852_100013508 3300005616 Bacteria 6250
42 Ga0068852_100018545 3300005616 Bacteria 5484
43 Ga0068852_100109188 3300005616 Bacteria 2512
44 Ga0068866_10017685 3300005718 Bacteria 3210
45 Ga0068860_100000040 3300005843 Bacteria 231652
46 Ga0075366_10000990 3300006195 Bacteria 13898
47 Ga0075366_10001635 3300006195 Bacteria 11237
48 Ga0097621_100000485 3300006237 Bacteria 27776
49 Ga0068871_100004975 3300006358 Bacteria 9283
50 Ga0068865_100000563 3300006881 Bacteria 20661
51 Ga0105240_10000764 3300009093 Bacteria 58488
52 Ga0105240_10002370 3300009093 Bacteria 30393
53 Ga0105240_10002578 3300009093 Bacteria 29041
54 Ga0105240_10010140 3300009093 Bacteria 13265
55 Ga0105240_10018847 3300009093 Bacteria 9241
56 Ga0105240_10044591 3300009093 Bacteria 5633
57 Ga0105240_10055426 3300009093 Bacteria 4963
58 Ga0105245_10411827 3300009098 Bacteria 1353
59 Ga0105241_10001542 3300009174 Bacteria 17671
60 Ga0105241_10045282 3300009174 Bacteria 3337
61 Ga0105241_10062457 3300009174 Bacteria 2872
62 Ga0105242_10034366 3300009176 Bacteria 4064
63 Ga0105237_10003315 3300009545 Bacteria 19173
64 Ga0105237_10008127 3300009545 Bacteria 11392
65 Ga0105237_10082515 3300009545 Bacteria 3205
66 Ga0105237_10743284 3300009545 Bacteria 987
67 Ga0105249_10390136 3300009553 Bacteria 1420
68 Ga0105239_10000002 3300010375 Bacteria 610298
69 Ga0105239_10000383 3300010375 Bacteria 64504
70 Ga0105239_10000998 3300010375 Bacteria 39651
71 Ga0105239_10015572 3300010375 Bacteria 8422
72 Ga0105239_10049533 3300010375 Bacteria 4606
73 Ga0105239_10082976 3300010375 Bacteria 3529
74 Ga0105246_10181627 3300011119 Bacteria 1620
75 Ga0157371_10000543 3300013102 Bacteria 44898
76 Ga0157371_10034027 3300013102 Bacteria 3659
77 Ga0157370_10206793 3300013104 Bacteria 1820
78 Ga0157370_10383552 3300013104 Bacteria 1294
79 Ga0157369_10168654 3300013105 Bacteria 2307
80 Ga0157369_10428183 3300013105 Bacteria 1372
81 Ga0157369_10570996 3300013105 Bacteria 1168
82 Ga0157374_10000025 3300013296 Bacteria 245131
83 Ga0157374_10000647 3300013296 Bacteria 30685
84 Ga0157374_10001424 3300013296 Bacteria 20239
85 Ga0157374_10089842 3300013296 Bacteria 2927
86 Ga0157378_10013537 3300013297 Bacteria 7135
87 Ga0157378_10074945 3300013297 Bacteria 3045
88 Ga0163162_10000024 3300013306 Bacteria 188515
89 Ga0163162_10001864 3300013306 Bacteria 19846
90 Ga0163162_10004277 3300013306 Bacteria 13739
91 Ga0157372_10000459 3300013307 Bacteria 44769
92 Ga0157372_10022466 3300013307 Bacteria 6827
93 Ga0157372_10032242 3300013307 Bacteria 5743
94 Ga0157372_10056522 3300013307 Bacteria 4384
95 Ga0157372_10071436 3300013307 Bacteria 3909
96 Ga0157372_10299464 3300013307 Bacteria 1871
97 Ga0157375_10007138 3300013308 Bacteria 9762
98 Ga0157375_10041540 3300013308 Bacteria 4441
99 Ga0157375_10131915 3300013308 Bacteria 2618
100 Ga0182008_10000384 3300014497 Bacteria 34275
101 Ga0157377_10021916 3300014745 Bacteria 3367
102 Ga0157376_10001038 3300014969 Bacteria 18213
103 Ga0157376_10369349 3300014969 Bacteria 1378
104 Ga0182006_1000164 3300015261 Bacteria 70337
105 Ga0182006_1006030 3300015261 Bacteria 5675
106 Ga0207425_1006123 3300025245 Bacteria 3329
107 Ga0209646_1000050 3300025246 Bacteria 296599
108 Ga0209026_1000195 3300025250 Bacteria 84589
