F331985

General Info

Members Datasets Scaffolds Average Seq Length
220 172 440 247

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100027830|Ga0070698_1000278303
Length 272
Sequence VSGNEGSFGKFLRVWRPRTSTLVLMTGPLVAILSGAGISTESGIPDYRGPNGLWRRDPEAEKLATYEYYMADPEIRRRSWQARREIWALHAEPNAAHRAIADLDRSGVPVRVITQNVDGLHQLAGMPDRKVLELHGTTHSVVCTACGARTPTRDVIPRIEAGEPDPPCRDCGGILKTATVMFGEELDPAVLGRAAAIARACQVMVAVGTSLQVYPAAGLVAIAAEGGARLVIVNAEPTPYDDMADEVIREPIGTALPRLLPIWPMKSVSDWT

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
12 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
13 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
36 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
37 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
38 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
39 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
40 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
41 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
42 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
43 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
44 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
45 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
46 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
47 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
48 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
49 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
50 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
51 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
52 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
53 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
54 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
60 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
61 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
62 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
63 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
64 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
65 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
66 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
67 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
68 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
86 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
105 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
151 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
152 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
159 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
160 2643221692 Nocardia sp. Root136 Isolate Unclassified
161 2643221714 Streptomyces sp. Root264 Isolate Unclassified
162 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
163 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
164 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
165 2867475112 Streptomyces sp. TM32 Isolate Unclassified
166 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
167 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
168 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
169 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
170 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
171 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
172 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.18
Metatranscriptomes 0.45
