F331959

General Info

Members Datasets Scaffolds Average Seq Length
220 179 440 217

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100279220|Ga0070678_1002792201
Length 245
Sequence MYRSTLVPTSYLFRPGFGREHTGEGDPMNDTEVWSAIDDQRRRTADLLEQLSEEEWRHASLCPGWTVRDVAAHLTLQQLRIGDVLAGLLRHPGSLGGMNRMIWLTARHKAEQPVEQLIGELRATVGSRRSNVGVTNLETLIDILVHGQDIAIPLERDLEMATSASATAASRVRSQLGTRTGRVFTDVGVQRFRLIATDTTWSEGDGPEVRGPIGAILLLLTGRLGALHRLTGAGADELRAPFTPA

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
112 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
167 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
168 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
169 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
170 2508501039 Frankia saprophytica CN3 Isolate Nodule
171 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
172 2671180195 Frankia sp. CcI49 Isolate Nodule
173 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
174 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
175 2773857922 Frankia sp. CcI49 Isolate Nodule
176 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
177 2920879853 Kocuria salina CV6 Isolate Unclassified
178 8002784119 Frankia sp. AgB1.9 Isolate Nodule
179 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 0.45
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 1.82
Rhizoplane 6.82
Rhizosphere 78.64
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100279220 3300005456 Bacteria 1412
2 rootL2_10113789 3300003322 Bacteria 2752
3 Ga0070676_10034532 3300005328 Bacteria 2904
4 Ga0070683_100000897 3300005329 Bacteria 22135
5 Ga0070683_100060801 3300005329 Bacteria 3512
6 Ga0070683_100859158 3300005329 Bacteria 870
7 Ga0070683_101106893 3300005329 Unclassified 761
8 Ga0068869_100765857 3300005334 Bacteria 827
9 Ga0070682_100188739 3300005337 Bacteria 1446
10 Ga0068868_100023312 3300005338 Bacteria 4684
11 Ga0070660_100343556 3300005339 Bacteria 1228
12 Ga0070689_100715708 3300005340 Bacteria 875
13 Ga0070661_100024055 3300005344 Bacteria 4370
14 Ga0070692_10078461 3300005345 Bacteria 1773
15 Ga0070668_100002469 3300005347 Bacteria 13618
16 Ga0070675_100058897 3300005354 Bacteria 3168
17 Ga0070659_100064502 3300005366 Bacteria 2899
18 Ga0070714_100022310 3300005435 Bacteria 5191
19 Ga0070663_100022722 3300005455 Bacteria 4197
20 Ga0070678_100413041 3300005456 Bacteria 1175
21 Ga0070662_100031591 3300005457 Bacteria 3717
22 Ga0070681_10242412 3300005458 Bacteria 1716
23 Ga0068867_100302963 3300005459 Bacteria 1318
24 Ga0070707_100279609 3300005468 Bacteria 1622
25 Ga0070679_100926138 3300005530 Bacteria 815
26 Ga0070684_100325920 3300005535 Bacteria 1411
27 Ga0070684_100404840 3300005535 Bacteria 1258
28 Ga0070696_100580880 3300005546 Bacteria 901
29 Ga0070665_101040064 3300005548 Bacteria 831
30 Ga0070664_100000476 3300005564 Bacteria 30248
31 Ga0068857_100033693 3300005577 Bacteria 4530
32 Ga0068852_100096377 3300005616 Bacteria 2659
33 Ga0068859_100316297 3300005617 Bacteria 1655
34 Ga0068864_100076352 3300005618 Bacteria 2928