109 Ga0209676_1000042 3300025292 Bacteria 424130
110 Ga0209758_1000653 3300025297 Bacteria 52393
111 Ga0209050_1000035 3300025298 Bacteria 424005
112 Ga0207426_1001367 3300025302 Bacteria 20677
113 Ga0207647_10002305 3300025904 Bacteria 14535
114 Ga0207647_10061586 3300025904 Bacteria 2289
115 Ga0207645_10000758 3300025907 Bacteria 26866
116 Ga0207654_10002598 3300025911 Bacteria 9164
117 Ga0207654_10063315 3300025911 Bacteria 2170
118 Ga0207707_10140712 3300025912 Bacteria 2110
119 Ga0207695_10000146 3300025913 Bacteria 209416
120 Ga0207695_10000248 3300025913 Bacteria 140288
121 Ga0207695_10000260 3300025913 Bacteria 133317
122 Ga0207695_10003083 3300025913 Bacteria 23862
123 Ga0207695_10012585 3300025913 Bacteria 10139
124 Ga0207695_10351259 3300025913 Bacteria 1362
125 Ga0207671_10002094 3300025914 Bacteria 21819
126 Ga0207671_10011832 3300025914 Bacteria 7061
127 Ga0207671_10013966 3300025914 Bacteria 6372
128 Ga0207671_10524534 3300025914 Bacteria 944
129 Ga0207657_10035243 3300025919 Bacteria 4489
130 Ga0207657_10153994 3300025919 Bacteria 1871
131 Ga0207649_10052333 3300025920 Bacteria 2533
132 Ga0207652_10019292 3300025921 Bacteria 5607
133 Ga0207681_10050405 3300025923 Bacteria 2817
134 Ga0207644_10027277 3300025931 Bacteria 3945
135 Ga0207706_10003796 3300025933 Bacteria 14400
136 Ga0207706_10375920 3300025933 Bacteria 1233
137 Ga0207704_10000041 3300025938 Bacteria 89976
138 Ga0207661_10038586 3300025944 Bacteria 3745
139 Ga0207679_10148197 3300025945 Bacteria 1906
140 Ga0207667_10000270 3300025949 Bacteria 71998
141 Ga0207651_10081112 3300025960 Bacteria 2337
142 Ga0207640_10064084 3300025981 Bacteria 2446
143 Ga0207677_10045050 3300026023 Bacteria 2944
144 Ga0207639_10082407 3300026041 Bacteria 2550
145 Ga0207639_10342108 3300026041 Bacteria 1334
146 Ga0207702_10003684 3300026078 Bacteria 13868
147 Ga0207648_10005037 3300026089 Bacteria 13403
148 Ga0207683_10008127 3300026121 Bacteria 8974
149 Ga0207698_10001917 3300026142 Bacteria 12194
150 Ga0207698_10466322 3300026142 Bacteria 1222
151 Ga0207698_10680327 3300026142 Bacteria 1022
152 Ga0268266_10000026 3300028379 Bacteria 434485
153 Ga0268266_10000137 3300028379 Bacteria 140685
154 Ga0268264_10000019 3300028381 Bacteria 488112
155 Ga0307515_10003557 3300028794 Bacteria 32734
156 Ga0307515_10007640 3300028794 Bacteria 21325
157 Ga0307511_10000182 3300030521 Bacteria 62310
158 Ga0307507_10000023 3300033179 Bacteria 212423
159 Ga0395899_0016929 3300037312 Bacteria 5557
160 Ga0395900_0000014 3300037418 Bacteria 386513
161 Ga0395900_0002301 3300037418 Bacteria 21221
162 Ga0395898_0006177 3300037466 Bacteria 12833
163 Ga0395905_0000241 3300037471 Bacteria 82847
164 Ga0395905_0000278 3300037471 Bacteria 75859
165 Ga0395905_0002623 3300037471 Bacteria 19747
166 Ga0395901_0000582 3300038443 Bacteria 42425
167 Ga0395901_0009402 3300038443 Bacteria 9917
168 Ga0436361_0971561 3300039447 Bacteria 11520
169 Ga0466972_0003113 3300044658 Bacteria 8233
170 Ga0466970_0014078 3300044765 Bacteria 4102
171 Ga0495638_0012943 3300046460 Bacteria 5696
172 Ga0495585_0000018 3300046492 Bacteria 162473
173 Ga0495585_0000436 3300046492 Bacteria 39946
174 Ga0495606_0058181 3300046507 Bacteria 2486