Isolates 6.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 1.36
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100027830 3300005471 Bacteria 5874
2 Ga0006562J51391_1055938 3300003578 Bacteria 2530
3 Ga0070671_100335609 3300005355 Bacteria 1289
4 Ga0070714_100104279 3300005435 Bacteria 2502
5 Ga0070711_100523669 3300005439 Unclassified 980
6 Ga0070708_100685201 3300005445 Bacteria 965
7 Ga0070707_100127610 3300005468 Bacteria 2472
8 Ga0070707_100450555 3300005468 Bacteria 1247
9 Ga0068856_100248332 3300005614 Bacteria 1794
10 Ga0068864_100230913 3300005618 Bacteria 1711
11 Ga0081539_10000630 3300005985 Bacteria 71317
12 Ga0070716_100084004 3300006173 Bacteria 1908
13 Ga0097621_100690554 3300006237 Bacteria 939
14 Ga0068871_100528757 3300006358 Bacteria 1066
15 Ga0075431_100150454 3300006847 Bacteria 2397
16 Ga0075433_10392306 3300006852 Bacteria 1225
17 Ga0075435_100233025 3300007076 Bacteria 1564
18 Ga0111539_10088471 3300009094 Bacteria 3639
19 Ga0111539_10127938 3300009094 Bacteria 2975
20 Ga0114129_10793370 3300009147 Bacteria 1209
21 Ga0105239_10571030 3300010375 Bacteria 1289
22 Ga0157372_10298278 3300013307 Bacteria 1875
23 Ga0213871_10081791 3300021441 Bacteria 926
24 Ga0207647_10008344 3300025904 Bacteria 7430
25 Ga0207685_10037155 3300025905 Bacteria 1791
26 Ga0207699_10456504 3300025906 Bacteria 917
27 Ga0207654_10368528 3300025911 Bacteria 992
28 Ga0207693_10113811 3300025915 Bacteria 2123
29 Ga0207646_10006959 3300025922 Bacteria 11595
30 Ga0207646_10040411 3300025922 Bacteria 4193
31 Ga0207664_10212249 3300025929 Bacteria 1675
32 Ga0207664_10725609 3300025929 Bacteria 894
33 Ga0207702_10243822 3300026078 Bacteria 1685
34 Ga0207641_10760298 3300026088 Bacteria 957
35 Ga0307512_10005384 3300030522 Bacteria 13383
36 Ga0307408_100375871 3300031548 Bacteria 1213
37 Ga0316578_10008413 3300031728 Bacteria 5249
38 Ga0307405_10090950 3300031731 Bacteria 2021
39 Ga0307518_10244495 3300031838 Bacteria 1147
40 Ga0307411_10288592 3300032005 Bacteria 1310
41 Ga0307507_10234925 3300033179 Bacteria 1209
42 Ga0307510_10002804 3300033180 Bacteria 19984
43 Ga0373926_0001208 3300035083 Bacteria 7749
44 Ga0373944_0007442 3300035089 Bacteria 2936
45 Ga0373936_0000687 3300035113 Bacteria 11808
46 Ga0373936_0028814 3300035113 Bacteria 2184
47 Ga0373945_0000543 3300035116 Bacteria 10765
48 Ga0373954_0056425 3300035118 Bacteria 1848
49 Ga0373956_0061470 3300035119 Bacteria 1702
50 Ga0373957_0013819 3300035120 Bacteria 2748
51 Ga0373943_0000294 3300035170 Bacteria 20746
52 Ga0373946_0000333 3300035171 Bacteria 15276
53 Ga0373955_0014004 3300035172 Bacteria 3893
54 Ga0316574_0045552 3300035398 Bacteria 2716
55 Ga0316574_0153809 3300035398 Unclassified 1482
56 Ga0373924_0045984 3300035410 Bacteria 1796
57 Ga0373935_0006387 3300035692 Bacteria 7030
58 Ga0373927_0006782 3300035695 Bacteria 7793
59 Ga0373933_0019420 3300035724 Bacteria 3839
60 Ga0373933_0052462 3300035724 Bacteria 2440
61 Ga0373947_0000366 3300035725 Bacteria 25508
62 Ga0373937_0021470 3300036401 Bacteria 5794
63 Ga0373937_0372711 3300036401 Bacteria 1353
64 Ga0373925_0004806 3300037068 Bacteria 10176
65 Ga0395898_0040966 3300037466 Bacteria 4577
66 Ga0436364_0018971 3300037853 Bacteria 3160
67 Ga0400483_214351 3300039062 Bacteria 70978
68 Ga0436361_0559139 3300039447 Unclassified 1559
69 Ga0439449_0046896 3300042007 Bacteria 1600