35 Ga0068861_100124139 3300005719 Bacteria 2087
36 Ga0068870_10121466 3300005840 Bacteria 1505
37 Ga0068870_10660700 3300005840 Bacteria 717
38 Ga0068863_100369614 3300005841 Bacteria 1399
39 Ga0068862_100006563 3300005844 Bacteria 9652
40 Ga0068862_100020798 3300005844 Bacteria 5481
41 Ga0081455_10000182 3300005937 Bacteria 79497
42 Ga0081540_1005301 3300005983 Bacteria 9647
43 Ga0075363_100030773 3300006048 Bacteria 2780
44 Ga0075363_100059182 3300006048 Bacteria 2060
45 Ga0097621_100521125 3300006237 Bacteria 1079
46 Ga0075430_100260152 3300006846 Bacteria 1437
47 Ga0075433_10514624 3300006852 Bacteria 1053
48 Ga0068865_100632804 3300006881 Bacteria 907
49 Ga0097620_100316292 3300006931 Bacteria 1655
50 Ga0111539_10054613 3300009094 Bacteria 4752
51 Ga0111539_10063714 3300009094 Bacteria 4362
52 Ga0105245_10003878 3300009098 Bacteria 13301
53 Ga0105247_10001496 3300009101 Bacteria 16725
54 Ga0114129_10855237 3300009147 Bacteria 1156
55 Ga0105248_10003171 3300009177 Bacteria 18221
56 Ga0105246_10283753 3300011119 Bacteria 1329
57 Ga0157374_10359070 3300013296 Bacteria 1448
58 Ga0163162_10299007 3300013306 Bacteria 1741
59 Ga0157372_11544069 3300013307 Bacteria 765
60 Ga0157375_10124204 3300013308 Bacteria 2694
61 Ga0157375_10267206 3300013308 Bacteria 1872
62 Ga0163163_10088511 3300014325 Bacteria 3108
63 Ga0163163_10346888 3300014325 Bacteria 1540
64 Ga0157377_10056700 3300014745 Bacteria 2226
65 Ga0157379_10000217 3300014968 Bacteria 44642
66 Ga0157379_10003086 3300014968 Bacteria 14091
67 Ga0157376_10324842 3300014969 Bacteria 1464
68 Ga0207710_10000504 3300025900 Bacteria 24301
69 Ga0207699_10379813 3300025906 Bacteria 1002
70 Ga0207645_10041552 3300025907 Bacteria 2942
71 Ga0207643_10129741 3300025908 Bacteria 1499
72 Ga0207649_10025372 3300025920 Bacteria 3455
73 Ga0207646_10235811 3300025922 Bacteria 1653
74 Ga0207687_10007673 3300025927 Bacteria 7087
75 Ga0207700_10397485 3300025928 Bacteria 1207
76 Ga0207664_10004543 3300025929 Bacteria 9408
77 Ga0207706_10029937 3300025933 Bacteria 4858
78 Ga0207665_10487971 3300025939 Bacteria 950
79 Ga0207711_10045693 3300025941 Bacteria 3743
80 Ga0207689_10001179 3300025942 Bacteria 25132
81 Ga0207661_10349967 3300025944 Bacteria 1333
82 Ga0207679_10023871 3300025945 Bacteria 4187
83 Ga0207679_10159788 3300025945 Bacteria 1844
84 Ga0207668_10016020 3300025972 Bacteria 4669
85 Ga0207677_10082501 3300026023 Bacteria 2311
86 Ga0207677_10258659 3300026023 Bacteria 1418
87 Ga0207703_10498788 3300026035 Bacteria 1142
88 Ga0207678_10069948 3300026067 Bacteria 3009
89 Ga0207678_10816548 3300026067 Bacteria 823
90 Ga0207641_10323974 3300026088 Bacteria 1462
91 Ga0207648_10273989 3300026089 Unclassified 1508
92 Ga0207676_10096274 3300026095 Bacteria 2443
93 Ga0207674_10045445 3300026116 Bacteria 4517
94 Ga0207683_10236846 3300026121 Bacteria 1665
95 Ga0207698_10412378 3300026142 Bacteria 1294
96 Ga0268266_10271302 3300028379 Bacteria 1575
97 Ga0268265_10000694 3300028380 Bacteria 33105
98 Ga0268265_10014346 3300028380 Bacteria 5397