175 Ga0495606_0097277 3300046507 Bacteria 1799
176 Ga0495610_0000233 3300046512 Bacteria 59298
177 Ga0495628_0317651 3300046516 Bacteria 1150
178 Ga0495637_0103812 3300046520 Bacteria 1108
179 Ga0495648_0005117 3300046524 Bacteria 10987
180 Ga0495648_0006127 3300046524 Bacteria 9858
181 Ga0495648_0029101 3300046524 Bacteria 3671
182 Ga0495652_0265677 3300046529 Bacteria 1264
183 Ga0495609_0000834 3300046538 Bacteria 22885
184 Ga0495633_0025237 3300046558 Bacteria 2928
185 Ga0495668_0000010 3300046616 Bacteria 487308
186 Ga0495668_0000114 3300046616 Bacteria 127503
187 Ga0495625_0000282 3300046660 Bacteria 79268
188 Ga0495625_0075027 3300046660 Bacteria 2367
189 Ga0495625_0236951 3300046660 Bacteria 1189
190 Ga0495661_0000429 3300046665 Bacteria 44378
191 Ga0495661_0082931 3300046665 Bacteria 1844
192 Ga0495660_0001218 3300046810 Bacteria 17967
193 Ga0495687_000031 3300047443 Bacteria 274659
194 Ga0495687_002623 3300047443 Bacteria 14107
195 Ga0495686_0000196 3300047472 Bacteria 112875
196 Ga0495686_0051761 3300047472 Bacteria 2576
197 Ga0495682_0033632 3300049460 Bacteria 1892
198 Ga0501034_0000007 3300049571 Bacteria 357805
199 Ga0501034_0178627 3300049571 Bacteria 2088
200 nmdc:mga0k408_1094_c1 3300050493 Bacteria 14844
201 nmdc:mga0k408_803_c1 3300050493 Bacteria 17292
202 Ga0500646_0001132 3300053090 Bacteria 7206
203 Ga0500608_015450 3300053122 Bacteria 3430
204 Ga0500614_002786 3300053123 Bacteria 3850
205 Ga0500618_000038 3300053125 Bacteria 116036
206 Ga0500622_0001181 3300053156 Bacteria 21553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10082515 Ga0105237_100825152 239
2 3300009093 Ga0105240_10002370 Ga0105240_100023704 256
3 3300025913 Ga0207695_10000260 Ga0207695_1000026080 256
4 3300005335 Ga0070666_10029294 Ga0070666_100292942 259
5 3300005539 Ga0068853_100038702 Ga0068853_1000387023 259
6 3300026041 Ga0207639_10342108 Ga0207639_103421082 259
7 3300005457 Ga0070662_100545215 Ga0070662_1005452151 262
8 3300005548 Ga0070665_100000018 Ga0070665_100000018279 262
9 3300006195 Ga0075366_10000990 Ga0075366_1000099013 262
10 3300025921 Ga0207652_10019292 Ga0207652_100192921 262
11 3300046529 Ga0495652_0265677 Ga0495652_0265677_28_816 262
12 iso_pu_bacteria 2929154850 2929158656 267
13 3300053090 Ga0500646_0001132 Ga0500646_0001132_2308_3144 269
14 3300046616 Ga0495668_0000114 Ga0495668_0000114_46109_46945 274
15 3300003320 rootH2_10051822 rootH2_1005182213 275
16 iso_pu_bacteria 2599185184 2599480964 275
17 iso_pu_bacteria 2739367663 2739647596 275
18 iso_pu_bacteria 2818991437 2819547760 275
19 iso_pu_bacteria 2849281842 2849286749 275
20 iso_pu_bacteria 2852623160 2852623451 275
21 iso_pu_bacteria 2883068021 2883069924 275
22 iso_pu_bacteria 2884791551 2884796195 275
23 iso_pu_bacteria 2884933994 2884937650 275
24 iso_pu_bacteria 2904445276 2904447603 275
25 iso_pu_bacteria 2928078545 2928080876 275
26 iso_pu_bacteria 2928147474 2928150217 275
27 iso_pu_bacteria 2932082852 2932088216 275
28 iso_pu_bacteria 2954016120 2954018467 275
29 3300009093 Ga0105240_10000764 Ga0105240_1000076437 276
30 3300025913 Ga0207695_10003083 Ga0207695_1000308316 276
31 3300013306 Ga0163162_10004277 Ga0163162_100042776 277
32 3300049571 Ga0501034_0000007 Ga0501034_0000007_27879_28718 278