70 Ga0439457_005696 3300042014 Bacteria 3101
71 Ga0450894_000084 3300042131 Bacteria 15364
72 Ga0450896_000522 3300042133 Bacteria 4047
73 Ga0450898_000676 3300042134 Bacteria 4108
74 Ga0450899_000882 3300042135 Bacteria 3418
75 Ga0450906_002473 3300042145 Bacteria 4042
76 Ga0450908_014102 3300042184 Bacteria 1440
77 Ga0466969_0008204 3300044656 Bacteria 5542
78 Ga0466969_0189781 3300044656 Bacteria 939
79 Ga0466972_0000499 3300044658 Bacteria 19646
80 Ga0466965_0132130 3300044683 Bacteria 1295
81 Ga0466966_0123854 3300044684 Bacteria 1586
82 Ga0466961_0113511 3300044693 Bacteria 1703
83 Ga0466961_0194884 3300044693 Bacteria 1255
84 Ga0466968_0069381 3300044735 Bacteria 1532
85 Ga0466970_0018576 3300044765 Bacteria 3601
86 Ga0466970_0082651 3300044765 Bacteria 1737
87 Ga0451576_0469693 3300045051 Bacteria 1321
88 Ga0466958_0082463 3300045836 Bacteria 1981
89 Ga0466967_0022964 3300045976 Bacteria 5103
90 Ga0466967_0363543 3300045976 Bacteria 1402
91 Ga0495592_0077526 3300046454 Bacteria 2409
92 Ga0495629_0010793 3300046459 Bacteria 6644
93 Ga0495641_0088437 3300046461 Bacteria 1385
94 Ga0495651_0046348 3300046462 Bacteria 3364
95 Ga0495653_0022636 3300046463 Bacteria 5082
96 Ga0495653_0022726 3300046463 Bacteria 5074
97 Ga0495582_0082223 3300046473 Bacteria 1789
98 Ga0495639_0013247 3300046475 Bacteria 3558
99 Ga0495662_0078461 3300046476 Bacteria 1604
100 Ga0495664_0001099 3300046477 Bacteria 14004
101 Ga0495608_0018870 3300046511 Bacteria 4752
102 Ga0495618_0069185 3300046514 Bacteria 2244
103 Ga0495620_0094017 3300046515 Bacteria 1200
104 Ga0495628_0058844 3300046516 Bacteria 3019
105 Ga0495628_0113465 3300046516 Bacteria 2083
106 Ga0495630_0030048 3300046517 Bacteria 4040
107 Ga0495665_0037388 3300046531 Bacteria 2591
108 Ga0495640_0009323 3300046533 Bacteria 7644
109 Ga0495640_0158848 3300046533 Bacteria 1450
110 Ga0495667_0011780 3300046559 Bacteria 5924
111 Ga0495667_0082055 3300046559 Bacteria 2095
112 Ga0495634_0019164 3300046642 Bacteria 4863
113 Ga0495611_0023078 3300046648 Bacteria 2697
114 Ga0495625_0077933 3300046660 Bacteria 2314
115 Ga0495635_0004215 3300046663 Bacteria 9974
116 Ga0495657_0016314 3300046675 Bacteria 5413
117 Ga0495657_0070694 3300046675 Bacteria 2280
118 Ga0495599_0037161 3300046678 Bacteria 3059
119 Ga0495646_0041269 3300046680 Bacteria 2836
120 Ga0495613_0013113 3300046689 Bacteria 6159
121 Ga0495624_0000781 3300046690 Bacteria 25096
122 Ga0495624_0054348 3300046690 Bacteria 2525
123 Ga0495589_0092390 3300046794 Bacteria 1469
124 Ga0495600_0097294 3300046809 Bacteria 1919
125 Ga0495600_0140429 3300046809 Bacteria 1567
126 Ga0495581_0007309 3300047315 Bacteria 6390
127 Ga0495581_0256448 3300047315 Bacteria 1023
128 Ga0495604_0016083 3300047317 Bacteria 5976
129 Ga0495636_0003250 3300047318 Bacteria 6301
130 Ga0495674_0000657 3300047319 Bacteria 32403
131 Ga0495676_0011725 3300047321 Bacteria 7905
132 Ga0495680_0013166 3300047322 Bacteria 7227
133 Ga0495680_0060009 3300047322 Bacteria 2934
134 Ga0495687_000608 3300047443 Bacteria 41847
135 Ga0495684_0000656 3300047471 Bacteria 27821
136 Ga0495684_0075198 3300047471 Bacteria 2566
137 Ga0495593_0048683 3300047673 Bacteria 2252
138 Ga0495602_0080248 3300048088 Bacteria 2749
139 Ga0495614_0037316 3300048089 Bacteria 2085
140 Ga0496108_0355406 3300048911 Bacteria 1279
141 Ga0496111_0345755 3300048914 Bacteria 1101