99 Ga0307517_10116673 3300028786 Bacteria 1997
100 Ga0307515_10008871 3300028794 Bacteria 19529
101 Ga0307512_10002625 3300030522 Bacteria 22257
102 Ga0307509_10173080 3300031507 Bacteria 2035
103 Ga0307508_10017400 3300031616 Bacteria 6534
104 Ga0307508_10074636 3300031616 Bacteria 2968
105 Ga0307508_10082976 3300031616 Bacteria 2787
106 Ga0307508_10112026 3300031616 Bacteria 2329
107 Ga0307516_10000122 3300031730 Bacteria 91743
108 Ga0307516_10108239 3300031730 Bacteria 2587
109 Ga0307405_10025661 3300031731 Bacteria 3387
110 Ga0307405_10066281 3300031731 Bacteria 2302
111 Ga0307413_10091031 3300031824 Bacteria 1986
112 Ga0307413_10204146 3300031824 Bacteria 1430
113 Ga0307518_10002101 3300031838 Bacteria 14642
114 Ga0307410_10068294 3300031852 Bacteria 2454
115 Ga0307406_10028735 3300031901 Bacteria 3362
116 Ga0307406_10076357 3300031901 Bacteria 2213
117 Ga0307406_10084746 3300031901 Bacteria 2117
118 Ga0307407_10024622 3300031903 Bacteria 3159
119 Ga0307407_10026475 3300031903 Bacteria 3072
120 Ga0307409_100049860 3300031995 Bacteria 3194
121 Ga0307409_100113722 3300031995 Bacteria 2276
122 Ga0307409_100337859 3300031995 Bacteria 1416
123 Ga0307409_100513274 3300031995 Bacteria 1169
124 Ga0307409_100516327 3300031995 Bacteria 1166
125 Ga0307416_100132421 3300032002 Unclassified 2247
126 Ga0307416_100214431 3300032002 Bacteria 1840
127 Ga0307416_100295317 3300032002 Bacteria 1607
128 Ga0307411_10179703 3300032005 Bacteria 1605
129 Ga0307411_10356755 3300032005 Bacteria 1194
130 Ga0307415_100056963 3300032126 Bacteria 2683
131 Ga0307415_100097316 3300032126 Bacteria 2148
132 Ga0307415_100477615 3300032126 Bacteria 1084
133 Ga0373923_0010373 3300035111 Bacteria 3387
134 Ga0373953_0003536 3300035117 Bacteria 4880
135 Ga0373954_0006913 3300035118 Bacteria 4953
136 Ga0373956_0012219 3300035119 Bacteria 3553
137 Ga0373957_0006541 3300035120 Bacteria 3675
138 Ga0373955_0023693 3300035172 Bacteria 3130
139 Ga0373924_0006731 3300035410 Bacteria 4127
140 Ga0373935_0102024 3300035692 Bacteria 1893
141 Ga0373933_0010641 3300035724 Bacteria 5044
142 Ga0373937_0038675 3300036401 Bacteria 4347
143 Ga0372808_007315 3300036459 Bacteria 1507
144 Ga0395901_0400727 3300038443 Bacteria 1410
145 Ga0439466_0140200 3300041411 Bacteria 742
146 Ga0439465_0000430 3300041413 Bacteria 12302
147 Ga0451793_1692205 3300041452 Bacteria 1046
148 Ga0439449_0194028 3300042007 Bacteria 760
149 Ga0466960_0429547 3300044901 Bacteria 765
150 Ga0495592_0020324 3300046454 Bacteria 5051
151 Ga0495651_0023508 3300046462 Bacteria 4791
152 Ga0495653_0022621 3300046463 Bacteria 5084
153 Ga0495664_0073806 3300046477 Bacteria 2040
154 Ga0495608_0016683 3300046511 Bacteria 5081
155 Ga0495618_0010920 3300046514 Bacteria 5500
156 Ga0495628_0083879 3300046516 Bacteria 2473
157 Ga0495630_0034330 3300046517 Bacteria 3788
158 Ga0495652_0013630 3300046529 Bacteria 7316
159 Ga0495665_0046199 3300046531 Bacteria 2313
160 Ga0495640_0020983 3300046533 Bacteria 4802
161 Ga0495667_0017885 3300046559 Bacteria 4788