33 3300001990 JGI24737J22298_10009652 JGI24737J22298_100096521 279
34 3300002077 JGI24744J21845_10000148 JGI24744J21845_100001485 279
35 3300002738 JGI25154J39366_1000021 JGI25154J39366_1000021130 279
36 3300002741 JGI25157J39369_1002591 JGI25157J39369_10025913 279
37 3300003215 JGI25153J46596_10000222 JGI25153J46596_1000022233 279
38 3300003322 rootL2_10101605 rootL2_101016051 279
39 3300003791 Ga0055530_10000622 Ga0055530_1000062225 279
40 3300005288 Ga0065714_10064694 Ga0065714_1006469414 279
41 3300005288 Ga0065714_10066114 Ga0065714_100661143 279
42 3300005328 Ga0070676_10000187 Ga0070676_1000018712 279
43 3300005329 Ga0070683_100036008 Ga0070683_1000360084 279
44 3300005338 Ga0068868_100087978 Ga0068868_1000879781 279
45 3300005339 Ga0070660_100194500 Ga0070660_1001945002 279
46 3300005353 Ga0070669_100071414 Ga0070669_1000714142 279
47 3300005355 Ga0070671_100005898 Ga0070671_1000058984 279
48 3300005364 Ga0070673_100009864 Ga0070673_1000098642 279
49 3300005364 Ga0070673_100381930 Ga0070673_1003819301 279
50 3300005456 Ga0070678_100001486 Ga0070678_1000014864 279
51 3300005457 Ga0070662_100000011 Ga0070662_10000001151 279
52 3300005457 Ga0070662_100357641 Ga0070662_1003576412 279
53 3300005458 Ga0070681_10160699 Ga0070681_101606993 279
54 3300005459 Ga0068867_100000770 Ga0068867_10000077010 279
55 3300005459 Ga0068867_100249684 Ga0068867_1002496841 279
56 3300005535 Ga0070684_100025165 Ga0070684_1000251653 279
57 3300005539 Ga0068853_100020524 Ga0068853_1000205241 279
58 3300005539 Ga0068853_100077674 Ga0068853_1000776742 279
59 3300005548 Ga0070665_100000003 Ga0070665_100000003139 279
60 3300005563 Ga0068855_100001866 Ga0068855_10000186622 279
61 3300005563 Ga0068855_100077187 Ga0068855_1000771874 279
62 3300005563 Ga0068855_100163340 Ga0068855_1001633402 279
63 3300005564 Ga0070664_100041168 Ga0070664_1000411685 279
64 3300005578 Ga0068854_100074766 Ga0068854_1000747662 279
65 3300005614 Ga0068856_100001307 Ga0068856_10000130722 279
66 3300005614 Ga0068856_100470422 Ga0068856_1004704222 279
67 3300005614 Ga0068856_100566514 Ga0068856_1005665141 279
68 3300005616 Ga0068852_100013508 Ga0068852_1000135082 279
69 3300005616 Ga0068852_100018545 Ga0068852_1000185451 279
70 3300005616 Ga0068852_100109188 Ga0068852_1001091882 279
71 3300005718 Ga0068866_10017685 Ga0068866_100176852 279
72 3300005843 Ga0068860_100000040 Ga0068860_10000004031 279
73 3300006195 Ga0075366_10001635 Ga0075366_100016357 279
74 3300006237 Ga0097621_100000485 Ga0097621_10000048510 279
75 3300006358 Ga0068871_100004975 Ga0068871_1000049753 279
76 3300006881 Ga0068865_100000563 Ga0068865_1000005635 279
77 3300009093 Ga0105240_10002578 Ga0105240_100025784 279
78 3300009093 Ga0105240_10010140 Ga0105240_100101406 279
79 3300009093 Ga0105240_10018847 Ga0105240_100188475 279
80 3300009093 Ga0105240_10044591 Ga0105240_100445916 279
81 3300009093 Ga0105240_10055426 Ga0105240_100554265 279
82 3300009098 Ga0105245_10411827 Ga0105245_104118272 279
83 3300009174 Ga0105241_10001542 Ga0105241_100015426 279
84 3300009174 Ga0105241_10045282 Ga0105241_100452822 279
85 3300009174 Ga0105241_10062457 Ga0105241_100624572 279
86 3300009176 Ga0105242_10034366 Ga0105242_100343663 279