142 Ga0496115_0019890 3300048918 Bacteria 5173
143 Ga0501031_0073502 3300049568 Bacteria 2226
144 Ga0501031_0134901 3300049568 Bacteria 1612
145 Ga0501032_0007109 3300049569 Bacteria 8196
146 Ga0501032_0042037 3300049569 Bacteria 3102
147 Ga0501033_0029333 3300049570 Bacteria 4135
148 Ga0501033_0044956 3300049570 Bacteria 3287
149 Ga0501033_0160689 3300049570 Bacteria 1617
150 Ga0501034_0027563 3300049571 Bacteria 5777
151 Ga0501034_0283115 3300049571 Unclassified 1597
152 Ga0501036_0035061 3300049572 Bacteria 4244
153 Ga0501036_0072700 3300049572 Bacteria 2907
154 Ga0501037_0019488 3300049573 Bacteria 5004
155 Ga0501038_0028744 3300049574 Bacteria 4937
156 Ga0501038_0463477 3300049574 Bacteria 973
157 Ga0501039_0004034 3300049575 Bacteria 11034
158 Ga0501039_0108485 3300049575 Bacteria 2170
159 Ga0501041_0032172 3300049577 Bacteria 3170
160 Ga0501041_0180204 3300049577 Bacteria 1322
161 Ga0501042_0004768 3300049578 Bacteria 8657
162 Ga0501042_0050176 3300049578 Bacteria 2976
163 Ga0501042_0118791 3300049578 Bacteria 1903
164 Ga0501043_0009507 3300049579 Bacteria 7621
165 Ga0501043_0380761 3300049579 Bacteria 1068
166 Ga0501046_0023553 3300049580 Bacteria 5063
167 Ga0501046_0189314 3300049580 Bacteria 1535
168 Ga0501047_0026229 3300049581 Bacteria 5605
169 Ga0501047_0146972 3300049581 Bacteria 2233
170 Ga0501048_0007985 3300049582 Bacteria 8013
171 Ga0501048_0073831 3300049582 Bacteria 2407
172 Ga0501070_0212836 3300049586 Bacteria 1586
173 Ga0501071_0043440 3300049587 Bacteria 3222
174 Ga0501071_0086788 3300049587 Bacteria 2295
175 Ga0501075_0037155 3300049591 Bacteria 3637
176 Ga0501076_0046925 3300049592 Bacteria 3414
177 Ga0501076_0212352 3300049592 Bacteria 1581
178 Ga0501077_0015625 3300049593 Bacteria 4781
179 Ga0501079_0036301 3300049741 Bacteria 3797
180 Ga0501080_0063594 3300049742 Bacteria 3434
181 Ga0501081_0245648 3300049743 Bacteria 1306
182 Ga0501081_0419055 3300049743 Bacteria 992
183 Ga0501035_0012452 3300049822 Bacteria 7860
184 Ga0501035_0107409 3300049822 Bacteria 2447
185 Ga0501035_0132106 3300049822 Bacteria 2176
186 Ga0501035_0256668 3300049822 Bacteria 1483
187 Ga0501035_0492519 3300049822 Bacteria 1010
188 Ga0501044_0026231 3300049823 Bacteria 6170
189 Ga0501044_0057017 3300049823 Bacteria 4009
190 Ga0501045_0021644 3300049824 Bacteria 4602
191 Ga0501045_0122215 3300049824 Bacteria 1933
192 nmdc:mga05p37_52703_c1 3300050507 Bacteria 5002
193 nmdc:mga06r32_67962_c1 3300050510 Bacteria 3441
194 nmdc:mga06r32_8798_c1 3300050510 Bacteria 9098
195 nmdc:mga0rr50_822664_c1 3300050513 Bacteria 792
196 Ga0495619_0504170 3300053085 Bacteria 832
197 Ga0500560_002256 3300053107 Bacteria 3635
198 Ga0500569_009569 3300053109 Bacteria 2257
199 Ga0500573_0092446 3300053140 Bacteria 1707
200 Ga0500616_0123137 3300053153 Bacteria 1235
201 Ga0500634_0009633 3300053161 Bacteria 4905
202 Ga0501084_0015872 3300054114 Bacteria 6247
203 Ga0501082_0115058 3300060353 Bacteria 2329
204 Ga0501082_0305993 3300060353 Bacteria 1384
205 Ga0466962_0086023 3300061719 Bacteria 1505
206 Ga0530510_0015214 3300061734 Bacteria 5432
207 2554260703 2554235005 Bacteria 6457341
208 2644516150 2643221692 Bacteria 7282860
209 2644631327 2643221714 Bacteria 9015452
210 2812477675 2811994917 Bacteria 7761064
211 2862507760 2862507626 Bacteria 9425308
212 2866554042 2866552031 Bacteria 5824618