162 Ga0495634_0102093 3300046642 Bacteria 1852
163 Ga0495635_0016988 3300046663 Bacteria 5081
164 Ga0495635_0106960 3300046663 Bacteria 1911
165 Ga0495657_0029674 3300046675 Bacteria 3834
166 Ga0495599_0028067 3300046678 Bacteria 3526
167 Ga0495623_0036085 3300046679 Bacteria 3168
168 Ga0495646_0026243 3300046680 Bacteria 3659
169 Ga0495646_0186347 3300046680 Bacteria 1136
170 Ga0495658_0150304 3300046683 Bacteria 1430
171 Ga0495658_0182425 3300046683 Bacteria 1303
172 Ga0495624_0286797 3300046690 Bacteria 994
173 Ga0495600_0011531 3300046809 Bacteria 5510
174 Ga0495600_0298452 3300046809 Bacteria 1017
175 Ga0495604_0019793 3300047317 Bacteria 5384
176 Ga0495674_0028554 3300047319 Bacteria 5084
177 Ga0495676_0412351 3300047321 Bacteria 895
178 Ga0495680_0019313 3300047322 Bacteria 5756
179 Ga0495675_0029241 3300047444 Bacteria 3514
180 Ga0495684_0017924 3300047471 Bacteria 5455
181 Ga0495602_0027106 3300048088 Bacteria 5514
182 Ga0496100_0636666 3300048903 Bacteria 830
183 Ga0496102_0033357 3300048905 Bacteria 4626
184 Ga0496102_0273150 3300048905 Bacteria 1594
185 Ga0496103_0088137 3300048906 Bacteria 1957
186 Ga0496104_0082046 3300048907 Bacteria 3075
187 Ga0496105_0025611 3300048908 Bacteria 4804
188 Ga0496108_0206997 3300048911 Bacteria 1702
189 Ga0496109_0001231 3300048912 Bacteria 21278
190 Ga0496110_0001030 3300048913 Bacteria 19604
191 Ga0496111_0018615 3300048914 Bacteria 4813
192 Ga0496113_0040291 3300048916 Bacteria 3442
193 Ga0496114_0118429 3300048917 Bacteria 2275
194 Ga0496114_0234881 3300048917 Bacteria 1611
195 Ga0496115_0080255 3300048918 Bacteria 2656
196 Ga0496119_0004651 3300048922 Bacteria 13533
197 Ga0496119_0020628 3300048922 Bacteria 4799
198 Ga0496120_0000223 3300048923 Bacteria 97882
199 Ga0496124_0221388 3300048927 Bacteria 1423
200 Ga0501268_051067 3300049765 Bacteria 801
201 nmdc:mga03n38_90074_c1 3300050490 Bacteria 1458
202 nmdc:mga05p37_1073792_c1 3300050507 Bacteria 846
203 nmdc:mga0qj67_234866_c1 3300050509 Bacteria 1488
204 nmdc:mga08y16_47439_c1 3300050511 Bacteria 4496
205 Ga0495612_0288606 3300053078 Bacteria 734
206 Ga0500644_0103319 3300053088 Bacteria 1086
207 Ga0500646_0025475 3300053090 Bacteria 1598
208 Ga0500579_121472 3300053143 Bacteria 1264
209 Ga0500600_0103970 3300053149 Bacteria 1493
210 Ga0500633_0135906 3300053160 Bacteria 919
211 2508677126 2508501039 Bacteria 9978592
212 2523387096 2523231044 Bacteria 6434991
213 2671840035 2671180195 Bacteria 9757215
214 2686536697 2684623035 Bacteria 8032739
215 2744954395 2744054611 Bacteria 5611514
216 2774858191 2773857922 Bacteria 9757215
217 2895881690 2895880812 Bacteria 11255272
218 2920881174 2920879853 Bacteria 4216831
219 8002792483 8002784119 Bacteria 9788632
220 8055181255 8055172936 Bacteria 9305943
221 Ga0070678_100279220
222 rootL2_10113789
223 Ga0070676_10034532
224 Ga0070683_100000897
225 Ga0070683_100060801
226 Ga0070683_100859158
227 Ga0070683_101106893
228 Ga0068869_100765857
229 Ga0070682_100188739
230 Ga0068868_100023312
231 Ga0070660_100343556