87 3300009545 Ga0105237_10003315 Ga0105237_100033159 279
88 3300009545 Ga0105237_10008127 Ga0105237_100081276 279
89 3300009545 Ga0105237_10743284 Ga0105237_107432842 279
90 3300009553 Ga0105249_10390136 Ga0105249_103901363 279
91 3300010375 Ga0105239_10000002 Ga0105239_10000002375 279
92 3300010375 Ga0105239_10000383 Ga0105239_1000038319 279
93 3300010375 Ga0105239_10000998 Ga0105239_1000099820 279
94 3300010375 Ga0105239_10015572 Ga0105239_100155722 279
95 3300010375 Ga0105239_10049533 Ga0105239_100495333 279
96 3300010375 Ga0105239_10082976 Ga0105239_100829763 279
97 3300011119 Ga0105246_10181627 Ga0105246_101816272 279
98 3300013102 Ga0157371_10000543 Ga0157371_1000054332 279
99 3300013102 Ga0157371_10034027 Ga0157371_100340272 279
100 3300013104 Ga0157370_10206793 Ga0157370_102067931 279
101 3300013104 Ga0157370_10383552 Ga0157370_103835521 279
102 3300013105 Ga0157369_10168654 Ga0157369_101686542 279
103 3300013105 Ga0157369_10428183 Ga0157369_104281832 279
104 3300013105 Ga0157369_10570996 Ga0157369_105709961 279
105 3300013296 Ga0157374_10000025 Ga0157374_10000025203 279
106 3300013296 Ga0157374_10000647 Ga0157374_100006476 279
107 3300013296 Ga0157374_10001424 Ga0157374_100014249 279
108 3300013296 Ga0157374_10089842 Ga0157374_100898423 279
109 3300013297 Ga0157378_10013537 Ga0157378_100135375 279
110 3300013297 Ga0157378_10074945 Ga0157378_100749452 279
111 3300013306 Ga0163162_10000024 Ga0163162_10000024110 279
112 3300013306 Ga0163162_10001864 Ga0163162_100018642 279
113 3300013307 Ga0157372_10000459 Ga0157372_1000045915 279
114 3300013307 Ga0157372_10022466 Ga0157372_100224664 279
115 3300013307 Ga0157372_10032242 Ga0157372_100322426 279
116 3300013307 Ga0157372_10056522 Ga0157372_100565222 279
117 3300013307 Ga0157372_10071436 Ga0157372_100714364 279
118 3300013307 Ga0157372_10299464 Ga0157372_102994642 279
119 3300013308 Ga0157375_10007138 Ga0157375_100071385 279
120 3300013308 Ga0157375_10041540 Ga0157375_100415401 279
121 3300013308 Ga0157375_10131915 Ga0157375_101319151 279
122 3300014497 Ga0182008_10000384 Ga0182008_100003848 279
123 3300014745 Ga0157377_10021916 Ga0157377_100219162 279
124 3300014969 Ga0157376_10001038 Ga0157376_1000103814 279
125 3300014969 Ga0157376_10369349 Ga0157376_103693492 279
126 3300015261 Ga0182006_1000164 Ga0182006_100016457 279
127 3300015261 Ga0182006_1006030 Ga0182006_10060304 279
128 3300025245 Ga0207425_1006123 Ga0207425_10061235 279
129 3300025246 Ga0209646_1000050 Ga0209646_1000050124 279
130 3300025250 Ga0209026_1000195 Ga0209026_100019551 279
131 3300025292 Ga0209676_1000042 Ga0209676_1000042356 279
132 3300025297 Ga0209758_1000653 Ga0209758_100065329 279
133 3300025298 Ga0209050_1000035 Ga0209050_1000035355 279
134 3300025302 Ga0207426_1001367 Ga0207426_10013675 279
135 3300025904 Ga0207647_10002305 Ga0207647_100023059 279
136 3300025904 Ga0207647_10061586 Ga0207647_100615863 279
137 3300025907 Ga0207645_10000758 Ga0207645_100007589 279
138 3300025911 Ga0207654_10002598 Ga0207654_100025983 279
139 3300025911 Ga0207654_10063315 Ga0207654_100633152 279
140 3300025912 Ga0207707_10140712 Ga0207707_101407122 279
141 3300025913 Ga0207695_10000146 Ga0207695_10000146177 279