213 2867476381 2867475112 Bacteria 6909112
214 2912763890 2912757875 Bacteria 7940295
215 2935395501 2935390628 Bacteria 7043367
216 2946078888 2946072368 Bacteria 8999607
217 2990090403 2990088156 Bacteria 6657676
218 8023626165 8023623736 Bacteria 8593882
219 8025417511 8025413630 Bacteria 7014048
220 8056837013 8056829672 Bacteria 9045328
221 Ga0070698_100027830
222 Ga0006562J51391_1055938
223 Ga0070671_100335609
224 Ga0070714_100104279
225 Ga0070711_100523669
226 Ga0070708_100685201
227 Ga0070707_100127610
228 Ga0070707_100450555
229 Ga0068856_100248332
230 Ga0068864_100230913
231 Ga0081539_10000630
232 Ga0070716_100084004
233 Ga0097621_100690554
234 Ga0068871_100528757
235 Ga0075431_100150454
236 Ga0075433_10392306
237 Ga0075435_100233025
238 Ga0111539_10088471
239 Ga0111539_10127938
240 Ga0114129_10793370
241 Ga0105239_10571030
242 Ga0157372_10298278
243 Ga0213871_10081791
244 Ga0207647_10008344
245 Ga0207685_10037155
246 Ga0207699_10456504
247 Ga0207654_10368528
248 Ga0207693_10113811
249 Ga0207646_10006959
250 Ga0207646_10040411
251 Ga0207664_10212249
252 Ga0207664_10725609
253 Ga0207702_10243822
254 Ga0207641_10760298
255 Ga0307512_10005384
256 Ga0307408_100375871
257 Ga0316578_10008413
258 Ga0307405_10090950
259 Ga0307518_10244495
260 Ga0307411_10288592
261 Ga0307507_10234925
262 Ga0307510_10002804
263 Ga0373926_0001208
264 Ga0373944_0007442
265 Ga0373936_0000687
266 Ga0373936_0028814
267 Ga0373945_0000543
268 Ga0373954_0056425
269 Ga0373956_0061470
270 Ga0373957_0013819
271 Ga0373943_0000294
272 Ga0373946_0000333
273 Ga0373955_0014004
274 Ga0316574_0045552
275 Ga0316574_0153809
276 Ga0373924_0045984
277 Ga0373935_0006387
278 Ga0373927_0006782
279 Ga0373933_0019420
280 Ga0373933_0052462
281 Ga0373947_0000366
282 Ga0373937_0021470
283 Ga0373937_0372711
284 Ga0373925_0004806
285 Ga0395898_0040966
286 Ga0436364_0018971
287 Ga0400483_214351
288 Ga0436361_0559139
289 Ga0439449_0046896
290 Ga0439457_005696
291 Ga0450894_000084
292 Ga0450896_000522
293 Ga0450898_000676
294 Ga0450899_000882
295 Ga0450906_002473
296 Ga0450908_014102
297 Ga0466969_0008204
298 Ga0466969_0189781
299 Ga0466972_0000499
300 Ga0466965_0132130
301 Ga0466966_0123854
302 Ga0466961_0113511
303 Ga0466961_0194884
304 Ga0466968_0069381
305 Ga0466970_0018576
306 Ga0466970_0082651
307 Ga0451576_0469693
308 Ga0466958_0082463
309 Ga0466967_0022964
310 Ga0466967_0363543
311 Ga0495592_0077526
312 Ga0495629_0010793
313 Ga0495641_0088437
314 Ga0495651_0046348
315 Ga0495653_0022636
316 Ga0495653_0022726
317 Ga0495582_0082223
318 Ga0495639_0013247
319 Ga0495662_0078461
320 Ga0495664_0001099
321 Ga0495608_0018870
322 Ga0495618_0069185
323 Ga0495620_0094017
324 Ga0495628_0058844
325 Ga0495628_0113465
326 Ga0495630_0030048
327 Ga0495665_0037388
328 Ga0495640_0009323
329 Ga0495640_0158848
330 Ga0495667_0011780
331 Ga0495667_0082055
332 Ga0495634_0019164
333 Ga0495611_0023078
334 Ga0495625_0077933
335 Ga0495635_0004215
336 Ga0495657_0016314
337 Ga0495657_0070694
338 Ga0495599_0037161
339 Ga0495646_0041269
340 Ga0495613_0013113
341 Ga0495624_0000781
342 Ga0495624_0054348
343 Ga0495589_0092390
344 Ga0495600_0097294
345 Ga0495600_0140429
346 Ga0495581_0007309
347 Ga0495581_0256448
348 Ga0495604_0016083
349 Ga0495636_0003250
350 Ga0495674_0000657
351 Ga0495676_0011725
352 Ga0495680_0013166
353 Ga0495680_0060009