232 Ga0070689_100715708
233 Ga0070661_100024055
234 Ga0070692_10078461
235 Ga0070668_100002469
236 Ga0070675_100058897
237 Ga0070659_100064502
238 Ga0070714_100022310
239 Ga0070663_100022722
240 Ga0070678_100413041
241 Ga0070662_100031591
242 Ga0070681_10242412
243 Ga0068867_100302963
244 Ga0070707_100279609
245 Ga0070679_100926138
246 Ga0070684_100325920
247 Ga0070684_100404840
248 Ga0070696_100580880
249 Ga0070665_101040064
250 Ga0070664_100000476
251 Ga0068857_100033693
252 Ga0068852_100096377
253 Ga0068859_100316297
254 Ga0068864_100076352
255 Ga0068861_100124139
256 Ga0068870_10121466
257 Ga0068870_10660700
258 Ga0068863_100369614
259 Ga0068862_100006563
260 Ga0068862_100020798
261 Ga0081455_10000182
262 Ga0081540_1005301
263 Ga0075363_100030773
264 Ga0075363_100059182
265 Ga0097621_100521125
266 Ga0075430_100260152
267 Ga0075433_10514624
268 Ga0068865_100632804
269 Ga0097620_100316292
270 Ga0111539_10054613
271 Ga0111539_10063714
272 Ga0105245_10003878
273 Ga0105247_10001496
274 Ga0114129_10855237
275 Ga0105248_10003171
276 Ga0105246_10283753
277 Ga0157374_10359070
278 Ga0163162_10299007
279 Ga0157372_11544069
280 Ga0157375_10124204
281 Ga0157375_10267206
282 Ga0163163_10088511
283 Ga0163163_10346888
284 Ga0157377_10056700
285 Ga0157379_10000217
286 Ga0157379_10003086
287 Ga0157376_10324842
288 Ga0207710_10000504
289 Ga0207699_10379813
290 Ga0207645_10041552
291 Ga0207643_10129741
292 Ga0207649_10025372
293 Ga0207646_10235811
294 Ga0207687_10007673
295 Ga0207700_10397485
296 Ga0207664_10004543
297 Ga0207706_10029937
298 Ga0207665_10487971
299 Ga0207711_10045693
300 Ga0207689_10001179
301 Ga0207661_10349967
302 Ga0207679_10023871
303 Ga0207679_10159788
304 Ga0207668_10016020
305 Ga0207677_10082501
306 Ga0207677_10258659
307 Ga0207703_10498788
308 Ga0207678_10069948
309 Ga0207678_10816548
310 Ga0207641_10323974
311 Ga0207648_10273989
312 Ga0207676_10096274
313 Ga0207674_10045445
314 Ga0207683_10236846
315 Ga0207698_10412378
316 Ga0268266_10271302
317 Ga0268265_10000694
318 Ga0268265_10014346
319 Ga0307517_10116673
320 Ga0307515_10008871
321 Ga0307512_10002625
322 Ga0307509_10173080
323 Ga0307508_10017400
324 Ga0307508_10074636
325 Ga0307508_10082976
326 Ga0307508_10112026
327 Ga0307516_10000122
328 Ga0307516_10108239
329 Ga0307405_10025661
330 Ga0307405_10066281
331 Ga0307413_10091031
332 Ga0307413_10204146
333 Ga0307518_10002101
334 Ga0307410_10068294
335 Ga0307406_10028735
336 Ga0307406_10076357
337 Ga0307406_10084746
338 Ga0307407_10024622
339 Ga0307407_10026475
340 Ga0307409_100049860
341 Ga0307409_100113722
342 Ga0307409_100337859
343 Ga0307409_100513274
344 Ga0307409_100516327
345 Ga0307416_100132421
346 Ga0307416_100214431
347 Ga0307416_100295317
348 Ga0307411_10179703
349 Ga0307411_10356755
350 Ga0307415_100056963
351 Ga0307415_100097316
352 Ga0307415_100477615
353 Ga0373923_0010373
354 Ga0373953_0003536
355 Ga0373954_0006913
356 Ga0373956_0012219
357 Ga0373957_0006541
358 Ga0373955_0023693
359 Ga0373924_0006731
360 Ga0373935_0102024
361 Ga0373933_0010641