142 3300025913 Ga0207695_10000248 Ga0207695_1000024879 279
143 3300025913 Ga0207695_10012585 Ga0207695_100125851 279
144 3300025913 Ga0207695_10351259 Ga0207695_103512591 279
145 3300025914 Ga0207671_10002094 Ga0207671_100020945 279
146 3300025914 Ga0207671_10011832 Ga0207671_100118322 279
147 3300025914 Ga0207671_10013966 Ga0207671_100139664 279
148 3300025914 Ga0207671_10524534 Ga0207671_105245342 279
149 3300025919 Ga0207657_10035243 Ga0207657_100352432 279
150 3300025919 Ga0207657_10153994 Ga0207657_101539942 279
151 3300025920 Ga0207649_10052333 Ga0207649_100523332 279
152 3300025923 Ga0207681_10050405 Ga0207681_100504053 279
153 3300025931 Ga0207644_10027277 Ga0207644_100272773 279
154 3300025933 Ga0207706_10003796 Ga0207706_100037961 279
155 3300025933 Ga0207706_10375920 Ga0207706_103759202 279
156 3300025938 Ga0207704_10000041 Ga0207704_1000004175 279
157 3300025944 Ga0207661_10038586 Ga0207661_100385864 279
158 3300025945 Ga0207679_10148197 Ga0207679_101481972 279
159 3300025949 Ga0207667_10000270 Ga0207667_1000027055 279
160 3300025960 Ga0207651_10081112 Ga0207651_100811122 279
161 3300025981 Ga0207640_10064084 Ga0207640_100640842 279
162 3300026023 Ga0207677_10045050 Ga0207677_100450502 279
163 3300026041 Ga0207639_10082407 Ga0207639_100824072 279
164 3300026078 Ga0207702_10003684 Ga0207702_100036847 279
165 3300026089 Ga0207648_10005037 Ga0207648_1000503712 279
166 3300026121 Ga0207683_10008127 Ga0207683_100081273 279
167 3300026142 Ga0207698_10001917 Ga0207698_100019175 279
168 3300026142 Ga0207698_10466322 Ga0207698_104663221 279
169 3300026142 Ga0207698_10680327 Ga0207698_106803271 279
170 3300028379 Ga0268266_10000026 Ga0268266_1000002680 279
171 3300028379 Ga0268266_10000137 Ga0268266_10000137135 279
172 3300028381 Ga0268264_10000019 Ga0268264_1000001952 279
173 3300028794 Ga0307515_10003557 Ga0307515_100035576 279
174 3300028794 Ga0307515_10007640 Ga0307515_1000764010 279
175 3300030521 Ga0307511_10000182 Ga0307511_1000018245 279
176 3300033179 Ga0307507_10000023 Ga0307507_10000023149 279
177 3300037312 Ga0395899_0016929 Ga0395899_0016929_351_1190 279
178 3300037418 Ga0395900_0000014 Ga0395900_0000014_277786_278625 279
179 3300037418 Ga0395900_0002301 Ga0395900_0002301_12412_13251 279
180 3300037466 Ga0395898_0006177 Ga0395898_0006177_9347_10186 279
181 3300037471 Ga0395905_0000241 Ga0395905_0000241_16095_16934 279
182 3300037471 Ga0395905_0000278 Ga0395905_0000278_34573_35433 279
183 3300037471 Ga0395905_0002623 Ga0395905_0002623_2486_3352 279
184 3300038443 Ga0395901_0000582 Ga0395901_0000582_14475_15314 279
185 3300038443 Ga0395901_0009402 Ga0395901_0009402_6103_6963 279
186 3300039447 Ga0436361_0971561 Ga0436361_0971561_9491_10330 279
187 3300044658 Ga0466972_0003113 Ga0466972_0003113_7274_8209 279
188 3300044765 Ga0466970_0014078 Ga0466970_0014078_2997_3860 279
189 3300046460 Ga0495638_0012943 Ga0495638_0012943_3523_4419 279
190 3300046492 Ga0495585_0000018 Ga0495585_0000018_18351_19190 279
191 3300046492 Ga0495585_0000436 Ga0495585_0000436_26229_27068 279
192 3300046507 Ga0495606_0058181 Ga0495606_0058181_1569_2408 279
193 3300046507 Ga0495606_0097277 Ga0495606_0097277_940_1779 279
194 3300046512 Ga0495610_0000233 Ga0495610_0000233_34626_35465 279