354 Ga0495687_000608
355 Ga0495684_0000656
356 Ga0495684_0075198
357 Ga0495593_0048683
358 Ga0495602_0080248
359 Ga0495614_0037316
360 Ga0496108_0355406
361 Ga0496111_0345755
362 Ga0496115_0019890
363 Ga0501031_0073502
364 Ga0501031_0134901
365 Ga0501032_0007109
366 Ga0501032_0042037
367 Ga0501033_0029333
368 Ga0501033_0044956
369 Ga0501033_0160689
370 Ga0501034_0027563
371 Ga0501034_0283115
372 Ga0501036_0035061
373 Ga0501036_0072700
374 Ga0501037_0019488
375 Ga0501038_0028744
376 Ga0501038_0463477
377 Ga0501039_0004034
378 Ga0501039_0108485
379 Ga0501041_0032172
380 Ga0501041_0180204
381 Ga0501042_0004768
382 Ga0501042_0050176
383 Ga0501042_0118791
384 Ga0501043_0009507
385 Ga0501043_0380761
386 Ga0501046_0023553
387 Ga0501046_0189314
388 Ga0501047_0026229
389 Ga0501047_0146972
390 Ga0501048_0007985
391 Ga0501048_0073831
392 Ga0501070_0212836
393 Ga0501071_0043440
394 Ga0501071_0086788
395 Ga0501075_0037155
396 Ga0501076_0046925
397 Ga0501076_0212352
398 Ga0501077_0015625
399 Ga0501079_0036301
400 Ga0501080_0063594
401 Ga0501081_0245648
402 Ga0501081_0419055
403 Ga0501035_0012452
404 Ga0501035_0107409
405 Ga0501035_0132106
406 Ga0501035_0256668
407 Ga0501035_0492519
408 Ga0501044_0026231
409 Ga0501044_0057017
410 Ga0501045_0021644
411 Ga0501045_0122215
412 nmdc:mga05p37_52703_c1
413 nmdc:mga06r32_67962_c1
414 nmdc:mga06r32_8798_c1
415 nmdc:mga0rr50_822664_c1
416 Ga0495619_0504170
417 Ga0500560_002256
418 Ga0500569_009569
419 Ga0500573_0092446
420 Ga0500616_0123137
421 Ga0500634_0009633
422 Ga0501084_0015872
423 Ga0501082_0115058
424 Ga0501082_0305993
425 Ga0466962_0086023
426 Ga0530510_0015214
427 2554260703
428 2644516150
429 2644631327
430 2812477675
431 2862507760
432 2866554042
433 2867476381
434 2912763890
435 2935395501
436 2946078888
437 2990090403
438 8023626165
439 8025417511
440 8056837013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

35

215

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yc5-assembly1.cif.gz_A sir2-p53 peptide-nicotinamide 0.9083 5 239
3d4b-assembly1.cif.gz_A crystal structure of sir2tm in complex with acetyl p53 peptide and dadme-nad+ 0.9082 5 239
2h2f-assembly1.cif.gz_A the structural basis for sirtuin substrate affinity 0.908 5 239
3jr3-assembly1.cif.gz_A sir2 bound to acetylated peptide 0.9034 5 239
2h4f-assembly1.cif.gz_A sir2-p53 peptide-nad+ 0.9033 5 239
ID Description Score Start End Superfamily
1iciA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9273 5 239 3.40.50.1220
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9258 2 239 3.40.50.1220
1s5pA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9143 3 239 3.40.50.1220
3jr3A02 Alpha Beta;2-Layer Sandwich;SIR2/SIRT2 'Small Domain';SIR2/SIRT2 'Small Domain' 0.9135 115 161 3.30.1600.10
4buzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9051 5 239 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A561QYY1-F1-model_v4 deleted 0.9851 4 240
AF-J2K6V3-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9817 1 240 GO:0017136
GO:0046872
GO:0070403
AF-A0A7W0R1E4-F1-model_v4 NAD-dependent deacetylase 0.9804 68 241 GO:0017136
GO:0046872
GO:0070403
AF-G2PCN4-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.978 3 240 GO:0017136
GO:0046872
GO:0070403
AF-A0A401M8I0-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9776 1 240 GO:0017136
GO:0046872
GO:0070403

Map