362 Ga0373937_0038675
363 Ga0372808_007315
364 Ga0395901_0400727
365 Ga0439466_0140200
366 Ga0439465_0000430
367 Ga0451793_1692205
368 Ga0439449_0194028
369 Ga0466960_0429547
370 Ga0495592_0020324
371 Ga0495651_0023508
372 Ga0495653_0022621
373 Ga0495664_0073806
374 Ga0495608_0016683
375 Ga0495618_0010920
376 Ga0495628_0083879
377 Ga0495630_0034330
378 Ga0495652_0013630
379 Ga0495665_0046199
380 Ga0495640_0020983
381 Ga0495667_0017885
382 Ga0495634_0102093
383 Ga0495635_0016988
384 Ga0495635_0106960
385 Ga0495657_0029674
386 Ga0495599_0028067
387 Ga0495623_0036085
388 Ga0495646_0026243
389 Ga0495646_0186347
390 Ga0495658_0150304
391 Ga0495658_0182425
392 Ga0495624_0286797
393 Ga0495600_0011531
394 Ga0495600_0298452
395 Ga0495604_0019793
396 Ga0495674_0028554
397 Ga0495676_0412351
398 Ga0495680_0019313
399 Ga0495675_0029241
400 Ga0495684_0017924
401 Ga0495602_0027106
402 Ga0496100_0636666
403 Ga0496102_0033357
404 Ga0496102_0273150
405 Ga0496103_0088137
406 Ga0496104_0082046
407 Ga0496105_0025611
408 Ga0496108_0206997
409 Ga0496109_0001231
410 Ga0496110_0001030
411 Ga0496111_0018615
412 Ga0496113_0040291
413 Ga0496114_0118429
414 Ga0496114_0234881
415 Ga0496115_0080255
416 Ga0496119_0004651
417 Ga0496119_0020628
418 Ga0496120_0000223
419 Ga0496124_0221388
420 Ga0501268_051067
421 nmdc:mga03n38_90074_c1
422 nmdc:mga05p37_1073792_c1
423 nmdc:mga0qj67_234866_c1
424 nmdc:mga08y16_47439_c1
425 Ga0495612_0288606
426 Ga0500644_0103319
427 Ga0500646_0025475
428 Ga0500579_121472
429 Ga0500600_0103970
430 Ga0500633_0135906
431 2508677126
432 2523387096
433 2671840035
434 2686536697
435 2744954395
436 2774858191
437 2895881690
438 2920881174
439 8002792483
440 8055181255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

37

135

0.77

PF12867

DinB_2

DinB superfamily

36

147

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.5851 1 179
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.5758 1 179
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.545 1 179
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.5353 1 179
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.4991 6 106
ID Description Score Start End Superfamily
af_P95285_1_214_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6772 9 186 1.20.120.450
af_P95285_1_214_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6241 9 186 1.20.120.450
af_P72040_13_192_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.559 6 167 1.10.30.50
af_P72040_13_192_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.511 6 167 1.10.30.50
af_A0A1D6HWK6_24_175_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4284 3 114 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A239NM83-F1-model_v4 Uncharacterized protein 0.9737 133 182
AF-A0A4Y3W1W9-F1-model_v4 deleted 0.9524 132 186
AF-A0A2T0K7I7-F1-model_v4 Uncharacterized protein (TIGR03083 family) 0.9365 1 188 GO:0046872
AF-A0A7G9RHY6-F1-model_v4 Uncharacterized protein 0.9299 131 189
AF-A0A1I5IUD1-F1-model_v4 Uncharacterized protein 0.9252 86 184

Map