195 3300046516 Ga0495628_0317651 Ga0495628_0317651_272_1111 279
196 3300046520 Ga0495637_0103812 Ga0495637_0103812_158_997 279
197 3300046524 Ga0495648_0005117 Ga0495648_0005117_5403_6299 279
198 3300046524 Ga0495648_0006127 Ga0495648_0006127_5866_6705 279
199 3300046524 Ga0495648_0029101 Ga0495648_0029101_2280_3119 279
200 3300046538 Ga0495609_0000834 Ga0495609_0000834_16794_17633 279
201 3300046558 Ga0495633_0025237 Ga0495633_0025237_1104_1943 279
202 3300046616 Ga0495668_0000010 Ga0495668_0000010_143880_144719 279
203 3300046660 Ga0495625_0000282 Ga0495625_0000282_63534_64373 279
204 3300046660 Ga0495625_0075027 Ga0495625_0075027_808_1647 279
205 3300046660 Ga0495625_0236951 Ga0495625_0236951_148_987 279
206 3300046665 Ga0495661_0000429 Ga0495661_0000429_40329_41168 279
207 3300046665 Ga0495661_0082931 Ga0495661_0082931_714_1553 279
208 3300046810 Ga0495660_0001218 Ga0495660_0001218_7011_7850 279
209 3300047443 Ga0495687_000031 Ga0495687_000031_270946_271854 279
210 3300047443 Ga0495687_002623 Ga0495687_002623_10263_11114 279
211 3300047472 Ga0495686_0000196 Ga0495686_0000196_17362_18201 279
212 3300047472 Ga0495686_0051761 Ga0495686_0051761_1279_2118 279
213 3300049460 Ga0495682_0033632 Ga0495682_0033632_959_1798 279
214 3300049571 Ga0501034_0178627 Ga0501034_0178627_435_1274 279
215 3300050493 nmdc:mga0k408_1094_c1 nmdc:mga0k408_1094_c1_1491_2330 279
216 3300050493 nmdc:mga0k408_803_c1 nmdc:mga0k408_803_c1_5623_6462 279
217 3300053122 Ga0500608_015450 Ga0500608_015450_1546_2385 279
218 3300053123 Ga0500614_002786 Ga0500614_002786_904_1743 279
219 3300053125 Ga0500618_000038 Ga0500618_000038_60863_61702 279
220 3300053156 Ga0500622_0001181 Ga0500622_0001181_3164_4060 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

44

269

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3esh-assembly1.cif.gz_A crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314 0.9153 2 274
3esh-assembly1.cif.gz_A crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314 0.8746 2 274
4o98-assembly1.cif.gz_A crystal structure of pseudomonas oleovorans pooph mutant h250i/i263w 0.8356 3 271
4le6-assembly3.cif.gz_E crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.8304 3 275
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8292 2 254
ID Description Score Start End Superfamily
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9232 2 264 3.60.15.10
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9025 2 264 3.60.15.10
af_O81645_523_612_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.872 43 57 3.40.20.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8304 3 275 3.60.15.10
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8045 3 277 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A4Q5UG65-F1-model_v4 MBL fold metallo-hydrolase 0.9831 180 279 GO:0016787
AF-A0A3S1B1W2-F1-model_v4 MBL fold metallo-hydrolase 0.9822 1 279
AF-A0A2W2B822-F1-model_v4 MBL fold metallo-hydrolase 0.977 1 278 GO:0016787
AF-A0A1H3W275-F1-model_v4 Glyoxylase, beta-lactamase superfamily II 0.9746 2 279
AF-A0A4Q5UG65-F1-model_v4 MBL fold metallo-hydrolase 0.9735 180 279 GO:0016787

Feature Viewer

pLDDT pTM Quality
88.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map